NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F094592

Metagenome / Metatranscriptome Family F094592

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F094592
Family Type Metagenome / Metatranscriptome
Number of Sequences 106
Average Sequence Length 55 residues
Representative Sequence AIQDAPYIVYRRYHLAHESWRLGIVYSLAPPTVGDIQILSAYRAGHEARPHLV
Number of Associated Samples 103
Number of Associated Scaffolds 106

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.94 %
% of genes near scaffold ends (potentially truncated) 99.06 %
% of genes from short scaffolds (< 2000 bps) 89.62 %
Associated GOLD sequencing projects 95
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(22.642 % of family members)
Environment Ontology (ENVO) Unclassified
(37.736 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(40.566 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 16.98%    β-sheet: 32.08%    Coil/Unstructured: 50.94%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 106 Family Scaffolds
PF01476LysM 66.04
PF13560HTH_31 2.83
PF01464SLT 2.83
PF07992Pyr_redox_2 0.94
PF00224PK 0.94
PF00903Glyoxalase 0.94

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 106 Family Scaffolds
COG0469Pyruvate kinaseCarbohydrate transport and metabolism [G] 0.94


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2162886012|MBSR1b_contig_11324112All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes872Open in IMG/M
3300000887|AL16A1W_10022484All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1254Open in IMG/M
3300000887|AL16A1W_10200227All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1266Open in IMG/M
3300001333|A21PFW6_1025661All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1048Open in IMG/M
3300001526|A105W1_1163815All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1166Open in IMG/M
3300004081|Ga0063454_100537680All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes834Open in IMG/M
3300004114|Ga0062593_100648537All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1018Open in IMG/M
3300004114|Ga0062593_102647203All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300004156|Ga0062589_102314157All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300004479|Ga0062595_100602794All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes856Open in IMG/M
3300004643|Ga0062591_101142068All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium754Open in IMG/M
3300005093|Ga0062594_102171916All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes599Open in IMG/M
3300005184|Ga0066671_10095271All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1639Open in IMG/M
3300005293|Ga0065715_10098291All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis3568Open in IMG/M
3300005328|Ga0070676_10212651All Organisms → cellular organisms → Bacteria1273Open in IMG/M
3300005329|Ga0070683_100142426All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes2271Open in IMG/M
3300005355|Ga0070671_101140453All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300005356|Ga0070674_100208942All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1512Open in IMG/M
3300005434|Ga0070709_10352243All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1088Open in IMG/M
3300005440|Ga0070705_101757127All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300005451|Ga0066681_10326914All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes940Open in IMG/M
3300005467|Ga0070706_100219508All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1775Open in IMG/M
3300005536|Ga0070697_100064355All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes2995Open in IMG/M
3300005549|Ga0070704_100329923All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1281Open in IMG/M
3300005549|Ga0070704_100972980All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes766Open in IMG/M
3300005558|Ga0066698_10509258All Organisms → cellular organisms → Bacteria818Open in IMG/M
3300005566|Ga0066693_10024086All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1872Open in IMG/M
3300005598|Ga0066706_10471131All Organisms → cellular organisms → Bacteria1001Open in IMG/M
3300005719|Ga0068861_101042689All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes783Open in IMG/M
3300005843|Ga0068860_101971979All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes605Open in IMG/M
3300005887|Ga0075292_1063053All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300005980|Ga0066798_10073352All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1033Open in IMG/M
3300006894|Ga0079215_11296012All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300006954|Ga0079219_10053142All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1757Open in IMG/M
3300007822|Ga0104325_101607All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1024Open in IMG/M
3300009098|Ga0105245_12343605All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300009143|Ga0099792_10973159All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300009177|Ga0105248_13196964All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300009545|Ga0105237_11945011All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300010146|Ga0126320_1296492All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300010301|Ga0134070_10232362All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes685Open in IMG/M
3300010364|Ga0134066_10068369All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes960Open in IMG/M
3300010397|Ga0134124_11367104All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes733Open in IMG/M
3300010399|Ga0134127_10212152All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1809Open in IMG/M
3300012204|Ga0137374_10389293All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1111Open in IMG/M
3300012206|Ga0137380_11299298All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300012208|Ga0137376_10177300All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1839Open in IMG/M
3300012209|Ga0137379_10826255All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes831Open in IMG/M
3300012210|Ga0137378_11281815All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes649Open in IMG/M
3300012530|Ga0136635_10019463All Organisms → cellular organisms → Bacteria2005Open in IMG/M
3300012925|Ga0137419_10548006All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes924Open in IMG/M
3300012957|Ga0164303_10307919All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes937Open in IMG/M
3300012961|Ga0164302_10802462All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes711Open in IMG/M
3300013307|Ga0157372_12035511All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes660Open in IMG/M
3300014054|Ga0120135_1045695All Organisms → cellular organisms → Bacteria656Open in IMG/M
3300014056|Ga0120125_1035319All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1078Open in IMG/M
3300014487|Ga0182000_10475185All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300015052|Ga0137411_1298719All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes4632Open in IMG/M
3300015245|Ga0137409_11244952All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300018071|Ga0184618_10033495All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1781Open in IMG/M
3300018476|Ga0190274_11229778All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes834Open in IMG/M
3300018482|Ga0066669_10685548All Organisms → cellular organisms → Bacteria902Open in IMG/M
3300019868|Ga0193720_1001784All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes2853Open in IMG/M
3300019870|Ga0193746_1020424All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300019878|Ga0193715_1006598All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes2478Open in IMG/M
3300019879|Ga0193723_1032027All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1581Open in IMG/M
3300019881|Ga0193707_1073877All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1054Open in IMG/M
3300019888|Ga0193751_1229175All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300019996|Ga0193693_1006630All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes2478Open in IMG/M
3300019999|Ga0193718_1103050All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes582Open in IMG/M
3300020008|Ga0193757_1012498All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes833Open in IMG/M
3300020022|Ga0193733_1003364All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae4625Open in IMG/M
3300021413|Ga0193750_1013783All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes2003Open in IMG/M
3300021968|Ga0193698_1007570All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1356Open in IMG/M
3300022694|Ga0222623_10121507All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1017Open in IMG/M
3300022898|Ga0247745_1033412All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes774Open in IMG/M
3300024279|Ga0247692_1062575All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300025905|Ga0207685_10570862All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300025906|Ga0207699_11089162All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300025910|Ga0207684_10559113All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes978Open in IMG/M
3300025912|Ga0207707_11133199All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes636Open in IMG/M
3300025916|Ga0207663_11716281All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300025921|Ga0207652_11140597All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300025928|Ga0207700_11653280All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300025938|Ga0207704_10097850All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1947Open in IMG/M
3300025944|Ga0207661_11831451All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300025945|Ga0207679_11852141All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300025981|Ga0207640_11548175All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300026023|Ga0207677_10678554All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes912Open in IMG/M
3300026078|Ga0207702_11621080All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300026118|Ga0207675_102348064All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300026320|Ga0209131_1134546All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1269Open in IMG/M
3300026323|Ga0209472_1253277All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300026524|Ga0209690_1098518All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1201Open in IMG/M
3300026542|Ga0209805_1252989All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes691Open in IMG/M
3300027775|Ga0209177_10430874All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300028713|Ga0307303_10057128All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes838Open in IMG/M
3300028717|Ga0307298_10275838All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300028811|Ga0307292_10367949All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes608Open in IMG/M
3300028814|Ga0307302_10017132All Organisms → cellular organisms → Bacteria3266Open in IMG/M
3300028872|Ga0307314_10110798All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes759Open in IMG/M
3300031114|Ga0308187_10260747All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes634Open in IMG/M
3300031199|Ga0307495_10251226All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300032180|Ga0307471_101871873All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes750Open in IMG/M
3300033412|Ga0310810_10585004All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1078Open in IMG/M
3300034817|Ga0373948_0166407All Organisms → cellular organisms → Bacteria559Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil22.64%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere10.38%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.49%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil5.66%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost5.66%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere3.77%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.83%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.89%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.89%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere1.89%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.89%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.94%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.94%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.94%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.94%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.94%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.94%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.94%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.94%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.94%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.94%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.94%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.94%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2162886012Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300000887Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-65cm-16A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001333Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A21-PF)- 6 month illuminaEnvironmentalOpen in IMG/M
3300001526Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-5cm-1A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005887Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403EnvironmentalOpen in IMG/M
3300005980Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil leachate replicate DNA2013-203EnvironmentalOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007822Permafrost core soil microbial communities from Svalbard, Norway - sample 2-8-2 SoapdenovoEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300010146Soil microbial communities from California, USA to study soil gas exchange rates - JR-CA-SND metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012530Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ85 (21.06)EnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014054Permafrost microbial communities from Nunavut, Canada - A34_5cm_12MEnvironmentalOpen in IMG/M
3300014056Permafrost microbial communities from Nunavut, Canada - A20_5cm_0MEnvironmentalOpen in IMG/M
3300014487Bulk soil microbial communities from Mexico - Magueyal (Ma) metaGEnvironmentalOpen in IMG/M
3300015052Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019868Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s1EnvironmentalOpen in IMG/M
3300019870Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m1EnvironmentalOpen in IMG/M
3300019878Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2EnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300019881Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2EnvironmentalOpen in IMG/M
3300019888Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2EnvironmentalOpen in IMG/M
3300019996Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a2EnvironmentalOpen in IMG/M
3300019999Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1EnvironmentalOpen in IMG/M
3300020008Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m2EnvironmentalOpen in IMG/M
3300020022Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2EnvironmentalOpen in IMG/M
3300021413Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c1EnvironmentalOpen in IMG/M
3300021968Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c1EnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300022898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5EnvironmentalOpen in IMG/M
3300024279Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK33EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes)EnvironmentalOpen in IMG/M
3300026524Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes)EnvironmentalOpen in IMG/M
3300026542Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300028713Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184EnvironmentalOpen in IMG/M
3300028717Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028872Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204EnvironmentalOpen in IMG/M
3300031114Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031199Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_SEnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300034817Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
MBSR1b_0434.000051802162886012Miscanthus RhizosphereYIIYRRYHLAHESWRLGIVYSIAPPTVGDIQILSAYRAGNEARPHLVDLR
AL16A1W_1002248413300000887PermafrostHLAHESWRLGIVYSVAPPTVGDIQILSAYRAGHEARPHLV*
AL16A1W_1020022733300000887PermafrostNATQRAIQDAPYIIYSRFHLAHESWRMGIVYSVAPPTVGDIQILSAYRAGHEARPHLV*
A21PFW6_102566133300001333PermafrostEICLPDRPLSDIEDDAIQRSIQDAPYIIYRRYHLAHESWRLGIVYSVAPPTVGDIQILSAYRAGHEARPHLV*
A105W1_116381513300001526PermafrostEDDAARRSIQEAPYIIYRRYHLAHESWRLGIVYSVAPPTVGDIQILSAYRAGHEARPHLV
Ga0063454_10053768013300004081SoilAVHKAIQDAPYIIYRRYHLAHESWRLGIVYSISPPTVGDIQILSAYRAGHEARPHLV*
Ga0062593_10064853713300004114SoilLEIEDNAAYKAIQDAPYIIYSRFHLAHESWRLGIVYSVAPPTVGDIQILSAYRAGHEARPHLV*
Ga0062593_10264720313300004114SoilQDAPYIIYKRYHLAHESWRLGIVYSVAPPTVGDILILSAYRAGHEARPHLV*
Ga0062589_10231415723300004156SoilEDNAAYKAIQDAPYIIYSRFHLAHESWRLGIVYSVAPPTVGDIQILSAYRAGHEARPHLV
Ga0062595_10060279433300004479SoilLAEIEDNAVHRAIQDAPYIIYRRYHLAHESWRLGIVYSIAPPTVGDIQILSAYRAGHEARPHLVDLQ*
Ga0062591_10114206813300004643SoilDEAVSKAIQDAPYIIYRRYHLAHESWRLGIVYSLAPPTVGDIQILSAYRAGHESRPRLV*
Ga0062594_10217191633300005093SoilAVLKAIQDAPYIIYRRYHLAHESWRLGIVYSIAPPTVGDIQILSAYRAGHEARPHLV*
Ga0066671_1009527143300005184SoilQRAIQDAPYITYRRYHLAHESWRLGIVYSLAAPTVGDIQILSAYRAGHEARPHLV*
Ga0065715_1009829113300005293Miscanthus RhizosphereYIIYRRYHLAHESWRLGIVYSIAPPTVGDIQILSAYRAGNEARPHLVDLR*
Ga0070676_1021265113300005328Miscanthus RhizosphereSEIEDNAVQRAIQDAPYIVYRRYHLAHESWRLGIVYSLAPPTVGDIQILSAYRAGHEARPHLV*
Ga0070683_10014242643300005329Corn RhizosphereLSDIQDDASRRFIQDAPYIIYRRYHLAHESWRLGIVYSIAPPTVGDIQILSAYRAGHEARPHLV*
Ga0070671_10114045333300005355Switchgrass RhizosphereDNAVQKAIQDAPYITYKRYHLAHESWRLGIVYSIAPPTVGDIQILSAYRAGHEARPHLV*
Ga0070674_10020894213300005356Miscanthus RhizosphereYKRYHLAYASWRLGIVYSLNPPTVGDIQILSAYRAGHEARPHLV*
Ga0070709_1035224333300005434Corn, Switchgrass And Miscanthus RhizosphereIYKRYHLAHESWRLGIVFSVAPPTVGDILILSAYRAGHESRPHLV*
Ga0070705_10175712713300005440Corn, Switchgrass And Miscanthus RhizosphereYLTYRRYHLAHESWRLGIVYSINPPTVGDIQILSAYRAGHEASPHLV*
Ga0066681_1032691413300005451SoilLRRAIQDAPYITYRRYHLAHESWRLGIVYSLAAPTVGDIQILSAYRAGHEARPHLV*
Ga0070706_10021950843300005467Corn, Switchgrass And Miscanthus RhizosphereRYHLAHESWRLGIVYSISPPTVGDIQILSAYRAGHEARPHLV*
Ga0070697_10006435553300005536Corn, Switchgrass And Miscanthus RhizosphereIEDNATQRAIQDAPYIIYRRYHLAHESWRLGIVYSVSPPTVGDIQILSAYRAGHEARPHLV*
Ga0070704_10032992313300005549Corn, Switchgrass And Miscanthus RhizospherePDKPLSEIEDNATQRAIQDAPYIIYRRYHLAHESWRLGIVYSVSPPTVGDIQILSAYRAGHEARPHLV*
Ga0070704_10097298013300005549Corn, Switchgrass And Miscanthus RhizosphereAPYIIYRRYHLAHESWRLGIVYSIAPPTVGDIQILSAYRAGNEARPHLVDLR*
Ga0066698_1050925833300005558SoilAIQDAPYIVYHRYHLAHESWRLGIVYSVAPPTVGDIQILSAYRAGHEARPHLV*
Ga0066693_1002408643300005566SoilTYRRYHLAHESWRLGIVYSLAAPTVGDIQILSAYRAGHEARPHLV*
Ga0066706_1047113133300005598SoilIQDAPYIVYHRYHLAHESWRLGIVYSVTPPTVGDIQILSAYRAGHEARPHLV*
Ga0068861_10104268913300005719Switchgrass RhizosphereRAIQDAPYLTYKRYHLAYASWRLGIVYSLNPPTVGDIQILSAYRAGHEARPHLV*
Ga0068860_10197197933300005843Switchgrass RhizosphereHLAHESWRLGIVYSLTPPTVGDIQILSAYRAGHEARPHLV*
Ga0075292_106305323300005887Rice Paddy SoilRYHLAHESWRLGIVYSIAPPTVGDIQILSAYRAGHEARPHLV*
Ga0066798_1007335233300005980SoilPYIIYSRFHLAHESWRLGIVYSVAPPTVGDIQILSAYRAGHEARPHLV*
Ga0079215_1129601223300006894Agricultural SoilAPYIIYRRYHLAHESWRLGIVYSLAPPTVGDIQILSAYRAGHEARPHLV*
Ga0079219_1005314213300006954Agricultural SoilKPLAEIEDEAIHRAIQDAPYIIYRRYHLAHESWRLGIVYSIAPPTVGDIQVLSAYRAGHEARPHLVDL*
Ga0104325_10160713300007822SoilIYSRFHLAHESWRLGIVYSVAPPTVGDIQILSAYRAGNEARPHLV*
Ga0105245_1234360513300009098Miscanthus RhizosphereLEIEDNAIQKAIQDAPYITYNRYHLAHESWRLGIVYSIAPPTVGDIQILSAYRAGHEARPHLV*
Ga0099792_1097315923300009143Vadose Zone SoilCLPDKPLSEIEDNAVLKAIQEAPYLVYRRYHLAHESWRLGIVYSLAPPTVGDIQILSAYRAGHEARPHLV*
Ga0105248_1319696413300009177Switchgrass RhizosphereKPLLEIEDNAVQKAIQDAPYITYKRYHLAHESWRLGIVYSLTPPTVGDIQILSAYRAGHEARPHLV*
Ga0105237_1194501113300009545Corn RhizosphereIYKRYHLAHESWRLGIVFSVAPPTVGDIQILSAYRAGHESRPHLV*
Ga0126320_129649223300010146SoilRYHLAHESWRLGIVYSIAPPTVGDIQILSAYRAGHEARPHLVDLQ*
Ga0134070_1023236213300010301Grasslands SoilIQKAIQDAPYIVYHRYHLAHESWRLGIVYSVTPPTVGDIQILSAYRAGHEARPHLV*
Ga0134066_1006836933300010364Grasslands SoilHLAHESWRLGIVYSLAAPTVGDIQILSAYRAGHEARPHLV*
Ga0134124_1136710413300010397Terrestrial SoilPLAEIEDDAVDKSIQDAPYIIYRRYHLAHESWRLGIVYSIAPPTVGDIQILSAYRAGNEARPHLVDLR*
Ga0134127_1021215243300010399Terrestrial SoilAIQDAPYIVYRRYHLAHESWRLGIVYSLAPPTVGDIQILSAYRAGHEARPHLV*
Ga0137374_1038929333300012204Vadose Zone SoilIDDDASIAAIQDAPYIIYKRFDLPDEAPRLGIVYAVAAPTVGDIQIISAYRAGEESRPRLA*
Ga0137380_1129929833300012206Vadose Zone SoilRAIQDAPYITYQRYHLAHESWRLGIVYSISPPTVGDIQILSAYRAGHEARPHLV*
Ga0137376_1017730043300012208Vadose Zone SoilIQDAPYITYRRYHLAHESWRLGIVYSLSPPTVGDIQILSAYRAGHEARPHLVV*
Ga0137379_1082625513300012209Vadose Zone SoilLPDKPLLEIEDNALLRAIQDAPYITYQRYHLAHESWRLGIVYSISPPTVGDIQILSAYRAGHEARPHLV*
Ga0137378_1128181513300012210Vadose Zone SoilDAPYITYRRYHLARESWRLGIVYSIAPPTVGDIQILSASRAGHEARPHLV*
Ga0136635_1001946313300012530Polar Desert SandPPPEICLPDKPLSEIEDDAPRRAIQDAPYIIYRRFHLAAESWRLGIVYAVSPPTVGDIQILSAYRAGHESRPRLV*
Ga0137419_1054800613300012925Vadose Zone SoilYLVYRRYHLAHESWRLGIVYSLAPPTVGDIQILSAYRAGHEARPHLV*
Ga0164303_1030791913300012957SoilHRAIQDAPYIIYRRYHLAHESWRLGIVYSIAPPTVGDIQILSAYRAGHEARPHLVDLQ*
Ga0164302_1080246213300012961SoilIEDDAPRRFIQDAPYIIYRRYHLAQESWRLGIVYSIAPPTVGDIQILSAYRAGHEARPHLV*
Ga0157372_1203551133300013307Corn RhizosphereQDAPYLTYKRYHLAYASWRLGIVYSLNPPTVGDIQILSAYRAGHEARPHLV*
Ga0120135_104569533300014054PermafrostAPYIIYKRYHLAHESWRLGIVFSVAPPTVGDILILSAYRAGHESRPHLA*
Ga0120125_103531913300014056PermafrostATQRAIQDAPYIIYSRFHLAHESWRMGIVYSVAPPTVGDIQILSAYRAGHEARPHLV*
Ga0182000_1047518513300014487SoilLAEMEDDAVHKSIQDAPYIIYRRYHLAHESWRLGIVYSIAPPTVGDIQILSAYRAGNEARPHLVDLR*
Ga0137411_129871963300015052Vadose Zone SoilVKRAIQDAPYIVYQRFHLAHESWRLGIVYSIAAPTVGDIQILSAYRAGHEARPHLV*
Ga0137409_1124495223300015245Vadose Zone SoilICLPDKPLSEIEDNAVLRAIQEAPYLVYRRYHLAHESWRLGIVYSLAPPTVGDIQILSAYRAGHEARPHLV*
Ga0184618_1003349513300018071Groundwater SedimentDNAVQLAIQDAPYIVYQRFHLAHESWRLGIVYSIAPPTVGDIQILSAYRAGHEARPRLV
Ga0190274_1122977833300018476SoilESWRLGIVYSLAPPTVGDIQILSAYRAGHEARPHLV
Ga0066669_1068554833300018482Grasslands SoilAVQRAIQDAPYITYKRYHLAHESWRLGIVYSLAPPTVGDIQILSAYRAGHEARPHLV
Ga0193720_100178413300019868SoilDKPLSEIEDNAVKRAIQDAPYLVYQRFHLAHESWRLGIVYSIAAPTVGDIQILSAYRAGHEARPHLV
Ga0193746_102042433300019870SoilLPDKPLSEIEDNAAKKAIQDAPYIIYKRYHLAHESWRLGIVFSVAPPTVGDILILSAYRAGHESRPHLV
Ga0193715_100659813300019878SoilRAIQDAPYIVYGRYHLAHESWRLGIVYSLAPPTVGDIQILSAYRAGHEARPHLV
Ga0193723_103202743300019879SoilDAPYIIYRRYHLAHESWRLGIVYSVAPPTVGDIQILSAYRAGHEARPHLV
Ga0193707_107387713300019881SoilDNATQKAIQDAPYIIYRRYHLAHESWRLGIVYSVAPPTVGDIQILSAYRAGHEARPHLV
Ga0193751_122917513300019888SoilCLPDRPLSDIEDDAVRRPIQDAPYIIYSRYHLAHESWRLGIVYSIAPPTVGDIQMLSAYRAGHEARPHLV
Ga0193693_100663013300019996SoilIIYRRYHLAHESWRLGIVYSVAPPTVGDIQILSAYRAGHEARPHLV
Ga0193718_110305013300019999SoilIIYSRFHLAHESWRLGIVYSVAPPTVGDIQILSAYRAGNEARPHLV
Ga0193757_101249833300020008SoilTQKAIQDAPYIIYRRYHLAHESWRLGIVYSVAPPTVGDIQILSAYRAGHEARPHLV
Ga0193733_100336473300020022SoilDAPYIVYGRYHLAHESWRLGIVYSLAPPTVGDIQILSAYRAGHEARPHLV
Ga0193750_101378343300021413SoilYIIYRRYHLAHESWRLGIVYSIAPPTVGDIQILSAYRAGHEARPHLV
Ga0193698_100757013300021968SoilDNAAMKAIQDAPYIIYKRYHLAHESWRLGIVFSVAPPTVGDILILSAYRAGHESRPHLV
Ga0222623_1012150713300022694Groundwater SedimentHLAHESWRLGIVYSLAPPTVGDIQILSAYRAGHEARPHLV
Ga0247745_103341213300022898SoilKRYHLAQASWRLGIVYSLNPPTVGDIQILSAYRAGHEARPHLV
Ga0247692_106257523300024279SoilIIYKRYHLAHESWRLGIVFSVAPPTVGDIQILSAYRAGHESRPHLV
Ga0207685_1057086213300025905Corn, Switchgrass And Miscanthus RhizosphereAIQDAPYIIYKRYHLAHESWRLGIVFSVAPPTVGDIQILSAYRAGHESRPHLV
Ga0207699_1108916213300025906Corn, Switchgrass And Miscanthus RhizosphereDAPYIIYKRYHLAHESWRLGIVFSVAPPTVGDILILSAYRAGHESRPHLV
Ga0207684_1055911313300025910Corn, Switchgrass And Miscanthus RhizosphereEDNALLKAIQDAPYITYHRYHLAHESWRLGIVYSISPPTVGDIQILSAYRAGHEARPHLV
Ga0207707_1113319933300025912Corn RhizosphereTYKRYHLAHESWRLGIVYSIAPPTVGDIQILSAYRAGHEARPHLV
Ga0207663_1171628123300025916Corn, Switchgrass And Miscanthus RhizospherePLSEIEDNAPRKAIQDAPYIIYKRYHLAHESWRLGIVFSVAPPTVGDILILSAYRAGHESRPHLV
Ga0207652_1114059713300025921Corn RhizosphereRAIQDAPYIVYRRYHLAHESWRLGIVYSLAPPTVGDIQILSAYRAGHEARPHLV
Ga0207700_1165328023300025928Corn, Switchgrass And Miscanthus RhizosphereKAIQDAPYIIYKRYHLAHESWRLGIVFSVAPPTVGDIQILSAYRAGHESRPHLV
Ga0207704_1009785043300025938Miscanthus RhizosphereAIQDAPYLTYKRYHLAYASWRLGIVYSLNPPTVGDIQILSAYRAGHEARPHLV
Ga0207661_1183145133300025944Corn RhizosphereDDAHLTVIQDAPYIIYKRHQLPADSPRLGVVYSLDAPTVGDIQVISAYRAGDESRPKLA
Ga0207679_1185214113300025945Corn RhizosphereDAPYIIYRRYHLAQESWRLGIVYSIAPPTVGDIQILSAYRAGHEARPHLV
Ga0207640_1154817533300025981Corn RhizosphereKPLSEIEDNAVQRAIQDAPYIVYRRYHLAHESWRLGIVYSLAPPTVGDIQILSAYRAGHEARPHLV
Ga0207677_1067855433300026023Miscanthus RhizosphereEIEDNAVLKAIQDAPYIIYRRYHLAHESWRLGIVYSIAPPTVGDIQILSAYRAGHEARPHLV
Ga0207702_1162108013300026078Corn RhizosphereDDAVDKSIQDAPYIIYRRYHLAHESWRLGIVYSIAPPTVGDIQILSAYRAGNEARPHLVDLR
Ga0207675_10234806413300026118Switchgrass RhizosphereERVWRAIQDAPYLTYKRYHLAQASWRLGIVYSLNPPTVGDIQILSAYRAGHEARPHLV
Ga0209131_113454633300026320Grasslands SoilSEIEDNATQRAIQDAPYIIYRRYHLAHESWRLGIVYSVSPPTVGDIQILSAYRAGHEARPHLV
Ga0209472_125327713300026323SoilLRRAIQDAPYITYRRYHLAHESWRLGIVYSLAAPTVGDIQILSAYRAGHEARPHLV
Ga0209690_109851833300026524SoilRYHLAHESWRLGIVYSVTPPTVGDIQILSAYRAGHEARPHLV
Ga0209805_125298933300026542SoilQRAIQDAPYITYKRFHLAHESWRLGIVYSLSPPTVGDIQILSAYRAGHEARPHLV
Ga0209177_1043087423300027775Agricultural SoilKPLAEIEDEAIHRAIQDAPYIIYRRYHLAHESWRLGIVYSIAPPTVGDIQVLSAYRAGHEARPHLVDL
Ga0307303_1005712813300028713SoilCLPDKPLSEIEDNAVQRAIQDAPYIVYGRYHLAHESWRLGIVYSLAPPTVGDIQILSAYRAGHEARPHLV
Ga0307298_1027583833300028717SoilYGRYHLAHESWRLGIVYSLAPPTVGDIQILSAYRAGHEARPHLV
Ga0307292_1036794933300028811SoilAIQDAPYIVYQRFHLAHESWRLGIVYSIAAPTVGDIQILSAYRAGHEARPHLV
Ga0307302_1001713213300028814SoilYHLAHESWRLGIVYSLAPPTVGDIQILSAYRAGHEARPHLV
Ga0307314_1011079813300028872SoilAHESWRLGIVYSLAPPTVGDIQILSAYRAGHEARPHLV
Ga0308187_1026074713300031114SoilQDAPYIVYGRYHLAHESWRLGIVYSLAPPTVGDIQILSAYRAGHEARPHLV
Ga0307495_1025122623300031199SoilPYIIYKRYHLAHESWRLGIVFSVAPPTVGDIQILSAYRAGHESRPHLV
Ga0307471_10187187313300032180Hardwood Forest SoilIQDAPYLTYRRYHLAHESWRLGIVYSINPPTVGDIQILSAYRAGHEARPHLV
Ga0310810_1058500413300033412SoilYIIYRRYHLAHESWRLGIVYSIAPPTVGDIQILSAYRAGHEARPHLVDLQ
Ga0373948_0166407_392_5593300034817Rhizosphere SoilIQDAPYIIYRRYHLAHESWRLGIVYSIAPPTVGDIQILSAYRAGNEARPHLVDLR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.