Metagenome Family F094206

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F094206
Family Type	Metagenome
Number of Sequences	106
Average Sequence Length	42 residues
Representative Sequence	MIDVLYVAGTVLFFALMLGYVAACERLGRSADVERAREDAR
Number of Associated Samples	86
Number of Associated Scaffolds	106

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	74.53 %
% of genes near scaffold ends (potentially truncated)	16.04 %
% of genes from short scaffolds (< 2000 bps)	88.68 %
Associated GOLD sequencing projects	80
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.54

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (83.019 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (13.207 % of family members)
Environment Ontology (ENVO)	Unclassified (28.302 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (46.226 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	Yes	Secondary Structure distribution:	α-helix: 56.52% β-sheet: 0.00% Coil/Unstructured: 43.48%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.54
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.54
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 106 Family Scaffolds
PF09604	Potass_KdpF	33.96
PF03814	KdpA	33.02
PF02518	HATPase_c	24.53
PF00486	Trans_reg_C	2.83
PF00122	E1-E2_ATPase	0.94
PF00702	Hydrolase	0.94

COG ID	Name	Functional Category	% Frequency in 106 Family Scaffolds
COG2060	K+-transporting ATPase, KdpA subunit	Inorganic ion transport and metabolism [P]	33.02
COG0474	Magnesium-transporting ATPase (P-type)	Inorganic ion transport and metabolism [P]	0.94
COG2216	K+ transport ATPase, ATPase subunit KdpB	Inorganic ion transport and metabolism [P]	0.94
COG2217	Cation-transporting P-type ATPase	Inorganic ion transport and metabolism [P]	0.94

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	83.02 %
Unclassified	root	N/A	16.98 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	83.02 %
Unclassified	root	N/A	16.98 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	83.02 %
Unclassified	root	N/A	16.98 %

Name	Rank	Taxonomy	Distribution
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	36.79 %
Unclassified	root	N/A	16.98 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	6.60 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.94 %

Name	Rank	Taxonomy	Distribution
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	36.79 %
Unclassified	root	N/A	16.98 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3.77 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.94 %

Name	Rank	Taxonomy	Distribution
Gemmatimonadetes	class	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes	34.91 %
Unclassified	root	N/A	16.98 %
Clostridia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia	0.94 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.94 %

Name	Rank	Taxonomy	Distribution
Gemmatimonadales	order	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales	34.91 %
Unclassified	root	N/A	16.98 %
Eubacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales	0.94 %
Methylobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae	0.94 %

Name	Rank	Taxonomy	Distribution
Gemmatimonadaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae	34.91 %
Unclassified	root	N/A	16.98 %
Peptococcaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae	0.94 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	0.94 %

Name	Rank	Taxonomy	Distribution
Gemmatimonas	genus	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas	32.08 %
Unclassified	root	N/A	16.98 %
Gemmatirosa	genus	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa	1.89 %
unclassified Methylobacterium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium	0.94 %
Pelotomaculum	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae → Pelotomaculum	0.94 %

Name	Rank	Taxonomy	Distribution
Gemmatimonas aurantiaca	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca	32.08 %
Unclassified	root	N/A	16.98 %
Gemmatirosa kalamazoonesis	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	1.89 %
unclassified Pelotomaculum	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae → Pelotomaculum → unclassified Pelotomaculum	0.94 %
Methylobacterium sp. B1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. B1	0.94 %

Name	Rank	Taxonomy	Distribution
Gemmatimonas aurantiaca T-27	strain	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27	32.08 %
Unclassified	root	N/A	16.98 %
Gemmatirosa kalamazoonesis	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	1.89 %
Pelotomaculum sp. PtaU1.Bin065	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae → Pelotomaculum → unclassified Pelotomaculum → Pelotomaculum sp. PtaU1.Bin065	0.94 %
Methylobacterium sp. B1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. B1	0.94 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2124908041\|P3_CLC_ConsensusfromContig14803	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27	638	Open in IMG/M
2170459009\|GA8DASG01ECRJD	Not Available	513	Open in IMG/M
3300000364\|INPhiseqgaiiFebDRAFT_105512248	All Organisms → cellular organisms → Bacteria	1027	Open in IMG/M
3300004114\|Ga0062593_100822007	All Organisms → cellular organisms → Bacteria	927	Open in IMG/M
3300004633\|Ga0066395_10436387	All Organisms → cellular organisms → Bacteria	744	Open in IMG/M
3300004633\|Ga0066395_10480852	All Organisms → cellular organisms → Bacteria	713	Open in IMG/M
3300005328\|Ga0070676_10182950	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1364	Open in IMG/M
3300005329\|Ga0070683_102313267	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. B1	515	Open in IMG/M
3300005332\|Ga0066388_100086017	All Organisms → cellular organisms → Bacteria	3543	Open in IMG/M
3300005332\|Ga0066388_102147300	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27	1006	Open in IMG/M
3300005332\|Ga0066388_102815149	All Organisms → cellular organisms → Bacteria	889	Open in IMG/M
3300005341\|Ga0070691_10718261	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27	601	Open in IMG/M
3300005347\|Ga0070668_100499490	All Organisms → cellular organisms → Bacteria	1053	Open in IMG/M
3300005434\|Ga0070709_10029735	All Organisms → cellular organisms → Bacteria	3271	Open in IMG/M
3300005434\|Ga0070709_10314743	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27	1147	Open in IMG/M
3300005436\|Ga0070713_100119384	All Organisms → cellular organisms → Bacteria	2310	Open in IMG/M
3300005436\|Ga0070713_100523075	Not Available	1121	Open in IMG/M
3300005529\|Ga0070741_10924316	All Organisms → cellular organisms → Bacteria → Proteobacteria	753	Open in IMG/M
3300005534\|Ga0070735_10571761	All Organisms → cellular organisms → Bacteria	671	Open in IMG/M
3300005538\|Ga0070731_10692472	All Organisms → cellular organisms → Bacteria	677	Open in IMG/M
3300005547\|Ga0070693_101578753	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	515	Open in IMG/M
3300005564\|Ga0070664_101138787	All Organisms → cellular organisms → Bacteria	735	Open in IMG/M
3300005577\|Ga0068857_101768797	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	605	Open in IMG/M
3300005764\|Ga0066903_100165269	All Organisms → cellular organisms → Bacteria	3221	Open in IMG/M
3300005764\|Ga0066903_101668076	All Organisms → cellular organisms → Bacteria	1212	Open in IMG/M
3300005764\|Ga0066903_102875511	All Organisms → cellular organisms → Bacteria	934	Open in IMG/M
3300005764\|Ga0066903_103462189	All Organisms → cellular organisms → Bacteria → Proteobacteria	851	Open in IMG/M
3300005764\|Ga0066903_103686130	All Organisms → cellular organisms → Bacteria	824	Open in IMG/M
3300005764\|Ga0066903_104679804	All Organisms → cellular organisms → Bacteria	728	Open in IMG/M
3300005842\|Ga0068858_100777123	All Organisms → cellular organisms → Bacteria	934	Open in IMG/M
3300005937\|Ga0081455_10106019	All Organisms → cellular organisms → Bacteria	2244	Open in IMG/M
3300006028\|Ga0070717_10675056	All Organisms → cellular organisms → Bacteria	938	Open in IMG/M
3300006175\|Ga0070712_100571752	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27	954	Open in IMG/M
3300006237\|Ga0097621_100930323	Not Available	811	Open in IMG/M
3300006804\|Ga0079221_10370309	All Organisms → cellular organisms → Bacteria → Proteobacteria	874	Open in IMG/M
3300006854\|Ga0075425_100910017	All Organisms → cellular organisms → Bacteria	1005	Open in IMG/M
3300006854\|Ga0075425_102912640	Not Available	525	Open in IMG/M
3300006903\|Ga0075426_11260628	Not Available	561	Open in IMG/M
3300009029\|Ga0066793_10138254	All Organisms → cellular organisms → Bacteria	1420	Open in IMG/M
3300009098\|Ga0105245_10037547	All Organisms → cellular organisms → Bacteria	4307	Open in IMG/M
3300009545\|Ga0105237_11378674	Not Available	711	Open in IMG/M
3300009553\|Ga0105249_12707288	All Organisms → cellular organisms → Bacteria	568	Open in IMG/M
3300009789\|Ga0126307_11135247	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27	632	Open in IMG/M
3300010046\|Ga0126384_11244497	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27	688	Open in IMG/M
3300010047\|Ga0126382_10167398	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27	1526	Open in IMG/M
3300010358\|Ga0126370_10288835	Not Available	1294	Open in IMG/M
3300010358\|Ga0126370_10613139	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27	942	Open in IMG/M
3300010358\|Ga0126370_12238784	All Organisms → cellular organisms → Bacteria	539	Open in IMG/M
3300010359\|Ga0126376_10157947	All Organisms → cellular organisms → Bacteria	1826	Open in IMG/M
3300010362\|Ga0126377_10073412	All Organisms → cellular organisms → Bacteria	3051	Open in IMG/M
3300010362\|Ga0126377_10257087	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27	1703	Open in IMG/M
3300010376\|Ga0126381_104413040	Not Available	544	Open in IMG/M
3300010398\|Ga0126383_10258038	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27	1715	Open in IMG/M
3300010398\|Ga0126383_11524140	All Organisms → cellular organisms → Bacteria	758	Open in IMG/M
3300012931\|Ga0153915_10011526	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	8489	Open in IMG/M
3300012948\|Ga0126375_10911560	All Organisms → cellular organisms → Bacteria	707	Open in IMG/M
3300012960\|Ga0164301_10245546	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27	1172	Open in IMG/M
3300012960\|Ga0164301_10720307	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27	753	Open in IMG/M
3300012964\|Ga0153916_10517231	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27	1265	Open in IMG/M
3300012971\|Ga0126369_10784159	All Organisms → cellular organisms → Bacteria	1034	Open in IMG/M
3300012984\|Ga0164309_11006201	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27	687	Open in IMG/M
3300012987\|Ga0164307_11158309	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27	638	Open in IMG/M
3300013102\|Ga0157371_10618249	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27	807	Open in IMG/M
3300013104\|Ga0157370_11409267	Not Available	627	Open in IMG/M
3300013297\|Ga0157378_11388243	All Organisms → cellular organisms → Bacteria	745	Open in IMG/M
3300013307\|Ga0157372_11051165	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27	942	Open in IMG/M
3300013307\|Ga0157372_11318758	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27	833	Open in IMG/M
3300015371\|Ga0132258_11490874	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27	1708	Open in IMG/M
3300015371\|Ga0132258_13194575	All Organisms → cellular organisms → Bacteria	1130	Open in IMG/M
3300017792\|Ga0163161_11467359	Not Available	598	Open in IMG/M
3300017927\|Ga0187824_10074772	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27	1068	Open in IMG/M
3300017937\|Ga0187809_10005039	All Organisms → cellular organisms → Bacteria	4931	Open in IMG/M
3300017937\|Ga0187809_10083592	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27	1056	Open in IMG/M
3300017966\|Ga0187776_10200397	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27	1255	Open in IMG/M
3300017966\|Ga0187776_10265377	All Organisms → cellular organisms → Bacteria	1104	Open in IMG/M
3300018058\|Ga0187766_10164639	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27	1384	Open in IMG/M
3300018064\|Ga0187773_10346429	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27	844	Open in IMG/M
3300021432\|Ga0210384_11303347	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	631	Open in IMG/M
3300021560\|Ga0126371_13390534	Not Available	538	Open in IMG/M
3300025899\|Ga0207642_10365711	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27	855	Open in IMG/M
3300025907\|Ga0207645_10156143	Not Available	1491	Open in IMG/M
3300025909\|Ga0207705_10130218	All Organisms → cellular organisms → Bacteria	1872	Open in IMG/M
3300025912\|Ga0207707_10679057	Not Available	866	Open in IMG/M
3300025928\|Ga0207700_10583541	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27	994	Open in IMG/M
3300025929\|Ga0207664_10780324	All Organisms → cellular organisms → Bacteria	860	Open in IMG/M
3300025932\|Ga0207690_10418429	All Organisms → cellular organisms → Bacteria	1072	Open in IMG/M
3300025933\|Ga0207706_10306373	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27	1383	Open in IMG/M
3300025938\|Ga0207704_10169538	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae → Pelotomaculum → unclassified Pelotomaculum → Pelotomaculum sp. PtaU1.Bin065	1564	Open in IMG/M
3300025944\|Ga0207661_11630922	Not Available	590	Open in IMG/M
3300025945\|Ga0207679_10914524	All Organisms → cellular organisms → Bacteria	803	Open in IMG/M
3300027869\|Ga0209579_10455478	All Organisms → cellular organisms → Bacteria	694	Open in IMG/M
3300027874\|Ga0209465_10505312	Not Available	603	Open in IMG/M
3300031640\|Ga0318555_10705610	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27	545	Open in IMG/M
3300031719\|Ga0306917_11440634	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27	531	Open in IMG/M
3300031720\|Ga0307469_11998914	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27	563	Open in IMG/M
3300031753\|Ga0307477_10307458	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27	1094	Open in IMG/M
3300031879\|Ga0306919_10758178	All Organisms → cellular organisms → Bacteria	747	Open in IMG/M
3300031902\|Ga0302322_100667548	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1229	Open in IMG/M
3300031910\|Ga0306923_12264334	Not Available	543	Open in IMG/M
3300032174\|Ga0307470_11177851	Not Available	621	Open in IMG/M
3300032205\|Ga0307472_101470746	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27	664	Open in IMG/M
3300032770\|Ga0335085_12364195	Not Available	530	Open in IMG/M
3300033433\|Ga0326726_10099435	All Organisms → cellular organisms → Bacteria	2601	Open in IMG/M
3300033475\|Ga0310811_10224989	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	2256	Open in IMG/M
3300033480\|Ga0316620_10048941	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae	2872	Open in IMG/M
3300033486\|Ga0316624_11620147	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27	597	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	73.58%
Host-Associated	Host-Associated	26.42%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	68.87%
Plants	Host-Associated → Plants	26.42%
Aquatic	Environmental → Aquatic	4.72%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	66.98%
Rhizosphere	Host-Associated → Plants → Rhizosphere	17.92%
Rhizoplane	Host-Associated → Plants → Rhizoplane	7.55%
Freshwater	Environmental → Aquatic → Freshwater	4.72%
Peat	Environmental → Terrestrial → Peat	1.89%
Roots	Host-Associated → Plants → Roots	0.94%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	35.85%
Loam	Environmental → Terrestrial → Soil → Loam	23.58%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	10.38%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	7.55%
Soil	Host-Associated → Plants → Rhizosphere → Soil	7.55%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	5.66%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	4.72%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	1.89%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.89%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.94%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	22.64%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	12.26%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	11.32%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	10.38%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	8.49%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	7.55%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	6.60%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	5.66%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	2.83%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	1.89%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	1.89%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	1.89%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	1.89%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.89%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	0.94%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	0.94%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.94%

Habitat	Taxonomy	Distribution
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	13.21%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	11.32%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	8.49%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	4.72%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	4.72%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	3.77%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	3.77%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	3.77%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	3.77%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	2.83%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	2.83%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	2.83%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	2.83%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	2.83%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	1.89%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.89%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.89%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.89%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	1.89%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	0.94%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.94%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.94%
Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil	0.94%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	0.94%
Grass Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil	0.94%
Prmafrost Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil	0.94%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil	0.94%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	0.94%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	0.94%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.94%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.94%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.94%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.94%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.94%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.94%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.94%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.94%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.94%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.94%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2124908041	Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P3	Environmental	Open in IMG/M
2170459009	Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect DNA Tissue lysis 0-10cm	Environmental	Open in IMG/M
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300004114	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5	Environmental	Open in IMG/M
3300004633	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio	Environmental	Open in IMG/M
3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Host-Associated	Open in IMG/M
3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Environmental	Open in IMG/M
3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Host-Associated	Open in IMG/M
3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Environmental	Open in IMG/M
3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Environmental	Open in IMG/M
3300005529	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1	Environmental	Open in IMG/M
3300005534	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1	Environmental	Open in IMG/M
3300005538	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1	Environmental	Open in IMG/M
3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Environmental	Open in IMG/M
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated	Open in IMG/M
3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated	Open in IMG/M
3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated	Open in IMG/M
3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Environmental	Open in IMG/M
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental	Open in IMG/M
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated	Open in IMG/M
3300006804	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200	Environmental	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006903	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5	Host-Associated	Open in IMG/M
3300009029	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189	Environmental	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300009789	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300012931	Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG	Environmental	Open in IMG/M
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental	Open in IMG/M
3300012960	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG	Environmental	Open in IMG/M
3300012964	Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300012984	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG	Environmental	Open in IMG/M
3300012987	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG	Environmental	Open in IMG/M
3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Host-Associated	Open in IMG/M
3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Host-Associated	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated	Open in IMG/M
3300017927	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4	Environmental	Open in IMG/M
3300017937	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4	Environmental	Open in IMG/M
3300017966	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG	Environmental	Open in IMG/M
3300018058	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG	Environmental	Open in IMG/M
3300018064	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG	Environmental	Open in IMG/M
3300021432	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300027869	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027874	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)	Environmental	Open in IMG/M
3300031640	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23	Environmental	Open in IMG/M
3300031719	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031753	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515	Environmental	Open in IMG/M
3300031879	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)	Environmental	Open in IMG/M
3300031902	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2	Environmental	Open in IMG/M
3300031910	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)	Environmental	Open in IMG/M
3300032174	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M
3300032770	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5	Environmental	Open in IMG/M
3300033433	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN	Environmental	Open in IMG/M
3300033475	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC	Environmental	Open in IMG/M
3300033480	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B	Environmental	Open in IMG/M
3300033486	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
P3_CLC_02258080	2124908041	Soil	IDIIYVAGSVAFFALMVGYVAACERLGRTQEIEERDHESR
F47_06351500	2170459009	Grass Soil	MIDVLYVAGTILFFALMLLYVEGCNRLGRVADVERTPDENAQ
INPhiseqgaiiFebDRAFT_1055122483	3300000364	Soil	MIDILYIAATVLFFALMLAYAAACNRLGRQADVERVPEDDR*
Ga0062593_1008220072	3300004114	Soil	MIDLIYLGSTVAFFALMIAYVAGCDRLGRAHDAERGDGDAR*
Ga0066395_104363872	3300004633	Tropical Forest Soil	MIDLIYVAATVAFFALMLLYVAGCARLGRTADVEQARDEGESQ*
Ga0066395_104808522	3300004633	Tropical Forest Soil	MMDALYLAGTLAFFALMLLYVEGCDRLGRAADVERTPSESER*
Ga0070676_101829501	3300005328	Miscanthus Rhizosphere	MIDVLYVAGTVLFFALMLGYVAACERLGRSADVERAREDAR*
Ga0070683_1023132671	3300005329	Corn Rhizosphere	MIDVLYVAGTVLFFALMIGYAAACDRLGRSADVERAREDGR*
Ga0066388_1000860172	3300005332	Tropical Forest Soil	MIDAIYVTGTILFFALMLLYVEACARLGRAADVERSPEENGR*
Ga0066388_1021473002	3300005332	Tropical Forest Soil	MIDFIYVAATVVFFALMLLYVAACDRLGRSADVERTRDQGEPQ*
Ga0066388_1028151492	3300005332	Tropical Forest Soil	MIDIAYVVGTILFFGLMLLYVAGCDRLGRSADVERVSEEGK*
Ga0070691_107182612	3300005341	Corn, Switchgrass And Miscanthus Rhizosphere	MIDLIYVLASILFFWLMILYVAGCERLGRTGEVERAAETDQ*
Ga0070668_1004994901	3300005347	Switchgrass Rhizosphere	MGTGPMIDVLYVAGTVLFFALMLGYVAACERLGRSADVERAREDAR*
Ga0070709_100297353	3300005434	Corn, Switchgrass And Miscanthus Rhizosphere	VIDILYVLATILFFWLMILYVAGCDRLGRAADVERTTKE*
Ga0070709_103147432	3300005434	Corn, Switchgrass And Miscanthus Rhizosphere	MIDLVYVAGTILFFALMLLYVEGCDRLGRVADVERSPEENAR*
Ga0070713_1001193842	3300005436	Corn, Switchgrass And Miscanthus Rhizosphere	VIDLVYVVATILFFALMIVYVAACDRLGRAADVERGGKEES*
Ga0070713_1005230752	3300005436	Corn, Switchgrass And Miscanthus Rhizosphere	VIDFIYVVTTVLFFALMIAYVAACHRLGGSADVERASKEQR*
Ga0070741_109243162	3300005529	Surface Soil	MLDLVYVAVTLVFFGLMLAYVAGCDRLGRSADVERAAEESR*
Ga0070735_105717613	3300005534	Surface Soil	VLDLIYVAGSIAFFALMILYVAACDRLGRAADVERSEEMKP*
Ga0070731_106924722	3300005538	Surface Soil	MIDLVYIVGTLAFFTLMLLYVAGCDFIGRHADVERAEPERGDSR*
Ga0070693_1015787531	3300005547	Corn, Switchgrass And Miscanthus Rhizosphere	MLDVLYVAGTVLFFALMLGYVAACERLGRSADVERAREDAR*
Ga0070664_1011387871	3300005564	Corn Rhizosphere	METGLVIDVLYVVATVLFFALMLGYVAACNRLGRSADVERAKEDVR*
Ga0068857_1017687973	3300005577	Corn Rhizosphere	RCHASHTTMETGLVIDVLYVVATVLFFALMLGYVAACNRLGRSADVERAKEDVR*
Ga0066903_1001652693	3300005764	Tropical Forest Soil	MIDFIYVAATVAFFALMLLYVAGCDRLGRSADVERAREEGEPQ*
Ga0066903_1016680762	3300005764	Tropical Forest Soil	MIDFIYVIATLAFFGLMLLYVAACDRLGGSADVERAQEQGQ*
Ga0066903_1028755111	3300005764	Tropical Forest Soil	MIDFIYVAATVVFFALMLLYVAACDRLGRSADVERGRDEGAAQ*
Ga0066903_1034621893	3300005764	Tropical Forest Soil	VVGTILFFGLMVLYIAGCDRLGRGADVERVSEEGK*
Ga0066903_1036861302	3300005764	Tropical Forest Soil	VIDILYVVATLLFFALMILYVEACDRLGRAADVERAADGGQR*
Ga0066903_1046798042	3300005764	Tropical Forest Soil	MIDFIYVAATVVFFALMLLYVAACDRLGRSADVERTR
Ga0068858_1007771231	3300005842	Switchgrass Rhizosphere	LYVAGTVLFFALMLGYVAACDRLGRNADVERAKEDVP*
Ga0081455_101060192	3300005937	Tabebuia Heterophylla Rhizosphere	MIDLVYVVGTVVFFVLMLLYIAGCERLGRGADVERTNEEP*
Ga0070717_106750562	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	VIDFIYVLTTVLFFALMVAYVAACQRLGRHADVERATKEQP*
Ga0070712_1005717522	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	MIDALYIAGTSLFFALMLLYVEGCDRLGRVADVERAPDENAR*
Ga0097621_1009303232	3300006237	Miscanthus Rhizosphere	MIDALYVAGTILFFALMLLYVEGCDRLGRVADVERAPDENAR*
Ga0079221_103703092	3300006804	Agricultural Soil	MIDVVYVATTVVFFALMVAYVAACDRLGRKADADRVKSEQP*
Ga0075425_1009100172	3300006854	Populus Rhizosphere	VIDFIYVVATVLFFAVMIGYTAACDRLGRAADVERATKEQS*
Ga0075425_1029126402	3300006854	Populus Rhizosphere	MIDALYIAGTILFFALMLLYVEGCDRLGRVADVERAPDENAR*
Ga0075426_112606281	3300006903	Populus Rhizosphere	VIDFIYVVATVLFFAGMIAYTAACDRLGRAADVERATKEQS*
Ga0066793_101382542	3300009029	Prmafrost Soil	MIDIIYVAGSVAFFALMVGYVAACERLGRTQEIEERDHESR*
Ga0105245_100375474	3300009098	Miscanthus Rhizosphere	MLDVLYVAGTVLFFALMLGYVAACDRLGRNADVERAKEDVP*
Ga0105237_113786743	3300009545	Corn Rhizosphere	MIDAVYVAGTIVFFALMILYAEGCDHLGRGADVERASSEDEAR*
Ga0105249_127072882	3300009553	Switchgrass Rhizosphere	MIDVLYVAGTVLFFALMLGYVAACERLRRSADVERARED
Ga0126307_111352471	3300009789	Serpentine Soil	MIDVVYVVATVLFFALMLGYVAACDRLGRSGDVERAEEDAR*
Ga0126384_112444973	3300010046	Tropical Forest Soil	MIDVVYVAGTMLFFALMILYAEGCDRLGRAADVERGAAEDEPR*
Ga0126382_101673983	3300010047	Tropical Forest Soil	MIDIAYIVGTILFFGLMVLYIAGCDRLGRTADVERAPEEGK*
Ga0126370_102888351	3300010358	Tropical Forest Soil	MIDFIYVAATVVFFALMLLYVAACDRLGRSADVERAREEGEPL*
Ga0126370_106131392	3300010358	Tropical Forest Soil	MMDALYLAGTLAFFALMLLYVEGCDRLGRAADVDRTPSESER*
Ga0126370_122387842	3300010358	Tropical Forest Soil	VIDILYVVATLLFFALMILYVEACDRLGRAADVERAPDGGQR*
Ga0126376_101579472	3300010359	Tropical Forest Soil	MRDAPSDKAAVVIDIIYIVSTIVFFALMIAYVAACDHLGRSADVERGGKEQS*
Ga0126377_100734123	3300010362	Tropical Forest Soil	MLDLVYVLGTVAFFGLMLLYIAGCDRLGRSADVERGSEERK*
Ga0126377_102570873	3300010362	Tropical Forest Soil	MIDLVYVLGTVAFFGLMLLYIAGCDRLGRAADVERGSEEGK*
Ga0126381_1044130403	3300010376	Tropical Forest Soil	VIDFMYVVATVLFFALMIAYVAGCDRLGRSADVERASKDQS*
Ga0126383_102580383	3300010398	Tropical Forest Soil	MIDLIYVAATVAFFALMLLYVAGCAWLGRTADVEQARDEGESQ*
Ga0126383_115241402	3300010398	Tropical Forest Soil	MIDFIYVAATLVFFALMLLYVAACDRLGRSADVERTRDQGEPQ*
Ga0153915_100115267	3300012931	Freshwater Wetlands	MIDVIYVVASVLFFALMLLYVYACDRLGRSAEVERAHEENP*
Ga0126375_109115602	3300012948	Tropical Forest Soil	MIDLVYVLGTVAFFGLMLLYIAGCDRLGRSADVERGSE
Ga0164301_102455462	3300012960	Soil	MSQMIDALYIAGTILFFALMLLYVEGCDRLGRVADVERAPDENTR*
Ga0164301_107203071	3300012960	Soil	DDAFCTSHTTMGTGPMIDVLYVAGTVLFFALMLGYVAACERLGRSADVERAREDAR*
Ga0153916_105172312	3300012964	Freshwater Wetlands	MLDLVYIAVTVLFFALMLLYVHGCDRLGRSADIEEPKP*
Ga0126369_107841591	3300012971	Tropical Forest Soil	MIDFIYVAVTVVFFALMLLYVAACDRLGRSADVERAREEGEPLCRSKAG
Ga0164309_110062011	3300012984	Soil	MSQMIDALYIAGTILFFALMLLYVEGCDRLGRVADVERAPDENAR*
Ga0164307_111583091	3300012987	Soil	MPEHATRISQMIDALHIAGTILFFALMLLYIEGCDRLGRVADVERAPDENTR*
Ga0157371_106182491	3300013102	Corn Rhizosphere	METGLVIDVLYVVATVLFFALMLGYVAACERLGRSADVERAREDAR*
Ga0157370_114092672	3300013104	Corn Rhizosphere	MIDVLYVVATVLFFALMLGYVAACNRLGRSADVERAKEDVR*
Ga0157378_113882432	3300013297	Miscanthus Rhizosphere	MIDVLYVAGTVLFFALMLGYVAACERLGRSADVERAREDVR*
Ga0157372_110511653	3300013307	Corn Rhizosphere	METGLVIDVLYVVATVLFFALMLGYVAACNRLGRSGDVERAKEDVR*
Ga0157372_113187583	3300013307	Corn Rhizosphere	VEATLVIDLIYVLITVLFFVLMAAYVAACYRLGRSADVERASREQP*
Ga0132258_114908742	3300015371	Arabidopsis Rhizosphere	MIDVLYVAATVLFFALMLGYAAACDRLGRNADVERAKEDAR*
Ga0132258_131945752	3300015371	Arabidopsis Rhizosphere	MMDLIYVASTIAFFALMIAYVAGCDRLGRTADAERSNDRSVQ*
Ga0163161_114673591	3300017792	Switchgrass Rhizosphere	MLDVLYVAGTVLFFALMLGYVAACDRLGRNADVERAKEDVP
Ga0187824_100747723	3300017927	Freshwater Sediment	MIDAVYILGTILFFALMLAYVAGCDRIGRTADVERAVEDVQ
Ga0187809_100050394	3300017937	Freshwater Sediment	MLDVLYVVGTVLFFALMIAYAAACDRLGRRADVERAPEDAR
Ga0187809_100835923	3300017937	Freshwater Sediment	VIDFIYVLATVLFFALMVAYVAACDRLGRNADVERASKEQP
Ga0187776_102003973	3300017966	Tropical Peatland	MIDAVYVAGTVLFFALMILYIEGCDRLGRTADVERAPEDETR
Ga0187776_102653773	3300017966	Tropical Peatland	MIDLIYVIATLAFFALMLLYVAACDRLGRNADVERAHEGETQ
Ga0187766_101646393	3300018058	Tropical Peatland	MIDVIYVAATIAFFALMLLYVAACDRLGRSADVERAPKEEQ
Ga0187773_103464293	3300018064	Tropical Peatland	MIDLIYVIATLAFFGHMLLYVAACDRLGRNADVERAHEGETQ
Ga0210384_113033472	3300021432	Soil	MLDLVYIAATVLFFGLTLLYVRSCERLGRTKDTDGSA
Ga0126371_133905343	3300021560	Tropical Forest Soil	MIDALYVAGTILFFALMILYAQGCDRLGRAADVERGAEEELR
Ga0207642_103657111	3300025899	Miscanthus Rhizosphere	MIDVLYVAGTVLFFALMLGYVAACERLGRSADVERAREDAR
Ga0207645_101561431	3300025907	Miscanthus Rhizosphere	MLDVLYVAGTVLFFALMLGYVAACERLGRSADVERAREDAR
Ga0207705_101302182	3300025909	Corn Rhizosphere	MLDVVYVLATTAFFAMMLGYVAACARRGRGDVDSPESL
Ga0207707_106790573	3300025912	Corn Rhizosphere	MIDLIYVLASILFFWLMILYVAGCERLGRTGEVERAAETDQ
Ga0207700_105835412	3300025928	Corn, Switchgrass And Miscanthus Rhizosphere	VIDFIYVLTTVLFFALMVAYVAACQRLGRHADVERATKEQP
Ga0207664_107803241	3300025929	Agricultural Soil	VIDFIYVVTTVLFFALMIAYVAACHRLGGSADVERASKE
Ga0207690_104184292	3300025932	Corn Rhizosphere	METGLVIDVLYVVATVLFFALMLGYVAACNRLGRSADVERAKEDVR
Ga0207706_103063733	3300025933	Corn Rhizosphere	METGLVIDVLYVVATVLFFALMLGYVAACERLGRSADVERAREDAR
Ga0207704_101695381	3300025938	Miscanthus Rhizosphere	PMIDVLYVAGTVLFFALMLGYVAACERLGRSADVERAREDAR
Ga0207661_116309221	3300025944	Corn Rhizosphere	MIDVLYVAGTVLFFALMIGYAAACDRLGRSADVERAREDGR
Ga0207679_109145242	3300025945	Corn Rhizosphere	VIDVLYVVATVLFFALMLGYVAACNRLGRSADVERAKEDVR
Ga0209579_104554782	3300027869	Surface Soil	MIDLVYIVGTLAFFTLMLLYVAGCDFIGRHADVERAEPERGDSR
Ga0209465_105053122	3300027874	Tropical Forest Soil	MMDALYLAGTLAFFALMLLYVEGCDRLGRAADVERTPSESER
Ga0318555_107056103	3300031640	Soil	HMIDVVYVAATILFFALMILYVEGCDRLGRTADVERASEESSR
Ga0306917_114406343	3300031719	Soil	MIDFIYVAATVAFFGLMLLYVAACDRLGRSADVERTQDREQ
Ga0307469_119989143	3300031720	Hardwood Forest Soil	TVPQSEAGVVIDLVYVAATVLFFALMIVYVAACDRLGRAADVERGGKEQS
Ga0307477_103074582	3300031753	Hardwood Forest Soil	MLDLIYVAATIVFFALMILYIHACDLLGRSADVERAEETVR
Ga0306919_107581781	3300031879	Soil	MIDVVYVAATILFFALMILYVEGCDRLGRTADVERASEES
Ga0302322_1006675483	3300031902	Fen	MNDILYLVLIVAFFALMLGYVAACARLGRSSGAEETGNDNR
Ga0306923_122643342	3300031910	Soil	MIDVVYVAATILFFALMILYVEGCDRLGRTADVERASEESSR
Ga0307470_111778512	3300032174	Hardwood Forest Soil	VIDLVYVAATVLFFALMIVYVAACDRLGRAADVERGGKEQS
Ga0307472_1014707461	3300032205	Hardwood Forest Soil	SEAGVVIDLVYVAATILFFALMIVYVAACDRLGRAADVERGGKEQS
Ga0335085_123641952	3300032770	Soil	MIDAAYLIGTVLFFALMIAYAAACDRLGQSADVERPEEDVR
Ga0326726_100994353	3300033433	Peat Soil	MIDAVYVAGTVLFFALMILYVEGCDRLGRSADVERAAEEEPR
Ga0310811_102249891	3300033475	Soil	METHMKDIGYVVATIAFFALMLAFVAGCARLGRIADSERAEETAR
Ga0316620_100489414	3300033480	Soil	MIDLIYVVATILFFALMLLYVAACDRLGRAAEAERAPEENP
Ga0316624_116201471	3300033486	Soil	YVAATLAFFALMLLYVAACDRLGRNADVERAHEEGEPQ

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F094206

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences