Basic Information | |
---|---|
Family ID | F093147 |
Family Type | Metagenome |
Number of Sequences | 106 |
Average Sequence Length | 45 residues |
Representative Sequence | MENKTPTQQEQQIKPEKRPNDTGSVTVDGFVKIFDPKTRKVFVEQKA |
Number of Associated Samples | 73 |
Number of Associated Scaffolds | 106 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 19.81 % |
% of genes near scaffold ends (potentially truncated) | 21.70 % |
% of genes from short scaffolds (< 2000 bps) | 59.43 % |
Associated GOLD sequencing projects | 61 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.33 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (65.094 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater (41.509 % of family members) |
Environment Ontology (ENVO) | Unclassified (86.792 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (92.453 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 18.67% Coil/Unstructured: 81.33% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 106 Family Scaffolds |
---|---|---|
PF04965 | GPW_gp25 | 2.83 |
PF14312 | FG-GAP_2 | 0.94 |
PF12322 | T4_baseplate | 0.94 |
PF06508 | QueC | 0.94 |
PF10504 | DUF2452 | 0.94 |
PF04055 | Radical_SAM | 0.94 |
PF03420 | Peptidase_S77 | 0.94 |
COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
---|---|---|---|
COG0037 | tRNA(Ile)-lysidine synthase TilS/MesJ | Translation, ribosomal structure and biogenesis [J] | 0.94 |
COG0137 | Argininosuccinate synthase | Amino acid transport and metabolism [E] | 0.94 |
COG0171 | NH3-dependent NAD+ synthetase | Coenzyme transport and metabolism [H] | 0.94 |
COG0301 | Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.94 |
COG0482 | tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain | Translation, ribosomal structure and biogenesis [J] | 0.94 |
COG0519 | GMP synthase, PP-ATPase domain/subunit | Nucleotide transport and metabolism [F] | 0.94 |
COG0603 | 7-cyano-7-deazaguanine synthase (queuosine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.94 |
COG0780 | NADPH-dependent 7-cyano-7-deazaguanine reductase QueF, C-terminal domain, T-fold superfamily | Translation, ribosomal structure and biogenesis [J] | 0.94 |
COG1606 | ATP-utilizing enzyme, PP-loop superfamily | General function prediction only [R] | 0.94 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 65.09 % |
All Organisms | root | All Organisms | 34.91 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000176|TB03JUN2009E_c000010 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 82414 | Open in IMG/M |
3300000176|TB03JUN2009E_c000633 | Not Available | 9945 | Open in IMG/M |
3300002933|G310J44882_10011786 | Not Available | 2532 | Open in IMG/M |
3300003375|JGI26470J50227_1000005 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 177097 | Open in IMG/M |
3300003375|JGI26470J50227_1008840 | Not Available | 2595 | Open in IMG/M |
3300003375|JGI26470J50227_1011320 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2205 | Open in IMG/M |
3300003375|JGI26470J50227_1064018 | Not Available | 603 | Open in IMG/M |
3300004095|Ga0007829_10015727 | Not Available | 1452 | Open in IMG/M |
3300004684|Ga0065168_1054461 | Not Available | 628 | Open in IMG/M |
3300004685|Ga0065177_1000113 | Not Available | 12391 | Open in IMG/M |
3300004685|Ga0065177_1000345 | Not Available | 7790 | Open in IMG/M |
3300004685|Ga0065177_1016465 | Not Available | 1384 | Open in IMG/M |
3300004685|Ga0065177_1036850 | Not Available | 923 | Open in IMG/M |
3300004686|Ga0065173_1001348 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4574 | Open in IMG/M |
3300004687|Ga0065174_1004536 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2490 | Open in IMG/M |
3300004770|Ga0007804_1043364 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1193 | Open in IMG/M |
3300004770|Ga0007804_1095797 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 757 | Open in IMG/M |
3300004770|Ga0007804_1135992 | Not Available | 619 | Open in IMG/M |
3300004772|Ga0007791_10244076 | Not Available | 505 | Open in IMG/M |
3300004774|Ga0007794_10001996 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6364 | Open in IMG/M |
3300004804|Ga0007796_10045397 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1465 | Open in IMG/M |
3300006072|Ga0007881_1103319 | Not Available | 711 | Open in IMG/M |
3300006100|Ga0007806_1016464 | Not Available | 1606 | Open in IMG/M |
3300006101|Ga0007810_1005735 | Not Available | 3290 | Open in IMG/M |
3300006101|Ga0007810_1028114 | Not Available | 1249 | Open in IMG/M |
3300006113|Ga0007858_1046873 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 932 | Open in IMG/M |
3300006113|Ga0007858_1110428 | Not Available | 562 | Open in IMG/M |
3300006115|Ga0007816_1031766 | Not Available | 1215 | Open in IMG/M |
3300006118|Ga0007859_1011475 | Not Available | 2019 | Open in IMG/M |
3300006127|Ga0007805_1048377 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 943 | Open in IMG/M |
3300006129|Ga0007834_1017870 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1953 | Open in IMG/M |
3300009151|Ga0114962_10000458 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 36300 | Open in IMG/M |
3300009151|Ga0114962_10143019 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1445 | Open in IMG/M |
3300009151|Ga0114962_10372522 | Not Available | 778 | Open in IMG/M |
3300009152|Ga0114980_10549693 | Not Available | 655 | Open in IMG/M |
3300009154|Ga0114963_10008743 | Not Available | 6878 | Open in IMG/M |
3300009155|Ga0114968_10196169 | Not Available | 1172 | Open in IMG/M |
3300009158|Ga0114977_10288119 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 939 | Open in IMG/M |
3300009158|Ga0114977_10348890 | Not Available | 834 | Open in IMG/M |
3300009164|Ga0114975_10000615 | Not Available | 26869 | Open in IMG/M |
3300009164|Ga0114975_10595929 | Not Available | 590 | Open in IMG/M |
3300009181|Ga0114969_10791458 | Not Available | 503 | Open in IMG/M |
3300009182|Ga0114959_10000073 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 88911 | Open in IMG/M |
3300009182|Ga0114959_10001101 | Not Available | 24403 | Open in IMG/M |
3300009182|Ga0114959_10034631 | Not Available | 3047 | Open in IMG/M |
3300009182|Ga0114959_10378985 | Not Available | 695 | Open in IMG/M |
3300009183|Ga0114974_10029701 | Not Available | 3790 | Open in IMG/M |
3300009502|Ga0114951_10033875 | Not Available | 3236 | Open in IMG/M |
3300009502|Ga0114951_10053638 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 2421 | Open in IMG/M |
3300010157|Ga0114964_10011932 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5232 | Open in IMG/M |
3300010158|Ga0114960_10075986 | Not Available | 1917 | Open in IMG/M |
3300010160|Ga0114967_10605657 | Not Available | 526 | Open in IMG/M |
3300010885|Ga0133913_10878617 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 2329 | Open in IMG/M |
3300010885|Ga0133913_11035400 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2120 | Open in IMG/M |
3300010885|Ga0133913_11042535 | Not Available | 2111 | Open in IMG/M |
3300013005|Ga0164292_10543281 | Not Available | 757 | Open in IMG/M |
3300013093|Ga0164296_1088906 | Not Available | 1323 | Open in IMG/M |
3300013285|Ga0136642_1006630 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3837 | Open in IMG/M |
3300020048|Ga0207193_1000986 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 51429 | Open in IMG/M |
3300020699|Ga0214221_1027867 | Not Available | 555 | Open in IMG/M |
3300020716|Ga0214207_1004808 | Not Available | 2156 | Open in IMG/M |
3300020716|Ga0214207_1006285 | Not Available | 1783 | Open in IMG/M |
3300020733|Ga0214172_1043915 | Not Available | 641 | Open in IMG/M |
3300021519|Ga0194048_10000464 | Not Available | 19731 | Open in IMG/M |
3300021519|Ga0194048_10003265 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7980 | Open in IMG/M |
3300021519|Ga0194048_10321453 | Not Available | 555 | Open in IMG/M |
3300022555|Ga0212088_10112232 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2450 | Open in IMG/M |
3300022555|Ga0212088_10802724 | Not Available | 542 | Open in IMG/M |
3300022591|Ga0236341_1433255 | Not Available | 502 | Open in IMG/M |
3300022594|Ga0236340_1075652 | Not Available | 676 | Open in IMG/M |
3300022602|Ga0248169_103237 | Not Available | 18817 | Open in IMG/M |
3300022602|Ga0248169_107191 | Not Available | 9999 | Open in IMG/M |
3300023311|Ga0256681_11150420 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1242 | Open in IMG/M |
3300025353|Ga0208255_108928 | Not Available | 945 | Open in IMG/M |
3300025358|Ga0208504_1010052 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1379 | Open in IMG/M |
3300025358|Ga0208504_1016782 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1011 | Open in IMG/M |
3300025383|Ga0208250_1051019 | Not Available | 600 | Open in IMG/M |
3300025407|Ga0208378_1029911 | Not Available | 946 | Open in IMG/M |
3300025410|Ga0208875_1074316 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 516 | Open in IMG/M |
3300025421|Ga0207958_1018163 | Not Available | 1184 | Open in IMG/M |
3300025423|Ga0208746_1002185 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5125 | Open in IMG/M |
3300025423|Ga0208746_1007802 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2250 | Open in IMG/M |
3300025449|Ga0208106_1088376 | Not Available | 508 | Open in IMG/M |
3300025466|Ga0208497_1078251 | Not Available | 624 | Open in IMG/M |
3300025487|Ga0208105_1027767 | Not Available | 1077 | Open in IMG/M |
3300025578|Ga0208864_1120477 | Not Available | 599 | Open in IMG/M |
3300025598|Ga0208379_1128814 | Not Available | 584 | Open in IMG/M |
3300025723|Ga0208741_10134581 | Not Available | 574 | Open in IMG/M |
3300025778|Ga0208388_1002792 | Not Available | 3422 | Open in IMG/M |
3300027708|Ga0209188_1000133 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 85295 | Open in IMG/M |
3300027708|Ga0209188_1023580 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3082 | Open in IMG/M |
3300027708|Ga0209188_1024607 | Not Available | 2994 | Open in IMG/M |
3300027708|Ga0209188_1060676 | Not Available | 1638 | Open in IMG/M |
3300027734|Ga0209087_1255568 | Not Available | 645 | Open in IMG/M |
3300027736|Ga0209190_1246127 | Not Available | 709 | Open in IMG/M |
3300027741|Ga0209085_1280605 | Not Available | 641 | Open in IMG/M |
3300027759|Ga0209296_1044575 | All Organisms → Viruses → Predicted Viral | 2352 | Open in IMG/M |
3300027896|Ga0209777_10101703 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2449 | Open in IMG/M |
3300027896|Ga0209777_10838216 | Not Available | 642 | Open in IMG/M |
3300027896|Ga0209777_10920591 | Not Available | 604 | Open in IMG/M |
3300027963|Ga0209400_1212963 | Not Available | 791 | Open in IMG/M |
3300028393|Ga0304728_1042668 | Not Available | 1921 | Open in IMG/M |
3300031759|Ga0316219_1009747 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5635 | Open in IMG/M |
3300031813|Ga0316217_10093331 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1409 | Open in IMG/M |
3300032753|Ga0316224_1109183 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1028 | Open in IMG/M |
3300034013|Ga0334991_0085953 | Not Available | 1540 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 41.51% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 30.19% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.66% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 4.72% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 4.72% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.72% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 2.83% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 2.83% |
Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 1.89% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.94% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000176 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnion | Environmental | Open in IMG/M |
3300002933 | Combined Assembly of freshwater hypolimnion microbial communities from Trout Bog Lake, Wisconsin, USA | Environmental | Open in IMG/M |
3300003375 | Freshwater actinobacteria microbial communities from Trout Bog Lake, Wisconsin, USA - enrichment TB-E6 | Environmental | Open in IMG/M |
3300004095 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09 | Environmental | Open in IMG/M |
3300004684 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Jun09 (version 2) | Environmental | Open in IMG/M |
3300004685 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Jul08 (version 2) | Environmental | Open in IMG/M |
3300004686 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Oct08 (version 2) | Environmental | Open in IMG/M |
3300004687 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Jul08 (version 2) | Environmental | Open in IMG/M |
3300004770 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 | Environmental | Open in IMG/M |
3300004772 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0.5M | Environmental | Open in IMG/M |
3300004774 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA5M | Environmental | Open in IMG/M |
3300004804 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0M | Environmental | Open in IMG/M |
3300006072 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09 | Environmental | Open in IMG/M |
3300006100 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 | Environmental | Open in IMG/M |
3300006101 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE15Jun09 | Environmental | Open in IMG/M |
3300006113 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH08Aug08 | Environmental | Open in IMG/M |
3300006115 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul09 | Environmental | Open in IMG/M |
3300006118 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul07 | Environmental | Open in IMG/M |
3300006127 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE24Aug09 | Environmental | Open in IMG/M |
3300006129 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE06Nov07 | Environmental | Open in IMG/M |
3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009502 | Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG | Environmental | Open in IMG/M |
3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013093 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES057 metaG | Environmental | Open in IMG/M |
3300013285 | Freshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31Y | Environmental | Open in IMG/M |
3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
3300020699 | Freshwater microbial communities from Trout Bog Lake, WI - 09AUG2007 hypolimnion | Environmental | Open in IMG/M |
3300020716 | Freshwater microbial communities from Trout Bog Lake, WI - 13JUL2009 epilimnion | Environmental | Open in IMG/M |
3300020733 | Freshwater microbial communities from Trout Bog Lake, WI - 12JUL2007 epilimnion | Environmental | Open in IMG/M |
3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
3300022555 | Alinen_combined assembly | Environmental | Open in IMG/M |
3300022591 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S2 | Environmental | Open in IMG/M |
3300022594 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S1 | Environmental | Open in IMG/M |
3300022602 | Freshwater microbial communities from Trout Bog Lake, Vilas County, Wisconsin, United States - 30JULY2014 epilimnion | Environmental | Open in IMG/M |
3300023311 | Combined Assembly of Gp0281739, Gp0281740, Gp0281741 | Environmental | Open in IMG/M |
3300025353 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH06Jun08 (SPAdes) | Environmental | Open in IMG/M |
3300025358 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH05Oct08 (SPAdes) | Environmental | Open in IMG/M |
3300025383 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 (SPAdes) | Environmental | Open in IMG/M |
3300025407 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE24Aug09 (SPAdes) | Environmental | Open in IMG/M |
3300025410 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH25Aug08 (SPAdes) | Environmental | Open in IMG/M |
3300025421 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul07 (SPAdes) | Environmental | Open in IMG/M |
3300025423 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH15Jun09 (SPAdes) | Environmental | Open in IMG/M |
3300025449 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Jul08 (SPAdes) | Environmental | Open in IMG/M |
3300025466 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 (SPAdes) | Environmental | Open in IMG/M |
3300025487 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Jul07 (SPAdes) | Environmental | Open in IMG/M |
3300025578 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0.5M (SPAdes) | Environmental | Open in IMG/M |
3300025598 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 (SPAdes) | Environmental | Open in IMG/M |
3300025723 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09 (SPAdes) | Environmental | Open in IMG/M |
3300025778 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Jul07 (SPAdes) | Environmental | Open in IMG/M |
3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028393 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300031759 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003P | Environmental | Open in IMG/M |
3300031813 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - 1anoA | Environmental | Open in IMG/M |
3300032753 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18013 | Environmental | Open in IMG/M |
3300034013 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
TB03JUN2009E_00001030 | 3300000176 | Freshwater | MENNIPTQQQPKPEKRPNDTGAINVDGLVRIFDPKTKKVFVEQKA* |
TB03JUN2009E_0006335 | 3300000176 | Freshwater | MENNTPIQQKPTVPEKQPNETGTVNVAGFLKIYDPKTRKVFVEQKDA* |
G310J44882_100117863 | 3300002933 | Freshwater | MENKTPIQQKADIPKKPPNDTGSVTVAGFLKIHDPNNRKVFVEQKDD* |
JGI26470J50227_1000005175 | 3300003375 | Freshwater | MENTTSNQQQTNPSKQPTDTGSVSVDAFVKIFDPKTRKVFVEQKS* |
JGI26470J50227_10088403 | 3300003375 | Freshwater | MENKTPIQQNADIPKKPPNDTGSVTVAGFLKIHDPNNRKVFVEQKDD* |
JGI26470J50227_10113202 | 3300003375 | Freshwater | MENKTPIQQTTSKPEKRPNDTGSVNVTGFLKIYDPNTRKVFVEQKDD* |
JGI26470J50227_10640182 | 3300003375 | Freshwater | QPQPQQKPEKRPDDTGSVAVEGFVKIFDPKTRKVFVEQQA* |
Ga0007829_100157273 | 3300004095 | Freshwater | VGINHNKYNTMENKTPNQQQVQPQKRPNDTGSVTVDGFIKIYDPKTRKVFVEQKA* |
Ga0065168_10544612 | 3300004684 | Freshwater | MNNKLPTQQQSTPEKRPNDTGSVSVEAFLKISDPKTRKVFVEQKA* |
Ga0065177_10001132 | 3300004685 | Freshwater | MENNNTTQSQSKPEKTPNDTGTVSFESFLKISDPKTRKVFVEQKA* |
Ga0065177_10003457 | 3300004685 | Freshwater | MENKTPNQKSQSLAPKKRPDDSSSVSVNGFIKIFDPKTRKVFVEQKA* |
Ga0065177_10164654 | 3300004685 | Freshwater | STQQQVKPEKRPNDTGAVSVDAFVKIFDPKTRKVFVEQKA* |
Ga0065177_10368501 | 3300004685 | Freshwater | MENKTPTQQQEQVKPEKRPNDTGSVTVDGFVKIFDPKTRKVFVEQKA*LFNQV* |
Ga0065173_10013482 | 3300004686 | Freshwater | VMMDNKTTNQQEHQPEQQKRPDDTGSVAVEGFVKIFDPKTRKVFVEQQA* |
Ga0065174_10045363 | 3300004687 | Freshwater | MENKTPTQQQEQVKPEKRPNDTGSVTVDGFVKIFDPKTRKVFVEQKA* |
Ga0007804_10433642 | 3300004770 | Freshwater | MENKIPTQQTTPQKRPNDTGAVAVDGFLKIFDPKTHKVFVEQKA* |
Ga0007804_10957971 | 3300004770 | Freshwater | MMDNKTTNQQEHQPEQQKRPDDTGSVAVEGFVKIFDPKTRKVFVEQQA** |
Ga0007804_11359922 | 3300004770 | Freshwater | NKYNTMENKTPNQQQVQPQKRPNDTGSVTVDGFIKIYDPKTRKVFVEQKA* |
Ga0007791_102440762 | 3300004772 | Freshwater | MENKTQPQQPASKPEKRPNDTGSVSVEGFIKIYDPQSRKVFVEQKA* |
Ga0007794_100019962 | 3300004774 | Freshwater | MENTNSTQQQVTPEKRPNDTGSVSVDAFVKIFDPKTRKVFVEQKA* |
Ga0007796_100453971 | 3300004804 | Freshwater | MENKTQPQQPASKPEKRPNDTGSVSVEGFIKIYDPQSRKVFV |
Ga0007881_11033192 | 3300006072 | Freshwater | MDNKTTNQQEHQPEQQKRPDDTGSVAVEGFVKIFDPKTRKVFVEQQA* |
Ga0007806_10164642 | 3300006100 | Freshwater | MMDNKTTNQPQPQQKPEKRPDDTGSVAVEGFVKIFDPKTRKVFVEQQA* |
Ga0007810_10057352 | 3300006101 | Freshwater | MENKTVNQTPQAQQPGKQPGKQPDDTNSVSVEGFVKIFDPKTRKVFVEQKA* |
Ga0007810_10281142 | 3300006101 | Freshwater | MMDNKTTNQQEHQPEQQKRPDDTGSVAVEGFVKIFDPKTRKVFVEQQA* |
Ga0007858_10468731 | 3300006113 | Freshwater | QSKPEKTPNDTGTVSFESFLKISDPKTRKVFVEQKA* |
Ga0007858_11104282 | 3300006113 | Freshwater | ADIPKKPPNDTGSVTVAGFLKIHDPNNRKVFVEQKDD* |
Ga0007816_10317662 | 3300006115 | Freshwater | MDNKTTNQPQPQQKPEKRPDDTGSVAVEGFVKIFDPKTRKVFVEQQA* |
Ga0007859_10114751 | 3300006118 | Freshwater | IQQKADIPKKPPNDTGSVTVAGFLKIHDPNNRKVFVEQKDD* |
Ga0007805_10483771 | 3300006127 | Freshwater | NQPQPQQKPEKRPDDTGSVAVEGFVKIFDPKTRKVFVEQQA* |
Ga0007834_10178701 | 3300006129 | Freshwater | MENKTPNQQQVQPQKRPNDTGSVTVGGFIKIYDPKT |
Ga0114962_1000045812 | 3300009151 | Freshwater Lake | MENKTTTQQPAVKPEKRPNDTGSVSVEGFIKIYDPQSRKVFVEQKA* |
Ga0114962_101430192 | 3300009151 | Freshwater Lake | MENKTPTQQQQVQPEKRPNDTGSVTVDGFVKIFDPQTRKVFVEQKA* |
Ga0114962_103725221 | 3300009151 | Freshwater Lake | MENKIPTQSQVNKPEKRPNETGSIAVDGFVKIFDPKTLKV |
Ga0114980_105496932 | 3300009152 | Freshwater Lake | MNNKLPTQQQPTPEKRPNDTGSVSVEAFLKITDPKTRKVFVEQKA* |
Ga0114963_100087433 | 3300009154 | Freshwater Lake | MENKTTTQTPQVQKPQKRPDDTGHVSVDGFVKIFDPKTHKVFVEQKA* |
Ga0114968_101961692 | 3300009155 | Freshwater Lake | MENKTNTQQPAVKPEKRPNDTGSVSVEGFIKIYDPQSRKVFVEQKA* |
Ga0114977_102881191 | 3300009158 | Freshwater Lake | MENKTPTQQQQVQPQKRPNDTGSVAVDGFIKIYDPKTRKVFVEQKA* |
Ga0114977_103488901 | 3300009158 | Freshwater Lake | MNNKLPTQQQPTPEKRPNDTGSVSVEAFLKITDPKTRKVFV |
Ga0114975_100006158 | 3300009164 | Freshwater Lake | MQNTTSNQKQTNPSKQPTDTGSVAVEAFVKIFDPKTRKVFVEQKS* |
Ga0114975_105959292 | 3300009164 | Freshwater Lake | MENKTPTQQQVQPQKRPNDTGSVTVDGFIKIYDPKTRKVFVEQKA* |
Ga0114969_107914582 | 3300009181 | Freshwater Lake | MNNKLPTQQQPNPEKRPNDTGSVSVEAFLKISDPKTRKVFVEQKA* |
Ga0114959_1000007391 | 3300009182 | Freshwater Lake | MENKTPTQQQQVQPEKRPNDTGSVTVDGFVKIFDPQTHKVFVEQKA* |
Ga0114959_100011013 | 3300009182 | Freshwater Lake | MENKTVNQTPQAQQPVKQPDDTNLVSVEGFVKIFDPKTRKVFVEQKA* |
Ga0114959_100346314 | 3300009182 | Freshwater Lake | MENTTPNPQQTNPSKQPTDTGSVAVEAFVKIFDPKTRKVFVEQKS* |
Ga0114959_103789852 | 3300009182 | Freshwater Lake | MENKTTNQPNTQQASSKRPPDDTGKVSVDGFVKIFDPKTRKVFVEQKA* |
Ga0114974_100297013 | 3300009183 | Freshwater Lake | MENKTQPQQPVSKPEKRPNDTGSVSVEGFIKIYDPQTRKVFVEQKA* |
Ga0114951_100338753 | 3300009502 | Freshwater | MENKTPTQQEQQIKPEKRPNDTGSVTVDGFVKIFDPKTRKVFVEQKA* |
Ga0114951_100536382 | 3300009502 | Freshwater | MENKTTNQTPQVQQPKKRPDDTSKVTVDGFVKIFDPKTRKVFVEQKA* |
Ga0114964_100119322 | 3300010157 | Freshwater Lake | MENKIPTQSQVNKPEKRPNETGSIAVDGFVKIFDPKTLKVFVEQQA* |
Ga0114960_100759863 | 3300010158 | Freshwater Lake | MENKTVNQTPQAQQPVKQPDDTNSVSVEGFVKIFDPKTRKVFVEQKA* |
Ga0114967_106056571 | 3300010160 | Freshwater Lake | QQQPNPEKRPNDTGSVSVEAFLKISDPKTRKVFVEQKA* |
Ga0133913_108786172 | 3300010885 | Freshwater Lake | MENKITTQTPQVQKPQKRPDDTGHVSVDGFVKIFDPKTHKVFVEQKA* |
Ga0133913_110354003 | 3300010885 | Freshwater Lake | MENKTPTQQQQVQPQKRPNDTGAVTVDGFIKIYDPKTRKVFVEQKA* |
Ga0133913_110425353 | 3300010885 | Freshwater Lake | MNNKLPTQQQPTPEKRPNDTGSVSVEAFLKISDPKTRKVFVEQKA* |
Ga0164292_105432812 | 3300013005 | Freshwater | MENTTSTQQQSNPTKQPNDTGSVSVDAFVKIFDPKTRKVFVEQKA* |
Ga0164296_10889061 | 3300013093 | Freshwater | QNADIPKKPPNDTGSVTVAGFLKIHDPNNRKVFVEQKDD* |
Ga0136642_10066302 | 3300013285 | Freshwater | MQNTTPTQQQNTPGKPPTDTGSVSVEAFVKIFDPKTRKVFVEQKA* |
Ga0207193_100098625 | 3300020048 | Freshwater Lake Sediment | MENTTSTQQHPKPEKSPNDTGSVSVDAFVKIFDPKTRKVFVEQKA |
Ga0214221_10278672 | 3300020699 | Freshwater | MENKTPIQQKADIPKKPPNDTGSVTVAGFLKIHDPNNRKVFVEQKDD |
Ga0214207_10048084 | 3300020716 | Freshwater | MENNIPTQQQPKPEKRPNDTGAINVDGLVRIFDPKTKKVFVEQKA |
Ga0214207_10062853 | 3300020716 | Freshwater | MNNKLPTQQQSTPEKRPNDTGSVSVEAFLKISDPKTRKVFVEQKA |
Ga0214172_10439152 | 3300020733 | Freshwater | MENNNTTQSQSKPEKTPNDTGTVSFESFLKISDPKTRKVFVEQKA |
Ga0194048_1000046412 | 3300021519 | Anoxic Zone Freshwater | MNNKLPTQQQPTPEKRPNDTGSVSVEAFLKITDPKTRKVFVEQKA |
Ga0194048_100032659 | 3300021519 | Anoxic Zone Freshwater | MMENNTPKQPQINKPEKRPNDTGSVAVDGFIKIFDPKTRKVFVEQKA |
Ga0194048_103214532 | 3300021519 | Anoxic Zone Freshwater | MENKIPTQSQVNKPEKRPNETGSIAVDGFVKIFDPKTLKVFVEQQA |
Ga0212088_101122323 | 3300022555 | Freshwater Lake Hypolimnion | MENKTPTQQEQQIKPEKRPNDTGSVTVDGFVKIFDPKTRKVFVEQKA |
Ga0212088_108027242 | 3300022555 | Freshwater Lake Hypolimnion | MENNIPTQQLPKPEKRPNDTGAINVDGFVKIFDPKTKKVFVEQKA |
Ga0236341_14332552 | 3300022591 | Freshwater | MENKIPTQQQTPQKRPNDTGSVAVDGFVKIFDPKTRKVFVEQQA |
Ga0236340_10756522 | 3300022594 | Freshwater | MENKTPTQQEQQIKPEKRPNDTGSVTVDGFVKIFDPKTRKVFVEQNA |
Ga0248169_1032373 | 3300022602 | Freshwater | MDNKTTNQPQPQQKPEKRPDDTGSVAVEGFVKIFDPKTRKVFVEQQA |
Ga0248169_1071912 | 3300022602 | Freshwater | MENKTPIQQTTSKPEKRPNDTGSVNVTGFLKIYDPNTRKVFVEQKDD |
Ga0256681_111504201 | 3300023311 | Freshwater | MENKTPTQQEQQIKPEKRPNDTGSVTVDGFVKIFDPKTRKVFVE |
Ga0208255_1089282 | 3300025353 | Freshwater | MENKTPNQQQVQPQKRPNDTGSVTVDGFIKIYDPKTRKVFVEQKA |
Ga0208504_10100522 | 3300025358 | Freshwater | MMDNKTTNQQEHQPEQQKRPDDTGSVAVEGFVKIFDPKTRKVFVEQQA |
Ga0208504_10167822 | 3300025358 | Freshwater | MENKTPNQKSQSLAPKKRPDDSSSVSVNGFIKIFDPKTRKVFVEQKA |
Ga0208250_10510192 | 3300025383 | Freshwater | MENNTPIQQKPTVPEKQPNETGTVNVAGFLKIYDPKTRKVFVEQKDA |
Ga0208378_10299111 | 3300025407 | Freshwater | NQPQPQQKPEKRPDDTGSVAVEGFVKIFDPKTRKVFVEQQA |
Ga0208875_10743162 | 3300025410 | Freshwater | MENKTPTQQQEQVKPEKRPNDTGSVTVDGFVKIFDPKTRKVFVEQKA |
Ga0207958_10181631 | 3300025421 | Freshwater | IQQKADIPKKPPNDTGSVTVAGFLKIHDPNNRKVFVEQKDD |
Ga0208746_10021858 | 3300025423 | Freshwater | NNTTQSQSKPEKTPNDTGTVSFESFLKISDPKTRKVFVEQKA |
Ga0208746_10078022 | 3300025423 | Freshwater | MENKIPTQQTTPQKRPNDTGAVAVDGFLKIFDPKTHK |
Ga0208106_10883762 | 3300025449 | Freshwater | MENNNTTQSQSKPEKTPNDTGTVSFESFLKISDPKTR |
Ga0208497_10782511 | 3300025466 | Freshwater | MENKIPTQQTTPQKRPNDTGAVAVDGFLKIFDPKTHKVFVEQKA |
Ga0208105_10277671 | 3300025487 | Freshwater | MKNTNSTQQQVKPEKRPNDTGAVSVDAFVKIFDPKTRKVFVEQKDD |
Ga0208864_11204772 | 3300025578 | Freshwater | MENKTQPQQPASKPEKRPNDTGSVSVEGFIKIYDPQSRKVFVEQKA |
Ga0208379_11288142 | 3300025598 | Freshwater | MMDNKTTNQPQPQQKPEKRPDDTGSVAVEGFVKIFDPKTRKVFVEQQA |
Ga0208741_101345812 | 3300025723 | Freshwater | MMDNKTTNQQEQQPEQQKRPDDTGSVAVEGFIKIFDPKTRKVFVEQQA |
Ga0208388_10027922 | 3300025778 | Freshwater | MENKTPIQQNADIPKKPPNDTGSVTVAGFLKIHDPNNRKVFVEQKDD |
Ga0209188_100013376 | 3300027708 | Freshwater Lake | MENKTPTQQQQVQPEKRPNDTGSVTVDGFVKIFDPQTRKVFVEQKA |
Ga0209188_10235802 | 3300027708 | Freshwater Lake | MENKTVNQTPQAQQPVKQPDDTNSVSVEGFVKIFDPKTRKVFVEQKA |
Ga0209188_10246074 | 3300027708 | Freshwater Lake | MENTTPNPQQTNPSKQPTDTGSVAVEAFVKIFDPKTRKVFVEQKS |
Ga0209188_10606762 | 3300027708 | Freshwater Lake | MENKTTTQTPQVQKPQKRPDDTGHVSVDGFVKIFDPKTHKVFVEQKA |
Ga0209087_12555682 | 3300027734 | Freshwater Lake | MENKTPTQQQVQPQKRPNDTGSVTVDGFIKIYDPKTRKVFVEQKA |
Ga0209190_12461272 | 3300027736 | Freshwater Lake | MENKTNTQQPAVKPEKRPNDTGSVSVEGFIKIYDPQSRKVFVEQKA |
Ga0209085_12806052 | 3300027741 | Freshwater Lake | MENKTTTQQPAVKPEKRPNDTGSVSVEGFIKIYDPQSRKVFVEQKA |
Ga0209296_10445752 | 3300027759 | Freshwater Lake | MENKTQPQQPVSKPEKRPNDTGSVSVEGFIKIYDPQTRKVFVEQKA |
Ga0209777_101017031 | 3300027896 | Freshwater Lake Sediment | MENNIPTQQQPKPEKRPNDTGTINVDGFVRIFDPKTKKVFVEQKA |
Ga0209777_108382162 | 3300027896 | Freshwater Lake Sediment | RTMENTTSKQQPLNPEKRPNDTGSVSVDAFIKIFDPKTRKVFVEQKA |
Ga0209777_109205912 | 3300027896 | Freshwater Lake Sediment | MENKIPTQQQPKPEKRPNDTGAINVDGFVKIFDPATRKVFVEQKA |
Ga0209400_12129631 | 3300027963 | Freshwater Lake | MENKTNTQQPAVKPEKRPNDTGSVSVEGFIKIYDPQSRKVFVEQ |
Ga0304728_10426682 | 3300028393 | Freshwater Lake | MENKTVNQTPQAQQPVKQPDDTNLVSVEGFVKIFDPKTRKVFVEQKA |
Ga0316219_10097474 | 3300031759 | Freshwater | MENKTPNQKSQSLAPNKRPDDSSSVSVNGFIKIFDPKTRKVFVEQKA |
Ga0316217_100933312 | 3300031813 | Freshwater | MENKTPIQQKADIPNKPPNDTGSVTVAGFLKIHDPNNRKVFVEQKDD |
Ga0316224_11091831 | 3300032753 | Freshwater | MENKTPNQKSQSLAPNKRPDDSSSVSVNGFIKIFDPKTRKVFVEQ |
Ga0334991_0085953_128_265 | 3300034013 | Freshwater | MENTTSTQQQSNPTKQPNDTGSVSVDAFVKIFDPKTRKVFVEQKA |
⦗Top⦘ |