NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F093293

Metagenome Family F093293

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F093293
Family Type Metagenome
Number of Sequences 106
Average Sequence Length 44 residues
Representative Sequence MKKLLNFKNIAIAALIIYVLLQWFNPGGVMPGGRTIRIEG
Number of Associated Samples 91
Number of Associated Scaffolds 106

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Archaea
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.06 %
% of genes from short scaffolds (< 2000 bps) 90.57 %
Associated GOLD sequencing projects 87
AlphaFold2 3D model prediction Yes
3D model pTM-score0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Archaea (69.811 % of family members)
NCBI Taxonomy ID 2157
Taxonomy All Organisms → cellular organisms → Archaea

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater
(20.755 % of family members)
Environment Ontology (ENVO) Unclassified
(60.377 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(61.321 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 26.47%    β-sheet: 5.88%    Coil/Unstructured: 67.65%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.46
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 106 Family Scaffolds
PF00149Metallophos 0.94
PF14905OMP_b-brl_3 0.94
PF01467CTP_transf_like 0.94



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.34 %
UnclassifiedrootN/A5.66 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002384|B570J29636_1010655All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage554Open in IMG/M
3300002408|B570J29032_109885980All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1987Open in IMG/M
3300002835|B570J40625_101552248All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage542Open in IMG/M
3300003411|JGI25911J50253_10150453Not Available668Open in IMG/M
3300004096|Ga0066177_10482320Not Available547Open in IMG/M
3300005662|Ga0078894_10629244All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon953Open in IMG/M
3300005662|Ga0078894_10659092All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon927Open in IMG/M
3300007545|Ga0102873_1099335All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage881Open in IMG/M
3300007547|Ga0102875_1174484All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon670Open in IMG/M
3300007549|Ga0102879_1098017All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon913Open in IMG/M
3300007603|Ga0102921_1188320All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon743Open in IMG/M
3300007624|Ga0102878_1227782All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon530Open in IMG/M
3300007974|Ga0105747_1190290All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon674Open in IMG/M
3300007974|Ga0105747_1276913All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage565Open in IMG/M
3300007992|Ga0105748_10192573All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon845Open in IMG/M
3300008107|Ga0114340_1120036All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon1849Open in IMG/M
3300008108|Ga0114341_10069632All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon2220Open in IMG/M
3300008110|Ga0114343_1005444All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6757Open in IMG/M
3300008110|Ga0114343_1024863All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon2583Open in IMG/M
3300008111|Ga0114344_1172402All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon717Open in IMG/M
3300008113|Ga0114346_1025684All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3126Open in IMG/M
3300008113|Ga0114346_1276873All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon599Open in IMG/M
3300008116|Ga0114350_1039570All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon1795Open in IMG/M
3300008117|Ga0114351_1076759All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon3222Open in IMG/M
3300009050|Ga0102909_1110834All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon664Open in IMG/M
3300009068|Ga0114973_10296874All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon862Open in IMG/M
3300009068|Ga0114973_10296875All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon862Open in IMG/M
3300009079|Ga0102814_10409710All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage738Open in IMG/M
3300009152|Ga0114980_10261776All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon1008Open in IMG/M
3300009159|Ga0114978_10327758All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon931Open in IMG/M
3300009159|Ga0114978_10567700All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon659Open in IMG/M
3300009161|Ga0114966_10349045All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon880Open in IMG/M
3300009163|Ga0114970_10245538All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1036Open in IMG/M
3300010160|Ga0114967_10656132All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage500Open in IMG/M
3300013005|Ga0164292_10843508All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon577Open in IMG/M
(restricted) 3300014720|Ga0172376_10080216All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon2413Open in IMG/M
(restricted) 3300014720|Ga0172376_10295488All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon970Open in IMG/M
3300017774|Ga0181358_1196216All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon663Open in IMG/M
3300017777|Ga0181357_1129940All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon940Open in IMG/M
3300017778|Ga0181349_1080102All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon1244Open in IMG/M
3300017778|Ga0181349_1165896All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon784Open in IMG/M
3300017780|Ga0181346_1257710Not Available607Open in IMG/M
3300020074|Ga0194113_10301187All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon1217Open in IMG/M
3300020141|Ga0211732_1013167All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon1341Open in IMG/M
3300020172|Ga0211729_10184112All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon644Open in IMG/M
3300020172|Ga0211729_11274149All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage680Open in IMG/M
3300020527|Ga0208232_1050872All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon523Open in IMG/M
3300020550|Ga0208600_1005703All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon1998Open in IMG/M
3300020562|Ga0208597_1029253All Organisms → Viruses → Predicted Viral1176Open in IMG/M
3300020571|Ga0208723_1046161All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon609Open in IMG/M
3300021091|Ga0194133_10555306All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage573Open in IMG/M
3300021963|Ga0222712_10339011All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon931Open in IMG/M
3300024502|Ga0255181_1074946All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon550Open in IMG/M
3300024507|Ga0255176_1003869All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon3299Open in IMG/M
3300024515|Ga0255183_1023240All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon1499Open in IMG/M
3300027123|Ga0255090_1061652All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon546Open in IMG/M
3300027134|Ga0255069_1045196All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon510Open in IMG/M
3300027145|Ga0255114_1062757All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon648Open in IMG/M
3300027216|Ga0208677_1047895All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300027221|Ga0208557_1065784All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage599Open in IMG/M
3300027281|Ga0208440_1107720All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon551Open in IMG/M
3300027286|Ga0255129_1039351All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon768Open in IMG/M
3300027290|Ga0255136_1040705All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon686Open in IMG/M
3300027292|Ga0255134_1039204All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon779Open in IMG/M
3300027292|Ga0255134_1047927All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon690Open in IMG/M
3300027368|Ga0255133_1085729All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon614Open in IMG/M
3300027396|Ga0255146_1003825All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon3170Open in IMG/M
3300027608|Ga0208974_1143183All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon611Open in IMG/M
3300027631|Ga0208133_1094455Not Available700Open in IMG/M
3300027659|Ga0208975_1187764All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon558Open in IMG/M
3300027688|Ga0209553_1142069All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon825Open in IMG/M
3300027759|Ga0209296_1202145All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon851Open in IMG/M
3300027782|Ga0209500_10189923All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon935Open in IMG/M
3300027785|Ga0209246_10224267Not Available731Open in IMG/M
3300027798|Ga0209353_10100717All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon1304Open in IMG/M
3300027804|Ga0209358_10213397All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon991Open in IMG/M
3300027804|Ga0209358_10305007All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage781Open in IMG/M
3300027892|Ga0209550_10511802All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon719Open in IMG/M
3300027969|Ga0209191_1136719All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon1011Open in IMG/M
3300027974|Ga0209299_1048231All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon1779Open in IMG/M
3300031758|Ga0315907_10011423Not Available8749Open in IMG/M
3300031857|Ga0315909_10643461All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage699Open in IMG/M
3300031951|Ga0315904_10731402All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon826Open in IMG/M
3300031963|Ga0315901_10437963All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1037Open in IMG/M
3300031963|Ga0315901_10816717All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon674Open in IMG/M
3300032050|Ga0315906_11213162All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage546Open in IMG/M
3300032116|Ga0315903_10719824All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage743Open in IMG/M
3300033993|Ga0334994_0517198All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon551Open in IMG/M
3300033995|Ga0335003_0135874All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon1237Open in IMG/M
3300033995|Ga0335003_0176322All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon1043Open in IMG/M
3300034013|Ga0334991_0015978All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4542Open in IMG/M
3300034018|Ga0334985_0358519All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon889Open in IMG/M
3300034066|Ga0335019_0260959All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon1100Open in IMG/M
3300034066|Ga0335019_0462201All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage765Open in IMG/M
3300034102|Ga0335029_0570784All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon641Open in IMG/M
3300034104|Ga0335031_0578778All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage667Open in IMG/M
3300034105|Ga0335035_0603774All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage580Open in IMG/M
3300034106|Ga0335036_0306814All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1052Open in IMG/M
3300034108|Ga0335050_0362849All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon664Open in IMG/M
3300034111|Ga0335063_0216431All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon1067Open in IMG/M
3300034116|Ga0335068_0324409All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon759Open in IMG/M
3300034120|Ga0335056_0283398All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon924Open in IMG/M
3300034121|Ga0335058_0736424All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon541Open in IMG/M
3300034200|Ga0335065_0132248All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon1674Open in IMG/M
3300034200|Ga0335065_0324957All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon964Open in IMG/M
3300034279|Ga0335052_0191740All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1182Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater20.75%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake14.15%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake11.32%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater11.32%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine9.43%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton8.49%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater6.60%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater5.66%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.83%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water2.83%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic1.89%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.89%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.94%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.94%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.94%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002384Freshwater microbial communities from Lake Mendota, WI - 08OCT2012 deep hole epilimnionEnvironmentalOpen in IMG/M
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003411Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SDEnvironmentalOpen in IMG/M
3300004096Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2)EnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300007545Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3EnvironmentalOpen in IMG/M
3300007547Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02EnvironmentalOpen in IMG/M
3300007549Estuarine microbial communities from the Columbia River estuary - metaG 1548B-02EnvironmentalOpen in IMG/M
3300007603Estuarine microbial communities from the Columbia River estuary - metaG 1568-02EnvironmentalOpen in IMG/M
3300007624Estuarine microbial communities from the Columbia River estuary - metaG 1548A-02EnvironmentalOpen in IMG/M
3300007974Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2umEnvironmentalOpen in IMG/M
3300007992Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2umEnvironmentalOpen in IMG/M
3300008107Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NAEnvironmentalOpen in IMG/M
3300008108Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NAEnvironmentalOpen in IMG/M
3300008110Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NAEnvironmentalOpen in IMG/M
3300008111Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NAEnvironmentalOpen in IMG/M
3300008113Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NAEnvironmentalOpen in IMG/M
3300008116Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NAEnvironmentalOpen in IMG/M
3300008117Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300009050Estuarine microbial communities from the Columbia River estuary - metaG 1557A-02EnvironmentalOpen in IMG/M
3300009068Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaGEnvironmentalOpen in IMG/M
3300009079Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741EnvironmentalOpen in IMG/M
3300009152Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaGEnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009161Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaGEnvironmentalOpen in IMG/M
3300009163Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaGEnvironmentalOpen in IMG/M
3300010160Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaGEnvironmentalOpen in IMG/M
3300013005Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaGEnvironmentalOpen in IMG/M
3300014720 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35mEnvironmentalOpen in IMG/M
3300017774Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017777Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017778Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017780Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300020074Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200mEnvironmentalOpen in IMG/M
3300020141Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1EnvironmentalOpen in IMG/M
3300020172Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1EnvironmentalOpen in IMG/M
3300020527Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020550Freshwater microbial communities from Lake Mendota, WI - 08OCT2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020562Freshwater microbial communities from Lake Mendota, WI - 05MAY2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020571Freshwater microbial communities from Lake Mendota, WI - 31AUG2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021091Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40mEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300024502Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepC_8dEnvironmentalOpen in IMG/M
3300024507Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8dEnvironmentalOpen in IMG/M
3300024515Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8dEnvironmentalOpen in IMG/M
3300027123Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8dEnvironmentalOpen in IMG/M
3300027134Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8hEnvironmentalOpen in IMG/M
3300027145Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepA_8hEnvironmentalOpen in IMG/M
3300027216Estuarine microbial communities from the Columbia River estuary - metaG 1546A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027221Estuarine microbial communities from the Columbia River estuary - metaG 1548A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027281Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027286Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepA_8dEnvironmentalOpen in IMG/M
3300027290Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepB_8dEnvironmentalOpen in IMG/M
3300027292Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepC_8dEnvironmentalOpen in IMG/M
3300027368Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepB_8dEnvironmentalOpen in IMG/M
3300027396Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8hEnvironmentalOpen in IMG/M
3300027608Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027631Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes)EnvironmentalOpen in IMG/M
3300027659Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027688Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027759Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027782Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027785Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027798Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027804Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027892Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027969Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027974Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300031963Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116EnvironmentalOpen in IMG/M
3300032050Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300033993Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037EnvironmentalOpen in IMG/M
3300033995Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056EnvironmentalOpen in IMG/M
3300034013Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034EnvironmentalOpen in IMG/M
3300034018Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021EnvironmentalOpen in IMG/M
3300034066Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087EnvironmentalOpen in IMG/M
3300034102Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112EnvironmentalOpen in IMG/M
3300034104Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120EnvironmentalOpen in IMG/M
3300034105Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127EnvironmentalOpen in IMG/M
3300034106Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131EnvironmentalOpen in IMG/M
3300034108Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157EnvironmentalOpen in IMG/M
3300034111Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186EnvironmentalOpen in IMG/M
3300034116Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOREnvironmentalOpen in IMG/M
3300034120Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172EnvironmentalOpen in IMG/M
3300034121Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174EnvironmentalOpen in IMG/M
3300034200Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190EnvironmentalOpen in IMG/M
3300034279Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
B570J29636_101065513300002384FreshwaterMKKLLNFKNIAIAALIIYVLLQWFNPGGVMPGGRTITIDGKKYEVIK
B570J29032_10988598033300002408FreshwaterMKKFLNFKNIAIVVLIIYCLLQWFNPIGIMPGGRTIRIEGKSYEVIKHEIDT
B570J40625_10155224813300002835FreshwaterMKKQLTFKNIAIAALIIYILLQWFNPGGVMPGGRTIRIDG
JGI25911J50253_1015045313300003411Freshwater LakeMKKLLNFRNIAIAALVIYILLQWFNPGGVMPGGRTIRIEGKKYEVIKHDIDTVDIVKTKIVTKKG
Ga0066177_1048232013300004096Freshwater LakeMKKLLNFRNIAIAALVIYILLQWFNPGGVMPGGRTIRIEGKKYEVIKHDIDTVD
Ga0078894_1062924413300005662Freshwater LakeMKKFVNFKNIAIVALVIWILLQWFNPGGVMPGGRTIRIDGKK
Ga0078894_1065909223300005662Freshwater LakeMKKFVNFKNIAIVALVIWILLQWFNPGGIMPGGRTIRIDGKKYE
Ga0102873_109933513300007545EstuarineMKNLLNFKNIAIAALIIYILLQWFNPGGVMPGGRTIRIDG
Ga0102875_117448413300007547EstuarineMKNLLNFKNIVIAALIIFVLLEWFNPGGVMPGKKVFIAGK
Ga0102879_109801713300007549EstuarineMKNLLNFKNIAIAVLIIFVLLEWFNPGGVMPGKKVFI
Ga0102921_118832013300007603EstuarineMKKLLNFRNIAIAALVIYILLQWFNPGGVMPGGRTIRIEGKKYEIIKHDIDTVDI
Ga0102878_122778213300007624EstuarineMKKFVNFKNIAIAALVIYILLQWFNPGGVMPGGRT
Ga0105747_119029013300007974Estuary WaterMKKLLNFKNIAIAALIIFVLLQWFNPGGILPGKKVFIAGKAYEVIKHEID
Ga0105747_127691323300007974Estuary WaterMKKFLNIKNIAIAVLIAIVLLEWFNPGGVMPGKKVIIAG
Ga0105748_1019257323300007992Estuary WaterLIFKNIVIAALIIFVLLEWFNPGGVMPGKKVFIAGKA
Ga0114340_112003643300008107Freshwater, PlanktonMKKLLNFKNIAIAALIIYVLLQWFNPGGVMPGGRT
Ga0114341_1006963213300008108Freshwater, PlanktonMKKYVNFKNIAIVALVIWILLQWFNPGGVMPGGRTIRIDGKKYEVI
Ga0114343_100544453300008110Freshwater, PlanktonMKKLLNLKNIAIAVLIAIILLEYFNPGGKMPGRTVRIEG
Ga0114343_102486313300008110Freshwater, PlanktonMKKLLNIKNIAIAVLVVIVLLEIWNPGGIMPGKTIR
Ga0114344_117240213300008111Freshwater, PlanktonMKKYVNFKNIAIVALVIWILLQWFNPGGVMPGGRTI
Ga0114346_102568433300008113Freshwater, PlanktonMKKLLNLKNIAIAVLVVIVLLEYFNPGGKMPGRTVRID
Ga0114346_127687313300008113Freshwater, PlanktonMKKFVNFKNIAIAALVIYILLQWFNPGGVMPGGRTIRI
Ga0114350_103957033300008116Freshwater, PlanktonMKKLLNLKNIAIAVLVVIVLLEYFNPGGVMPGKTIRIDGKKYE
Ga0114351_107675943300008117Freshwater, PlanktonMKKLLNFKNIAIAALIIYVLLQWFNPGGVMPGGRTRK*
Ga0102909_111083413300009050EstuarineMKKLLNFRNIAIAALVIYILLQWFNPGGVMPGGRTIRIEGKKY
Ga0114973_1029687423300009068Freshwater LakeMKNLLNFKNIAIAALIIFVLLEWFNPGGVMPGKKVFIAGKAYEV
Ga0114973_1029687523300009068Freshwater LakeMKKLLNFKNIAIAALIIFVLLEWFNPGGVMPGKKVFIAGKAYEV
Ga0102814_1040971023300009079EstuarineMKKLLNLKNIAIAVLIAIILLEWFNPGGVMPGKKVFIAGKAYEVIKHDI
Ga0114980_1026177623300009152Freshwater LakeMKNLLNFKNIAIAVLVIFLLLELWNPGGVMPGKTIRIEGKKYEVIKHDIDTIDIVKTKIV
Ga0114978_1032775833300009159Freshwater LakeMKKLLNFKNIVIAALIIFVLLEWFNPGGVMPGKKVFIAGKAYEVIKHDIDTID
Ga0114978_1056770013300009159Freshwater LakeMKKLLNFKNIAIAALIIFVLLEWFNPGGVMPGKKVFIAGKAYEVIKHEI
Ga0114966_1034904523300009161Freshwater LakeMKKLLNFKNIAIAALIIFVLLEWFNPGGVMPGKKVFIA
Ga0114970_1024553833300009163Freshwater LakeMKKFLNIKNIAIAVLVAVVLLEWFNPGGVMPGKKVLIAGKS
Ga0114967_1065613223300010160Freshwater LakeMKNLKNITIIVLIALALLQFFNPGGVLPGGKTIRIEGKKYEVIKHEIDT
Ga0164292_1084350813300013005FreshwaterMKKFVNFKNIAIAALIIYILLQWFNPGGVMPGGRTIRIDGKKYEVLKHTI
(restricted) Ga0172376_1008021633300014720FreshwaterMKKFVNFKNIAIAALIIYILLQWFNPGGVMPGGRTIRIEGKK
(restricted) Ga0172376_1029548823300014720FreshwaterMKKYVNFKNIAIAALIIYILLQWFNPGGVMPGGRTIRIEGKK
Ga0181358_119621623300017774Freshwater LakeMKKLLNFRNIAIAALVIYILLQWFNPGGVMPGGRTIRIEGKKYEIIKHDIDTVDIVKT
Ga0181357_112994023300017777Freshwater LakeMTKLLNFRNIAIAALVIYILLQWFNPGGVMPGGRTIRIEGKKYEI
Ga0181349_108010213300017778Freshwater LakeMKKLLNFRNIAIAALVIYILLQWFNPGGVMPGGRTIRIEGKKYEVIKHDIDTVDIVKTKIVTK
Ga0181349_116589623300017778Freshwater LakeMKKSLNFRNIAIAALVIYILLQWFNPGGVMPGGRTIRIEG
Ga0181346_125771013300017780Freshwater LakeMKKLLNFKNIVIAALIIFVLLEWLNPGGVMPGKKVFIAGKA
Ga0194113_1030118723300020074Freshwater LakeMKKYVNFKNIAIAALVLFIILQWINPGGVMPGGKTIRIEG
Ga0211732_101316713300020141FreshwaterMKNLLNFRNIAIVALVIYILLQWFNPGGVMPGGRTI
Ga0211729_1018411223300020172FreshwaterMKKLLNFKNIVIAALIIFVLLEWFNPGGVMPGKKVFIAGKAYEVIKHEIDTVD
Ga0211729_1127414923300020172FreshwaterMKKLVNFKNIAIAALIVYILLQWFNPGGVMPGGRTIRIEGKKYE
Ga0208232_105087213300020527FreshwaterMKKFVNFKNIAIAALIIYILLQWFNPGGVMPGGRTIRIDG
Ga0208600_100570313300020550FreshwaterMKKFLNFKNIAIVVLIIYCLLQWFNPIGIMPGGRTI
Ga0208597_102925323300020562FreshwaterMKKLLNFKNIAIAVLIIFVLLEWFNPGGVMPGKKVFIAGKAYEVIKHDI
Ga0208723_104616113300020571FreshwaterMKKFVNFKNIAIAALVIYILLQWFNPGGVMPGGRTIRIEGKKYEV
Ga0194133_1055530623300021091Freshwater LakeMKKYLNFRNIAIAVLVIWVLLQWFNPGGVMPGGRIVEI
Ga0222712_1033901123300021963Estuarine WaterMKKHLNFKNIAILALIVYVLLQWFNPGGVMPGGRTIRIDG
Ga0255181_107494623300024502FreshwaterMKKYVNFKNIAIVALVIWILLQWFNPGGVMPGGRTIRI
Ga0255176_100386943300024507FreshwaterMKKYVNFKNIAIVALVIWILLQWFNPGGVMPGGRTIRIDGKKYEVIKHT
Ga0255183_102324013300024515FreshwaterMKKYVNFKNIAIVALVIWILLQWFNPGGVMPGGRTIRIDGK
Ga0255090_106165223300027123FreshwaterMKKLLNFRNIAIAALVIYILLQWFNPGGVMPGGRTIRID
Ga0255069_104519613300027134FreshwaterMKKLLNFRNIAIAALVIYILLQWFNPGGVMPGGRTIRIE
Ga0255114_106275713300027145FreshwaterMKKLLNFKNIAIVALIIFVLLQWFNPGGILPGKKVFIAG
Ga0208677_104789533300027216EstuarineMKNLLNFKNIAIAALIIYILLQWFNPGGVMPGGRTIRIEGKKYEIIKHDIDTVDIV
Ga0208557_106578413300027221EstuarineMKNLLNFKNIAIAALIIYILLQWFNPGGVMPGGRTIR
Ga0208440_110772013300027281EstuarineMKNLLNFKNIVIAALIIFVLLEWFNPGGVMPGKKV
Ga0255129_103935113300027286FreshwaterMKKLLNFRNIAIAALVIYILLQWFNPGGVMPGGRTIRIEGKKYEIIKHDIDT
Ga0255136_104070523300027290FreshwaterMKKLLNFKNIAIVALIIFVLLQWFNPGGILPGKKVFIAGKAYEVIKHEIDT
Ga0255134_103920413300027292FreshwaterMKKFVNFKNIAIAALVIYILLQWFNPGGVMPGGRTIRIEGKKYEVI
Ga0255134_104792723300027292FreshwaterMKKLLNFRNIAIAALVIYILLQWFNPGGVMPGGRTIRIEGKKYEII
Ga0255133_108572923300027368FreshwaterMKKLLNFKNIAIVALIIFVLLQWFNPGGILPGKKVFIAGKAY
Ga0255146_100382513300027396FreshwaterMKNLLNFKNIAIAALIIYCLLQWFNPGGVMPGGRTIRIDGKKYEV
Ga0208974_114318323300027608Freshwater LenticMKNLLNFKNIAIAALIIFVLLQWFNPGGILPGKKVFIAGKAYEVI
Ga0208133_109445523300027631EstuarineMKKLLNFKNIAIAALIIFVLLQWFNPGGVMPGKKVFIAGKAYEVIK
Ga0208975_118776423300027659Freshwater LenticMKKLLNFRNIAIAALVIYILLQWFNPGGVMPGGRTIRIEGKKYEIIKHDI
Ga0209553_114206923300027688Freshwater LakeMKKLLNFRNIAIAALVIYILLQWFNPGGVMPGGRTIRIEGKKYEIIKHD
Ga0209296_120214533300027759Freshwater LakeMKNLLNFKNIVIAALIIFVLLEWLNPGGVMPGKKVFVNGK
Ga0209500_1018992313300027782Freshwater LakeMKNLLNFKNIVIAALIIFVLLEWFNPGGVMPGKKVFIAGKAYEVIKHDIDTID
Ga0209246_1022426713300027785Freshwater LakeMKKLLNFRNIAIAALVIYILLQWFNPGGVMPGGRTIRIEGKKYEVIKHDIDTVDIVKTKI
Ga0209353_1010071723300027798Freshwater LakeMKKLLNFRNIAIAALVIYILLQWFNPGGVMPGGRTIRIEGK
Ga0209358_1021339713300027804Freshwater LakeMKKLLNFKNIVIAALIIFVLLEWFNPGGVMPGKKVFIA
Ga0209358_1030500713300027804Freshwater LakeMKKLLNLKNIAIAVLVVIVLLEYFNPGGVMPGKTI
Ga0209550_1051180223300027892Freshwater LakeMKNLLNFRNIAIVALVIYILLQWFNPGGVMPGGRTIRIE
Ga0209191_113671923300027969Freshwater LakeMKKLLNFRNIAIAALVIYIFLQWFNPGGVMPGGRTIRIEGKK
Ga0209299_104823133300027974Freshwater LakeMKNLLNFKNIVIAALIIFVLLEWLNPGGVMPGKKVFVNGKAYEVIKHDIDTIDIVKT
Ga0315907_10011423113300031758FreshwaterMKKLLNFKNIAIAALIIYVLLQWFNPGGVMPGGRTI
Ga0315909_1064346123300031857FreshwaterMKKYLNLKNIAIAALIIYILLQWFNPGGVMPGGRTIRIAGKKY
Ga0315904_1073140213300031951FreshwaterMKKLLNIKNIAIAVLVVIVLLEIWNPGGIMPGKTIRIEGKKYEVIK
Ga0315901_1043796313300031963FreshwaterMKKLVNFKNIAIAALIVYILLQWFNPGGVMPGGRTIRIEGKKYEVIKHEI
Ga0315901_1081671713300031963FreshwaterMKKYVNFKNIAIVALVIWILLQWFNPGGVMPGGRTIRIDNKKYEV
Ga0315906_1121316213300032050FreshwaterMKKYLNLKNIAIAALIIYILLQWFNPGGVMPGGRTIRIDGKKYE
Ga0315903_1071982413300032116FreshwaterMKKYLTFKNIAITALIIYILLQWFNPGGVMPGGRTIR
Ga0334994_0517198_404_5503300033993FreshwaterMKNLLNFKNIAIAVLIIFVLLEWFNPGGVMPGKKVFIAGKAYEVIKHEI
Ga0335003_0135874_1_1113300033995FreshwaterMKKLLNFKNIAIAVLIIFVLLEWFNPGGVMPGKKVFI
Ga0335003_0176322_1_1413300033995FreshwaterMKKLLNFKNIAIAVLIIFVLLEWFNPGGVMPGKKVFIAGKAYEVIKH
Ga0334991_0015978_3_1343300034013FreshwaterMKKLLNLKNIAIVALIIFILLEWFNPGGVMPGKKVYIEGKAYEV
Ga0334985_0358519_767_8893300034018FreshwaterMKKLLNFKNIAIAVLIIFVLLEWFNPGGVMPGKKVFIAGKA
Ga0335019_0260959_950_10993300034066FreshwaterMKKFVNFKNIAIAALVIYVLLQWFNPGGVMPGGRTIRIEGKKYEVIKHEI
Ga0335019_0462201_650_7633300034066FreshwaterMKKLLNFKNIAIAALIIFILLQWFNPGDILPGKKVYIE
Ga0335029_0570784_525_6413300034102FreshwaterMKKLLNFKNIAIAALIIYVLLQWFNPGGVMPGGRTIRID
Ga0335031_0578778_1_1443300034104FreshwaterMKKLLNLKNIAIAVLVVIVLLEYFNPGGKMPGRKIIIEGKAYEVIKHD
Ga0335035_0603774_471_5783300034105FreshwaterMKKFLNLKNIAIAVLVVIVLLEYFNPGGKMPGRTVR
Ga0335036_0306814_2_1153300034106FreshwaterMKKLLNLKNIAIAVLVVIVLLEYFNPGGVMPGKTIRID
Ga0335050_0362849_1_1353300034108FreshwaterMKKLLNFKNIAIAVLIIFVLLEWFNPGGVMPGKKVFIAGKAYEVI
Ga0335063_0216431_3_1793300034111FreshwaterMKKLLNFKNIAIAALIIFVLLQWFNPGDILPGKKVFIAGKAYEVIKHEIDTDIINAAIA
Ga0335068_0324409_3_1553300034116FreshwaterMKKFVNFKNIAIAALIIYILLQWFNPGGVMPGGRTIRIEGKKYEVIKHEID
Ga0335056_0283398_805_9243300034120FreshwaterMKKLLNFKNIAIAALIIYVLLQWFNPGGVMPGGRTIRIEG
Ga0335058_0736424_2_1333300034121FreshwaterMKKLLNFKNIAIAVLIIFVLLEWFNPGGVMPGKKVFIAGKAYEV
Ga0335065_0132248_1_1593300034200FreshwaterMKNLLNFKNIAIAVLIIFVLLEWFNPGGVMPGKKVFIAGKAYEVIKHDIDTVD
Ga0335065_0324957_2_1423300034200FreshwaterMKKLLNFKNIAIAALIIYVLLQWFNPGGVMPGGRTIRIDGNKYEVIK
Ga0335052_0191740_1062_11813300034279FreshwaterMKKFLNLKNIAIAVLVVIVLLEYFNPGGKMPGRTVRIDGK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.