NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F092939

Metagenome / Metatranscriptome Family F092939

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F092939
Family Type Metagenome / Metatranscriptome
Number of Sequences 107
Average Sequence Length 52 residues
Representative Sequence NSEATLYPPEEAVKNLIRMSAYMDKKLGSISANRVVDLSILDELGTKRNQRAQR
Number of Associated Samples 101
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 4.67 %
% of genes near scaffold ends (potentially truncated) 85.05 %
% of genes from short scaffolds (< 2000 bps) 85.98 %
Associated GOLD sequencing projects 95
AlphaFold2 3D model prediction Yes
3D model pTM-score0.39

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.131 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(10.280 % of family members)
Environment Ontology (ENVO) Unclassified
(37.383 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(33.645 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 43.90%    β-sheet: 0.00%    Coil/Unstructured: 56.10%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.39
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF07311Dodecin 21.50
PF03641Lysine_decarbox 11.21
PF03737RraA-like 5.61
PF09084NMT1 4.67
PF13676TIR_2 3.74
PF03807F420_oxidored 3.74
PF00528BPD_transp_1 2.80
PF08021FAD_binding_9 1.87
PF00005ABC_tran 1.87
PF00182Glyco_hydro_19 1.87
PF00596Aldolase_II 1.87
PF07362CcdA 1.87
PF00575S1 0.93
PF02353CMAS 0.93
PF08241Methyltransf_11 0.93
PF01268FTHFS 0.93
PF03741TerC 0.93
PF07969Amidohydro_3 0.93
PF03884YacG 0.93
PF01471PG_binding_1 0.93
PF00903Glyoxalase 0.93
PF01042Ribonuc_L-PSP 0.93
PF01979Amidohydro_1 0.93
PF13426PAS_9 0.93
PF00072Response_reg 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 107 Family Scaffolds
COG3360Flavin-binding protein dodecinGeneral function prediction only [R] 21.50
COG1611Nucleotide monophosphate nucleosidase PpnN/YdgH, Lonely Guy (LOG) familyNucleotide transport and metabolism [F] 11.21
COG0684RNA degradosome component RraA (regulator of RNase E activity)Translation, ribosomal structure and biogenesis [J] 5.61
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 4.67
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 4.67
COG0543NAD(P)H-flavin reductaseEnergy production and conversion [C] 3.74
COG5302Post-segregation antitoxin (ccd killing mechanism protein) encoded by the F plasmidMobilome: prophages, transposons [X] 1.87
COG3979ChitodextrinaseCarbohydrate transport and metabolism [G] 1.87
COG3179Chitinase, GH19 familyCarbohydrate transport and metabolism [G] 1.87
COG2375NADPH-dependent ferric siderophore reductase, contains FAD-binding and SIP domainsInorganic ion transport and metabolism [P] 1.87
COG1018Flavodoxin/ferredoxin--NADP reductaseEnergy production and conversion [C] 1.87
COG2230Cyclopropane fatty-acyl-phospholipid synthase and related methyltransferasesLipid transport and metabolism [I] 0.93
COG2759Formyltetrahydrofolate synthetaseNucleotide transport and metabolism [F] 0.93
COG3024Endogenous inhibitor of DNA gyrase, YacG/DUF329 familyReplication, recombination and repair [L] 0.93
COG22272-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylaseCoenzyme transport and metabolism [H] 0.93
COG2226Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenGCoenzyme transport and metabolism [H] 0.93
COG0861Tellurite resistance membrane protein TerCInorganic ion transport and metabolism [P] 0.93
COG0251Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 familyDefense mechanisms [V] 0.93


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.13 %
UnclassifiedrootN/A1.87 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000890|JGI11643J12802_11900363All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria820Open in IMG/M
3300001372|YBBDRAFT_1056150All Organisms → cellular organisms → Bacteria1113Open in IMG/M
3300003987|Ga0055471_10243640All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium569Open in IMG/M
3300003994|Ga0055435_10230428All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium541Open in IMG/M
3300003999|Ga0055469_10223220All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium594Open in IMG/M
3300004779|Ga0062380_10030841All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1694Open in IMG/M
3300005185|Ga0066811_1011098All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium667Open in IMG/M
3300005276|Ga0065717_1003862All Organisms → cellular organisms → Bacteria1161Open in IMG/M
3300005334|Ga0068869_100701969All Organisms → cellular organisms → Bacteria863Open in IMG/M
3300005339|Ga0070660_100083374All Organisms → cellular organisms → Bacteria2511Open in IMG/M
3300005444|Ga0070694_101756867All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300005459|Ga0068867_101874584Not Available565Open in IMG/M
3300005559|Ga0066700_10511951All Organisms → cellular organisms → Bacteria837Open in IMG/M
3300005577|Ga0068857_100451458All Organisms → cellular organisms → Bacteria1202Open in IMG/M
3300005615|Ga0070702_101278809All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300005719|Ga0068861_101171440All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium742Open in IMG/M
3300005874|Ga0075288_1000838All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria4035Open in IMG/M
3300005886|Ga0075286_1000747All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria4277Open in IMG/M
3300006755|Ga0079222_10585377All Organisms → cellular organisms → Bacteria847Open in IMG/M
3300006844|Ga0075428_102065296All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp.590Open in IMG/M
3300006847|Ga0075431_101399762All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300006881|Ga0068865_101402379All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300006904|Ga0075424_102610826All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300007004|Ga0079218_14003746All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium501Open in IMG/M
3300009053|Ga0105095_10827380All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca → Desulfobacca acetoxidans → Desulfobacca acetoxidans DSM 11109519Open in IMG/M
3300009100|Ga0075418_11588448All Organisms → cellular organisms → Bacteria710Open in IMG/M
3300009137|Ga0066709_102719771All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium659Open in IMG/M
3300009148|Ga0105243_10222095All Organisms → cellular organisms → Bacteria1671Open in IMG/M
3300009157|Ga0105092_10118892All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1457Open in IMG/M
3300010029|Ga0105074_1005832All Organisms → cellular organisms → Bacteria1850Open in IMG/M
3300010046|Ga0126384_11355607All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium662Open in IMG/M
3300010047|Ga0126382_10584859All Organisms → cellular organisms → Bacteria916Open in IMG/M
3300010360|Ga0126372_12546874All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300010373|Ga0134128_10151267All Organisms → cellular organisms → Bacteria2623Open in IMG/M
3300010391|Ga0136847_10855921All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1060Open in IMG/M
3300011414|Ga0137442_1044108All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium883Open in IMG/M
3300011433|Ga0137443_1094496All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium855Open in IMG/M
3300011435|Ga0137426_1249902All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium530Open in IMG/M
3300011445|Ga0137427_10036796All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Piscinibacter → Piscinibacter defluvii1926Open in IMG/M
3300012034|Ga0137453_1020241All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1050Open in IMG/M
3300012205|Ga0137362_10942161All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium736Open in IMG/M
3300012355|Ga0137369_10708032All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium692Open in IMG/M
3300012484|Ga0157333_1024533All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium561Open in IMG/M
3300012497|Ga0157319_1044515All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300012506|Ga0157324_1015893All Organisms → cellular organisms → Bacteria710Open in IMG/M
3300012582|Ga0137358_10092787All Organisms → cellular organisms → Bacteria2041Open in IMG/M
3300012913|Ga0157298_10277144All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300012922|Ga0137394_10021745All Organisms → cellular organisms → Bacteria → Proteobacteria5149Open in IMG/M
3300012922|Ga0137394_10652680All Organisms → cellular organisms → Bacteria888Open in IMG/M
3300012931|Ga0153915_10653223All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1212Open in IMG/M
3300012951|Ga0164300_11138795All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp.513Open in IMG/M
3300013096|Ga0157307_1156217All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium534Open in IMG/M
3300013296|Ga0157374_10012063All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium7503Open in IMG/M
3300014304|Ga0075340_1036858All Organisms → cellular organisms → Bacteria807Open in IMG/M
3300015373|Ga0132257_100386371All Organisms → cellular organisms → Bacteria1699Open in IMG/M
3300016319|Ga0182033_10708243All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium882Open in IMG/M
3300017997|Ga0184610_1007763All Organisms → cellular organisms → Bacteria2612Open in IMG/M
3300018052|Ga0184638_1327974All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp.515Open in IMG/M
3300018081|Ga0184625_10500409All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp.613Open in IMG/M
3300018466|Ga0190268_10203216All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1084Open in IMG/M
3300019362|Ga0173479_10566389All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium587Open in IMG/M
3300021080|Ga0210382_10410656All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300021332|Ga0210339_1433552All Organisms → cellular organisms → Bacteria → Proteobacteria577Open in IMG/M
3300021344|Ga0193719_10290783All Organisms → cellular organisms → Bacteria687Open in IMG/M
3300025537|Ga0210061_1005822All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1937Open in IMG/M
3300025559|Ga0210087_1013641All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1693Open in IMG/M
3300025900|Ga0207710_10489023All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium638Open in IMG/M
3300025904|Ga0207647_10092792All Organisms → cellular organisms → Bacteria1800Open in IMG/M
3300025925|Ga0207650_10332466All Organisms → cellular organisms → Bacteria1246Open in IMG/M
3300025932|Ga0207690_11286082All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium611Open in IMG/M
3300025938|Ga0207704_10629740All Organisms → cellular organisms → Bacteria881Open in IMG/M
3300025940|Ga0207691_10012836All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales8020Open in IMG/M
3300025959|Ga0210116_1007078All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1993Open in IMG/M
3300026014|Ga0208776_1000753All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2790Open in IMG/M
3300026023|Ga0207677_10039567All Organisms → cellular organisms → Bacteria3102Open in IMG/M
3300026088|Ga0207641_10745348All Organisms → cellular organisms → Bacteria967Open in IMG/M
3300026118|Ga0207675_101852967All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium622Open in IMG/M
3300026716|Ga0208344_102410All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium556Open in IMG/M
3300027513|Ga0208685_1018424All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Piscinibacter → Piscinibacter defluvii1596Open in IMG/M
3300027722|Ga0209819_10352228All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp.503Open in IMG/M
3300027831|Ga0209797_10459798All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium509Open in IMG/M
3300027907|Ga0207428_10039551All Organisms → cellular organisms → Bacteria3830Open in IMG/M
3300028536|Ga0137415_10326405All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1338Open in IMG/M
3300031547|Ga0310887_11051201All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium521Open in IMG/M
3300031716|Ga0310813_11488181All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp.630Open in IMG/M
3300031820|Ga0307473_11260758All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300031847|Ga0310907_10507416All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300031854|Ga0310904_10165593All Organisms → cellular organisms → Bacteria1300Open in IMG/M
3300031854|Ga0310904_11130356All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium562Open in IMG/M
3300031858|Ga0310892_11217970All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300032013|Ga0310906_10559040All Organisms → cellular organisms → Bacteria783Open in IMG/M
3300032075|Ga0310890_10291977All Organisms → cellular organisms → Bacteria1168Open in IMG/M
3300032180|Ga0307471_101752788All Organisms → cellular organisms → Bacteria774Open in IMG/M
3300033004|Ga0335084_10846697Not Available927Open in IMG/M
3300033412|Ga0310810_10129350All Organisms → cellular organisms → Bacteria → Proteobacteria2967Open in IMG/M
3300033412|Ga0310810_10278926All Organisms → cellular organisms → Bacteria1814Open in IMG/M
3300033419|Ga0316601_101313252All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium727Open in IMG/M
3300033475|Ga0310811_10121057All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium3352Open in IMG/M
3300033480|Ga0316620_10331876All Organisms → cellular organisms → Bacteria1346Open in IMG/M
3300033814|Ga0364930_0020666All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2201Open in IMG/M
3300034115|Ga0364945_0040525All Organisms → cellular organisms → Bacteria1280Open in IMG/M
3300034115|Ga0364945_0071732All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca → Desulfobacca acetoxidans → Desulfobacca acetoxidans DSM 11109990Open in IMG/M
3300034115|Ga0364945_0221237All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium580Open in IMG/M
3300034147|Ga0364925_0060719All Organisms → cellular organisms → Bacteria1298Open in IMG/M
3300034148|Ga0364927_0022775All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Piscinibacter → Piscinibacter defluvii1497Open in IMG/M
3300034148|Ga0364927_0214308All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca → Desulfobacca acetoxidans → Desulfobacca acetoxidans DSM 11109570Open in IMG/M
3300034151|Ga0364935_0040627All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Piscinibacter → Piscinibacter defluvii1333Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil10.28%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment7.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil6.54%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands5.61%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil5.61%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.61%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere4.67%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.67%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment2.80%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.80%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.80%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.80%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil2.80%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.80%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment1.87%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.87%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.87%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.87%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.87%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.87%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere1.87%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.87%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.93%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment0.93%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.93%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.93%
Marine EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.93%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.93%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.93%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.93%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.93%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300001372YB-Back-sedEnvironmentalOpen in IMG/M
3300003987Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2EnvironmentalOpen in IMG/M
3300003994Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300003999Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2EnvironmentalOpen in IMG/M
3300004779Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3FreshEnvironmentalOpen in IMG/M
3300005185Soil and rhizosphere microbial communities from Laval, Canada - mgHPBEnvironmentalOpen in IMG/M
3300005276Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5Host-AssociatedOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005874Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404EnvironmentalOpen in IMG/M
3300005886Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009053Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300010029Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_10_20EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300011414Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT266_2EnvironmentalOpen in IMG/M
3300011433Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT300_2EnvironmentalOpen in IMG/M
3300011435Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2EnvironmentalOpen in IMG/M
3300011445Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2EnvironmentalOpen in IMG/M
3300012034Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT526_2EnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012484Unplanted soil (control) microbial communities from North Carolina - M.Soil.2.old.190510EnvironmentalOpen in IMG/M
3300012497Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510Host-AssociatedOpen in IMG/M
3300012506Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610Host-AssociatedOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012913Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2EnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300013096Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2EnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300014304Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D1EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021332Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.384 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300025537Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025559Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025959Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026014Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205 (SPAdes)EnvironmentalOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026716Grasslands soil microbial communities from Kansas, USA, that are Nitrogen fertilized - NN592 (SPAdes)EnvironmentalOpen in IMG/M
3300027513Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 (SPAdes)EnvironmentalOpen in IMG/M
3300027722Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027831Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033419Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCTEnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300033480Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_BEnvironmentalOpen in IMG/M
3300033814Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17EnvironmentalOpen in IMG/M
3300034115Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17EnvironmentalOpen in IMG/M
3300034147Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17EnvironmentalOpen in IMG/M
3300034148Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17EnvironmentalOpen in IMG/M
3300034151Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI11643J12802_1190036313300000890SoilQYLHVNSEASLYPPEAAVKNLIRMSGYMDKKLASTDVNKVLDLSLLDEIGTKRHQRAQK*
YBBDRAFT_105615033300001372Marine EstuarineYPPDDAVKNLIRMSAYMDKKLGAINANQFIDLSILDELGTKRNERSPQR*
Ga0055471_1024364013300003987Natural And Restored WetlandsVNNLIRMSRYMDKKLGSITANRVVDFTILDELGTKRNQRKQK*
Ga0055435_1023042823300003994Natural And Restored WetlandsPDDAVKNLIRMSAYMDKKLGAINANRFMDLSILDELGTKRNRRAP*
Ga0055469_1022322023300003999Natural And Restored WetlandsPPDQAVANLVRMSAYMDKKLGAIGAASVIDLSLLDELGTRRNQRR*
Ga0062380_1003084113300004779Wetland SedimentLHANSEATLYPPEEAVKNLIRMSGYMDKKLASISVNRIMDLSLLDELGTKRYQRAPR*
Ga0066811_101109813300005185SoilSEAALYPPEEAVKNLIRMSAYMDKKLGSISANRVVDLSILDELGTKRNQRGQR*
Ga0065717_100386233300005276Arabidopsis RhizosphereAYDYLHANSEATLYPPAEAVENLIKMSGYMDKKLQSINAKQVVDLSLLDELGTKQNERVHR*
Ga0068869_10070196933300005334Miscanthus RhizosphereLKAIGALHANSETTLYPPAEAVENLIKMSGYMDKKLQLISAKQVVDLSVLDELGTKQNERAHR*
Ga0070660_10008337443300005339Corn RhizosphereLHANSETTLYPPAEAVENLIKMSGYMDKKLQLISAKQVVDLSVLDELGTKQNERAHR*
Ga0070694_10175686723300005444Corn, Switchgrass And Miscanthus RhizosphereNSEATLYPPDDAVKNLIRMSAYMDKKLGTISANRVVDLSILDELGTKRNQRWQK*
Ga0068867_10187458423300005459Miscanthus RhizosphereSEATLYPPEDAVKNLIRMSAYMDKKLAAISANRVIDLSVLDELGTKRNQRGQR*
Ga0066700_1051195113300005559SoilNLIRMSAYMDKKLGSISANRVVDLSILDELGTKRNQRAQR*
Ga0068857_10045145833300005577Corn RhizosphereAYDYLHANSEATLYPPAEAVENLIKMSGYMEKKLQSIDAKQVVDLSLLDELGTKQNERVHR*
Ga0070702_10127880923300005615Corn, Switchgrass And Miscanthus RhizosphereYAYLHANSETTLYPPAEAVENLIKMSGYMEKKLQSISAKQVVDLSILDELGTKQNERVHR
Ga0068861_10117144023300005719Switchgrass RhizosphereLKAIGALHANSETTLYPPAEAVENLIKMSGYMDKKLQLISAKQVVDLSVLDELGTKQNERVHR*
Ga0075288_100083853300005874Rice Paddy SoilAVNNLIRMSRYMDKKLGSITANRVVDFTILDELGTKRNQRKQK*
Ga0075286_100074723300005886Rice Paddy SoilMSRYMDKKLGSITANRVVDFTILDELGTKRNQRKQK*
Ga0079222_1058537713300006755Agricultural SoilTNSEVSLYPPDDAVKNLIRMSTYMDKRLGAISADRVIDLSVLEELGIKRTQRAPK*
Ga0075428_10206529613300006844Populus RhizosphereYQYLQSNSDATLYPPDEAVKNLIRMSAYMDKKLGSISANRVLDLSILDELGTKRNQRAQR
Ga0075431_10139976213300006847Populus RhizosphereFAYDYLHANVETTLYPPAEAVENLIKMSGYMDKKLQSISAKQVVDLAILDELGTKQNERVHR*
Ga0068865_10140237923300006881Miscanthus RhizosphereDDAVKNLIRMSAYMDKKLGTISVNRVVDLSILDELGTKRNQRWQK*
Ga0075424_10261082623300006904Populus RhizosphereEDAVKNLIRMSAYMDKRLGAISANRVIDLSILEELGIKRSPRAQR*
Ga0079218_1400374623300007004Agricultural SoilMSIPSRRFTRREDAVKNLIRMSAYMDKKLGAISANRVMDFSILDELGTKRNQRAQK*
Ga0105095_1082738023300009053Freshwater SedimentYPPEDAVKNLIRMSGYMDKKLASISVSRVIDLSLLDELGTKRHQRGQR*
Ga0075418_1158844813300009100Populus RhizosphereVKLLNTSDHEVIDFAYDYLHANAETTLYPPAEAVENLIKMSGYMDKKLQSISAKQVVDLAILDELGTKQNERVHR*
Ga0066709_10271977113300009137Grasslands SoilMSAYVDKKLGAISAKRVVDLSILDELGTKRNQRVQK*
Ga0105243_1022209513300009148Miscanthus RhizosphereLKAIGALHANSETTLYPPAEAVENLIKMSGYMDKKLQSISAKQVVDLSILDELGTKQNERVHR*
Ga0105092_1011889213300009157Freshwater SedimentQYLHANSEASLYPPEVAVKNLIRMSGYMDKKLASINADRVLDLSLLDEIGTKRHQRGQK*
Ga0105074_100583233300010029Groundwater SandAVENLIRMSAYVDKKLGSISANRVVDLSILDELGTKRNQRGQK*
Ga0126384_1135560713300010046Tropical Forest SoilQNLIRMSAYMDKRLGSISANRLVDLSFLDELGTKRNQRPQR*
Ga0126382_1058485923300010047Tropical Forest SoilEAIKNLIRMSSYMDRKLGSISADKVVDLSILDELGTKRNQRPQR*
Ga0126372_1254687423300010360Tropical Forest SoilYPPDDATKNLIRMSAYMDKKLGSINVNRVVDLSLLDELGTKRNQRPPR*
Ga0134128_1015126713300010373Terrestrial SoilTNDAEVIDFAYSYLHAISETTLYPPGEAVENLIKMSGYMDKKLQSISAKQVVDLSILDELGTKQNERVHR*
Ga0136847_1085592123300010391Freshwater SedimentAVRNLIRMSAYMDKKLGSISPNRIMDLSILDEIGTKRNQPAQR*
Ga0137442_104410813300011414SoilMSGYMDKKLASISANRVVDLSILDELGTKRNARNQK*
Ga0137443_109449613300011433SoilEATLYPPEDAVKNLIRMSAYMDKKLGAISANRVMDFSILDELGTKRNQRAQK*
Ga0137426_124990213300011435SoilYPPDDAVKNLLRMSSYVDKKLGSISASRVIDLSILDELGTKRYQRVPR*
Ga0137427_1003679633300011445SoilEAVKNLIRMSAYVDKKLASISANKIMDLSILDEIGTKRNQRPQK*
Ga0137453_102024113300012034SoilAVKNLIRMSAYMDKKLGTISATRVMDLSILDELGTKRNQRAQK*
Ga0137362_1094216113300012205Vadose Zone SoilYQYLHANAEATLYPPDDAVKNLIRMSAYVDRKLGAISANRVVDLSILDELGTKRNQRVPK
Ga0137369_1070803223300012355Vadose Zone SoilSEATLYPPDEAVKYLICMSSYMDKKLGSISANRVVELSILDELGTKRNQRVQR*
Ga0157333_102453313300012484SoilQLLNTSDSDVIDFAYDYLHANSEATLYPPAEAVENLIKMSGYMEKKLQSIDAKQVVDLSLLDELGTKQNERVHR*
Ga0157319_104451513300012497Arabidopsis RhizosphereNSEATLYPPDDAVKNLIRMSAYMDKKLGTISVNRVVDLSILDELGTKRNQRGQK*
Ga0157324_101589313300012506Arabidopsis RhizosphereLTQLLNTSDNDVIDFAYDYLHANSEATLYPPAEAVENLIKMSGYMDKKLQSINAKQVVDLSLLDELGTKQNERAHR*
Ga0137358_1009278713300012582Vadose Zone SoilDAVKNLIRMSAYMDKKLGTISANRVVGLSILDELGTKRNQRWQK*
Ga0157298_1027714413300012913SoilLHANSETTLYPPAEAVENLIKMSGYMDKKLQSISAKQVVDLSVLDELGTKQNERAHR*
Ga0137394_1002174513300012922Vadose Zone SoilLYPPDDAVKNLIRMYAYMDKKLGTISANRVVDLSILDELGTKRNQRWQK*
Ga0137394_1065268023300012922Vadose Zone SoilYQYLHANSEATLYPPDEAVKNLIRMSVYMDKKLGTISANRVVDLSILDELGTKRNQRLQR
Ga0153915_1065322313300012931Freshwater WetlandsLYPPEEAVRNLIRMSAYMDKKLGSIGPNRIMDFSILDELGTKRNQPAQR*
Ga0164300_1113879513300012951SoilAVNNLIRMSAYMDKKLGSISPGRVVDLSILDELGTKRNQRAQK*
Ga0157307_115621713300013096SoilLKAIGALHANSETTLYPPAEAVENLIKMSGYMDKKLQSISAKQVVDLSLLDELGTKQNERAHR*
Ga0157374_1001206363300013296Miscanthus RhizosphereVIDFAYAYLHANSETTLYPPAEAVENLIKMSGYMDKKLQLISAKQVVDLSVLDELGTKQNERAHR*
Ga0075340_103685813300014304Natural And Restored WetlandsNLLRMSAYVDKRLGAISAGRVVDLSLLDELGTKRYQRAPR*
Ga0132257_10038637113300015373Arabidopsis RhizosphereNSEATLYPPAEAVENLIKMSAYMDKKLQSINAKQVVDLSLLDELGTKQNERVHR*
Ga0182033_1070824323300016319SoilYPPDEAVKNLIRMSAYMDKKLGSVSANRVVDLSILDEIGTQRNQRTLR
Ga0184610_100776343300017997Groundwater SedimentSAYMDKKLGSISVSRVVDLSILDELGTKRNQRVQK
Ga0184638_132797413300018052Groundwater SedimentAVKNLIRMAAYMDKKLGSIGANRVVDLSILDELGTKRNQRAQK
Ga0184625_1050040913300018081Groundwater SedimentNSDATLYPPDEAVNNLIRMSAYMDKKLGSISANRVVDLSILDELGTKHNQRAQK
Ga0190268_1020321613300018466SoilKNLIRMAGYMDKKLASISVNRIMDLSLLDELGTKRHQRGQR
Ga0173479_1056638923300019362SoilANSETTLYPPEDAVKNLIRMSAYMDKKLGAISANRVMDFSILDELGTKRNQRSQK
Ga0210382_1041065613300021080Groundwater SedimentLIRMSAYMDKKLASINPNRVVDLSILDELGTKRNQRVQK
Ga0210339_143355223300021332EstuarineLYPPEDAVKNLIRMSGYMDKKLASISVSRIMDLSLLDELGTKRHQRMQK
Ga0193719_1029078313300021344SoilHSNSDATLYPPDEAVNNLIRMSAYMDKKLGSISANRVVDLSILDELGTKHNQRAQK
Ga0210061_100582233300025537Natural And Restored WetlandsYPPDEAVNNLIRMSGYMDKKLGSINANRVVDFTILDELGTKRNQRKQK
Ga0210087_101364123300025559Natural And Restored WetlandsVNNLIRMSRYMDKKLGSITANRVVDFTILDELGTKRNQRKQK
Ga0207710_1048902313300025900Switchgrass RhizosphereFAYDYLHANSEATLYPPAEAVENLIKMSGYMDKKLQSINAKQVVDLSLLDELGTKQNERVHR
Ga0207647_1009279233300025904Corn RhizosphereYAYLHANSETTLYPPAEAVENLIKMSGYMDKKLQLISAKQVVDLSVLDELGTKQNERAHR
Ga0207650_1033246613300025925Switchgrass RhizosphereLYPPAEAVENLIKMSAYMDKKLQSINAKQVVDLSLLDELGTKQNERVHR
Ga0207690_1128608223300025932Corn RhizosphereLKAIGALHANSETTLYPPAEAVENLIKMSGYMDKKLQLISAKQVVDLSVLDELGTKQNERAHR
Ga0207704_1062974023300025938Miscanthus RhizospherePPDDAVKNLIRMSAYMDKKLGTISANRVVDLSILDELGTKRNQRWQK
Ga0207691_1001283693300025940Miscanthus RhizosphereLHANSEATLYPPAEAVENLIKMSGYMDKKLQSINAKQVVDLSLLDELGTKQNELVHR
Ga0210116_100707833300025959Natural And Restored WetlandsLRMSAYVDKRLGSISAGRVVDLSLLDELGTKRYQRAPR
Ga0208776_100075313300026014Rice Paddy SoilMSRYMDKKLGSITANRVVDFTILDELGTKRNQRKQK
Ga0207677_1003956753300026023Miscanthus RhizosphereTTLYPPAEAVENLIKMSGYMDKKLQSISAKQVVDLSILDELGTKQNERVHR
Ga0207641_1074534813300026088Switchgrass RhizosphereYAYLHANSETTLYPPAEAVENLIKMSGYMEKKLQSISAKQVVDLSILDELGTKQNERAHR
Ga0207675_10185296723300026118Switchgrass RhizosphereLKAIGALHANSETTLYPPAEAVENLIKMSGYMDKKLQSISAKQVVDLSILDELGTKQNERVHR
Ga0208344_10241023300026716SoilVIDFAYDYLHANAETTLYPPAEAVENLIKMSGYMDKKLQSISAKQVVDLAILDELGTKQNERVHR
Ga0208685_101842413300027513SoilPPDEAVKNLIRMSAYVDKKLASISANKIMDLSILDEIGTKRNQRAQK
Ga0209819_1035222823300027722Freshwater SedimentYPPDEAVGNLIKMSAYVDKKLGSISANKIVDLSILDELGTKRNQREQK
Ga0209797_1045979823300027831Wetland SedimentYLHANSEATLYPPEEAVKNLIRMSGYMDKKLASISVNRIMDLSLLDELGTKRYQRAPR
Ga0207428_1003955153300027907Populus RhizosphereYQYLHANSEATLYPPDDAVKNLIRMSAYMDKKLGTISANRVVDLSILDELGTKRNQRGQK
Ga0137415_1032640513300028536Vadose Zone SoilNAEATLYPPDDAVKNLIRMSAYVDKKLGAISANRVVDLSILDELGTKRNQRMPK
Ga0310887_1105120113300031547SoilANSEATLYPPAEAVENLIKMSGYMDKKLQSINAKQVVDLSLLDELGTKQNERVHR
Ga0310813_1148818113300031716SoilYLHANSETTLYPPEEAVKNLIRMSGYMDKKLASISANRVVDLSILDELGTKRNARNQK
Ga0307473_1126075823300031820Hardwood Forest SoilLIRMSAYMDKKLGTISANRVVDLSILDELGTKRNQRWQK
Ga0310907_1050741613300031847SoilPDDAVKNLIRMSAYMDKKLGTISVNRVVDLSILDELGTKRNQRGQK
Ga0310904_1016559313300031854SoilLHSNSDASLYPPDEAVNNLIRMSAYMDKKLASISPSRVVDLSILDELGTKRNQRAQK
Ga0310904_1113035613300031854SoilTLYPPEDAVKNLIRMSAYMDKKLGALSTTRVMDFSILDELGTKRSQRAQK
Ga0310892_1121797013300031858SoilDDAVKNLIRMSAYMDKKLGTISANRVVDLSILDELGTKRNQRGQK
Ga0310906_1055904023300032013SoilPPDDAVKNLIRMSAYMDKKLGTIRANRVVDLSILDELGTKRNQRGQK
Ga0310890_1029197713300032075SoilNTSDSDVIDFAYDYLHANSEATLYPPAEAVENLIKMSGYMDKKLQSINAKQVVDLSLLDELGTKQNERVHR
Ga0307471_10175278823300032180Hardwood Forest SoilNSEATLYPPDDAVKNLIRMSAYMDKKLGTISANRVVDLSILDELGTKRNQRWQK
Ga0335084_1084669723300033004SoilNLIRMSAYMDKKLGAISANRVVDLSILDELGTKRNQRVQK
Ga0310810_1012935033300033412SoilVIDFAYDYLHANSEATLYPPAEAVENLIKMSGYMEKKLQSIDAKQVVDLSLLDELGTKQNERVHR
Ga0310810_1027892613300033412SoilAYAYLHANSETTLYPPAEAVENLIKMSGYMDKKLQLISAKQVVDLSVLDELGTKQNERAH
Ga0316601_10131325223300033419SoilPDDAVKNLLRMSAYVDKRLGSISAGRVVDLSLLDELGTKRYQRMPR
Ga0310811_1012105753300033475SoilEVIDFAYDYLHANSEATLYPPAEAVENLIKMSGYMEKKLQSINAKQVVDLSLLDELGTKQNERVHR
Ga0316620_1033187643300033480SoilLYPPDQAVANLIRMSAYMDKKLGSIRAGQVIDLSLLDEIGTKQNQKR
Ga0364930_0020666_3_1763300033814SedimentLHSNSEATLYPPDDAIRNLIRMSAYVDKKFGSISPNRIVDLSVLDELGTKRNQPAQR
Ga0364945_0040525_1121_12793300034115SedimentEATLYPPDDAVKNLIRMSAYMDKKLGTISANRVVDLSILDELGTKRNQRWQK
Ga0364945_0071732_3_1313300034115SedimentVRNLIRMSGYMDKKLASISVSRVMDLSLLDELGTKRHQRGQR
Ga0364945_0221237_416_5803300034115SedimentNSEATLYPPEEAVKNLIRMSAYMDKKLGSISANRVVDLSILDELGTKRNQRAQR
Ga0364925_0060719_1_1293300034147SedimentVKNLIRMSAYMDKKLGSISANRVVDLSILDELGTKRNQRAQR
Ga0364927_0022775_1320_14963300034148SedimentYLHSNSEATLYPPDEAVKNLIRMSAYVDKKLASISANKIMDLSILDEIGTKRNQRAQK
Ga0364927_0214308_400_5703300034148SedimentHANSEASLYPPEDAVRNLIRMSGYMDKKLASISVSRVMDLSLLDELGTKRHQRGQR
Ga0364935_0040627_1_1383300034151SedimentDEAVKNLIRMSAYVDKKLASISANKIMDLSILDEIGTKRNQRPQK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.