NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F092926

Metagenome Family F092926

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F092926
Family Type Metagenome
Number of Sequences 107
Average Sequence Length 41 residues
Representative Sequence MTPAITLEELLAWNQESSDFWKAHLDANPALLELPCGIGGNA
Number of Associated Samples 96
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 98.10 %
% of genes near scaffold ends (potentially truncated) 97.20 %
% of genes from short scaffolds (< 2000 bps) 84.11 %
Associated GOLD sequencing projects 93
AlphaFold2 3D model prediction Yes
3D model pTM-score0.56

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (67.290 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog
(30.841 % of family members)
Environment Ontology (ENVO) Unclassified
(42.056 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(36.449 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 35.71%    β-sheet: 0.00%    Coil/Unstructured: 64.29%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.56
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF02843GARS_C 73.83
PF02844GARS_N 11.21
PF01715IPPT 4.67
PF07992Pyr_redox_2 3.74
PF01745IPT 0.93
PF13701DDE_Tnp_1_4 0.93
PF05163DinB 0.93
PF12706Lactamase_B_2 0.93
PF04295GD_AH_C 0.93
PF13476AAA_23 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 107 Family Scaffolds
COG0151Phosphoribosylamine-glycine ligaseNucleotide transport and metabolism [F] 85.05
COG0324tRNA A37 N6-isopentenylltransferase MiaATranslation, ribosomal structure and biogenesis [J] 4.67
COG2318Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB)Secondary metabolites biosynthesis, transport and catabolism [Q] 0.93
COG2721Altronate dehydrataseCarbohydrate transport and metabolism [G] 0.93


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms67.29 %
UnclassifiedrootN/A32.71 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001401|JGI20189J14885_1007995All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1788Open in IMG/M
3300005345|Ga0070692_10156733All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1301Open in IMG/M
3300005614|Ga0068856_100038918All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00684669Open in IMG/M
3300005921|Ga0070766_11018870All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae570Open in IMG/M
3300009628|Ga0116125_1035160All Organisms → cellular organisms → Bacteria1256Open in IMG/M
3300009635|Ga0116117_1093190All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300009638|Ga0116113_1104567All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300009645|Ga0116106_1077257All Organisms → cellular organisms → Bacteria1088Open in IMG/M
3300009759|Ga0116101_1129631Not Available605Open in IMG/M
3300010343|Ga0074044_10678775All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300010399|Ga0134127_10045846All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3592Open in IMG/M
3300013104|Ga0157370_11826192All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300014153|Ga0181527_1220227All Organisms → cellular organisms → Bacteria781Open in IMG/M
3300014153|Ga0181527_1383001Not Available540Open in IMG/M
3300014167|Ga0181528_10822244Not Available523Open in IMG/M
3300014168|Ga0181534_10407834All Organisms → cellular organisms → Bacteria753Open in IMG/M
3300014168|Ga0181534_10745271Not Available575Open in IMG/M
3300014199|Ga0181535_10504548All Organisms → cellular organisms → Bacteria700Open in IMG/M
3300014200|Ga0181526_10414895All Organisms → cellular organisms → Bacteria854Open in IMG/M
3300014495|Ga0182015_10628551All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300014655|Ga0181516_10472923Not Available642Open in IMG/M
3300014657|Ga0181522_10746052All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300017988|Ga0181520_10554965All Organisms → cellular organisms → Bacteria804Open in IMG/M
3300018022|Ga0187864_10273066All Organisms → cellular organisms → Bacteria766Open in IMG/M
3300018023|Ga0187889_10301447All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300018033|Ga0187867_10707199Not Available549Open in IMG/M
3300018035|Ga0187875_10539848Not Available617Open in IMG/M
3300018035|Ga0187875_10544355Not Available614Open in IMG/M
3300018038|Ga0187855_10847698All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300018044|Ga0187890_10489801All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300018046|Ga0187851_10560145Not Available647Open in IMG/M
3300018047|Ga0187859_10658968Not Available593Open in IMG/M
3300018057|Ga0187858_10418809All Organisms → cellular organisms → Bacteria829Open in IMG/M
3300019082|Ga0187852_1411840All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300021170|Ga0210400_10910018All Organisms → cellular organisms → Bacteria718Open in IMG/M
3300021404|Ga0210389_10958573All Organisms → cellular organisms → Bacteria664Open in IMG/M
3300022863|Ga0224532_1040659All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300023088|Ga0224555_1031061All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2259Open in IMG/M
3300023091|Ga0224559_1052133Not Available1614Open in IMG/M
3300024295|Ga0224556_1052368All Organisms → cellular organisms → Bacteria1008Open in IMG/M
3300025612|Ga0208691_1060114All Organisms → cellular organisms → Bacteria859Open in IMG/M
3300026142|Ga0207698_10835107All Organisms → cellular organisms → Bacteria925Open in IMG/M
3300028068|Ga0255355_1012256Not Available1999Open in IMG/M
3300028087|Ga0255354_1041417All Organisms → cellular organisms → Bacteria1036Open in IMG/M
3300028566|Ga0302147_10087042Not Available1077Open in IMG/M
3300028572|Ga0302152_10260162All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300028762|Ga0302202_10052817All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2616Open in IMG/M
3300028765|Ga0302198_10032329All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3464Open in IMG/M
3300028788|Ga0302189_10025347All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3299Open in IMG/M
3300028813|Ga0302157_10193115Not Available1173Open in IMG/M
3300028866|Ga0302278_10451574Not Available557Open in IMG/M
3300028873|Ga0302197_10129506Not Available1237Open in IMG/M
3300028873|Ga0302197_10482708Not Available542Open in IMG/M
3300028882|Ga0302154_10314636All Organisms → cellular organisms → Bacteria767Open in IMG/M
3300029882|Ga0311368_10309730Not Available1193Open in IMG/M
3300029883|Ga0311327_10324949All Organisms → cellular organisms → Bacteria991Open in IMG/M
3300029883|Ga0311327_10814612Not Available544Open in IMG/M
3300029908|Ga0311341_10655053All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300029908|Ga0311341_10675189Not Available577Open in IMG/M
3300029913|Ga0311362_10271963Not Available1809Open in IMG/M
3300029914|Ga0311359_10901944All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300029916|Ga0302148_1166767All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300029917|Ga0311326_10080669Not Available1828Open in IMG/M
3300029922|Ga0311363_10092702All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00684214Open in IMG/M
3300029922|Ga0311363_10253049All Organisms → cellular organisms → Bacteria → Acidobacteria2044Open in IMG/M
3300029945|Ga0311330_11068197All Organisms → cellular organisms → Bacteria592Open in IMG/M
3300029954|Ga0311331_11476451Not Available556Open in IMG/M
3300029985|Ga0302280_1276790All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300029990|Ga0311336_11138184Not Available680Open in IMG/M
3300030007|Ga0311338_11320839Not Available676Open in IMG/M
3300030041|Ga0302274_10392713Not Available621Open in IMG/M
3300030045|Ga0302282_1206054All Organisms → cellular organisms → Bacteria742Open in IMG/M
3300030049|Ga0302191_10124195All Organisms → cellular organisms → Bacteria1015Open in IMG/M
3300030051|Ga0302195_10374374Not Available620Open in IMG/M
3300030399|Ga0311353_11503134Not Available546Open in IMG/M
3300030506|Ga0302194_10010190All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5479Open in IMG/M
3300030506|Ga0302194_10202266All Organisms → cellular organisms → Bacteria816Open in IMG/M
3300030507|Ga0302192_10014638All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00684606Open in IMG/M
3300030507|Ga0302192_10199164All Organisms → cellular organisms → Bacteria866Open in IMG/M
3300030519|Ga0302193_10023992All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4291Open in IMG/M
3300030617|Ga0311356_12027937All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300030688|Ga0311345_10600787All Organisms → cellular organisms → Bacteria913Open in IMG/M
3300030739|Ga0302311_10282493Not Available1213Open in IMG/M
3300031236|Ga0302324_102393194All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300031241|Ga0265325_10269529All Organisms → cellular organisms → Bacteria766Open in IMG/M
3300031242|Ga0265329_10087023All Organisms → cellular organisms → Bacteria991Open in IMG/M
3300031247|Ga0265340_10019293All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3511Open in IMG/M
3300031258|Ga0302318_10368615All Organisms → cellular organisms → Bacteria722Open in IMG/M
3300031259|Ga0302187_10294740All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300031708|Ga0310686_108936159All Organisms → cellular organisms → Bacteria844Open in IMG/M
3300031708|Ga0310686_110870034Not Available1662Open in IMG/M
3300031712|Ga0265342_10326230All Organisms → cellular organisms → Bacteria804Open in IMG/M
3300031788|Ga0302319_10017834All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae12976Open in IMG/M
3300031902|Ga0302322_100164917All Organisms → cellular organisms → Bacteria → Acidobacteria2388Open in IMG/M
3300031902|Ga0302322_101608090All Organisms → cellular organisms → Bacteria794Open in IMG/M
3300031918|Ga0311367_11292583All Organisms → cellular organisms → Bacteria721Open in IMG/M
3300032515|Ga0348332_14282275All Organisms → cellular organisms → Bacteria896Open in IMG/M
3300032677|Ga0316227_1253289All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300033158|Ga0335077_11342482Not Available692Open in IMG/M
3300033402|Ga0326728_10890735Not Available632Open in IMG/M
3300033405|Ga0326727_10071702All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00684983Open in IMG/M
3300033561|Ga0371490_1053167Not Available1192Open in IMG/M
3300033818|Ga0334804_080786All Organisms → cellular organisms → Bacteria871Open in IMG/M
3300034091|Ga0326724_0285308All Organisms → cellular organisms → Bacteria926Open in IMG/M
3300034282|Ga0370492_0448942All Organisms → cellular organisms → Bacteria523Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog30.84%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland11.21%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog9.35%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen7.48%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil6.54%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland5.61%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa5.61%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil3.74%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere3.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.87%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.87%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater0.93%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.93%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.93%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.93%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.93%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.93%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.93%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.93%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.93%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001401Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 deep-072012EnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300009628Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10EnvironmentalOpen in IMG/M
3300009635Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10EnvironmentalOpen in IMG/M
3300009638Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10EnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300009759Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300014153Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaGEnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014168Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaGEnvironmentalOpen in IMG/M
3300014199Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014655Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaGEnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300018022Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40EnvironmentalOpen in IMG/M
3300018023Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300019082Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40EnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300022863Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 1-5EnvironmentalOpen in IMG/M
3300023088Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 30-34EnvironmentalOpen in IMG/M
3300023091Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 30-34EnvironmentalOpen in IMG/M
3300024295Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5EnvironmentalOpen in IMG/M
3300025612Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes)EnvironmentalOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028068Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T75EnvironmentalOpen in IMG/M
3300028087Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T50EnvironmentalOpen in IMG/M
3300028566Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_2EnvironmentalOpen in IMG/M
3300028572Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_1EnvironmentalOpen in IMG/M
3300028762Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_3EnvironmentalOpen in IMG/M
3300028765Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_2EnvironmentalOpen in IMG/M
3300028783Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_3EnvironmentalOpen in IMG/M
3300028788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_2EnvironmentalOpen in IMG/M
3300028813Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_3EnvironmentalOpen in IMG/M
3300028866Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2EnvironmentalOpen in IMG/M
3300028873Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_1EnvironmentalOpen in IMG/M
3300028882Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3EnvironmentalOpen in IMG/M
3300029882III_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029883I_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029908II_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029913III_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029914III_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029916Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_1EnvironmentalOpen in IMG/M
3300029917I_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029922III_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029945I_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029954I_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029985Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_1EnvironmentalOpen in IMG/M
3300029990I_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030041Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_1EnvironmentalOpen in IMG/M
3300030045Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_3EnvironmentalOpen in IMG/M
3300030049Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_1EnvironmentalOpen in IMG/M
3300030051Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_2EnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030506Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_1EnvironmentalOpen in IMG/M
3300030507Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_2EnvironmentalOpen in IMG/M
3300030519Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_3EnvironmentalOpen in IMG/M
3300030617II_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030688II_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300030739Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031241Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaGHost-AssociatedOpen in IMG/M
3300031242Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaGHost-AssociatedOpen in IMG/M
3300031247Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaGHost-AssociatedOpen in IMG/M
3300031258Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1EnvironmentalOpen in IMG/M
3300031259Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_3EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031712Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaGHost-AssociatedOpen in IMG/M
3300031788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2EnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300031918III_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032677Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18019EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033561Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB28FN SIP fractionEnvironmentalOpen in IMG/M
3300033818Peat soil microbial communities from Stordalen Mire, Sweden - 713 S-3-MEnvironmentalOpen in IMG/M
3300034091Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00NEnvironmentalOpen in IMG/M
3300034282Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI20189J14885_100799533300001401Arctic Peat SoilMSVGITFEEMLAWSNQASDYWKAHLDANPNLLDLPCGIGGAKNVQE
Ga0070692_1015673313300005345Corn, Switchgrass And Miscanthus RhizosphereVDVGISLKELLAWNEEVADFWKAHLDANPHLLELPCDIGGTKNVQE
Ga0068856_10003891863300005614Corn RhizosphereVDVGISLKELLAWNEEVADFWKAHLDANPHLLELPCDIGG
Ga0070766_1101887023300005921SoilMRMTQGLSLEELLAWNEEASAFWKAHFEANPELLQLPCDIGGNKTVQE
Ga0116125_103516013300009628PeatlandMTVGTTLEELLAWNRESAHFWNGHFVANPALLELPCGIGGT
Ga0116117_109319023300009635PeatlandMTPVITHQELLVWSQEASRFWKAHLDANPDLLELPCDIGGSANVQ
Ga0116113_110456723300009638PeatlandMTVAISLEELLIWNEESSAFWKGLLEDNPSLLQLPCGI
Ga0116106_107725713300009645PeatlandMSVGISLEELLAWNEQSAAWWKTHLETNPALLELPCDIGGT
Ga0116101_112963113300009759PeatlandMSVGISLEELLAWNEQSAAYWKTHLETNPALLELPCDI
Ga0074044_1067877523300010343Bog Forest SoilMTPAITLEELLTWNQESSDFWKAHLDANPALLELPC
Ga0134127_1004584653300010399Terrestrial SoilVDVGISLKELLAWNEEVADFWKAHLDANPHLLELPCDIGGTKNVQ
Ga0157370_1182619213300013104Corn RhizosphereMSVGITLAELLAWNDEASSHWKIHLDANGSLLDLPCDIGGAKT
Ga0181527_122022723300014153BogMTPAITLEELLAWNQESSNFWKAHLDANPALLELPCD
Ga0181527_138300123300014153BogMSVGISLEELLAWNEQSAAYWKTHLETNPTLLELPCD
Ga0181528_1082224423300014167BogMSVGITLEELVAWNEQSSDYWKAHLETNPALLELPCDIGGTANVQGFVR
Ga0181534_1040783423300014168BogMSVAISLEELLAWNQEASNWWKAHLDANPTLLELPCGIGGTA
Ga0181534_1074527123300014168BogMTPAITLEELLKWTEESAAWWKAHLEANPALLDLPCGIGG
Ga0181535_1050454813300014199BogMSVGITLEELLVWCQDSSAYWKAHLDANPALLELPCDIGGTANVQG
Ga0181526_1041489523300014200BogVTVGISLEELLAWNEQSAAYWKTHLEMNPALLELPCDIGGTAT
Ga0182015_1062855123300014495PalsaMTPAISFEELLVWNQESADFWKAHFEANPALLELPCGIGGTAT
Ga0181516_1047292313300014655BogMSAGITLEELLAWNDEVARYWKAHLDANPNLLALPCDIGPATNVQE
Ga0181522_1074605213300014657BogMTPAITIEELQAWNQETAKFWKEHLEANPALLELPCGVGGAAN
Ga0181520_1055496513300017988BogMSVGITLEELLAWNEQASDYWKTHLETNPALLDLPCDIGGTANAQG
Ga0187864_1027306623300018022PeatlandMTPAITLDELLAWNHESAAFWKAHLEANPALLELPCGISGTAN
Ga0187889_1030144723300018023PeatlandMSLAISLEELLAWNQESSNFWKAHLEANPALLELPCDIGGTANVLEFAG
Ga0187867_1070719923300018033PeatlandMTPAITLDELLAWNHESAAFWKAHLEANPALLELPCGISG
Ga0187875_1053984813300018035PeatlandMMTHGVSLEELLAWNDEASAFWKAHLEANPALLQLPCDIGGTANVQD
Ga0187875_1054435523300018035PeatlandMSVGITLEELVAWNEQSSDYWKAHLETNPALLELPCDIGGTAN
Ga0187855_1084769813300018038PeatlandVTVGISLEELLAWNEQSAAYWKTHLEMNPALLELPCDI
Ga0187887_1072840313300018043PeatlandMSVGVSMKELLIWNNEASEFWKAHLEANPGLLELK
Ga0187890_1048980123300018044PeatlandMSVGITLEELLAWNDEAARYWKAHLEANPHLLALPCDIGPATSVQ
Ga0187851_1056014523300018046PeatlandMSVGISLEELLAWNEQSAAYWKTHLETNPALLELP
Ga0187859_1065896823300018047PeatlandMSVGITLEELLAWNDQSAASWKTHLETNPALLELPC
Ga0187858_1041880923300018057PeatlandMSVGISLEELLAWNEQSAAWWKTHLETNPALLELPCDIGGTA
Ga0187852_141184013300019082PeatlandMTPAITMQELLVWSQESSGFWNEHLKANPALLQLPCGIG
Ga0210400_1091001813300021170SoilVTPAITLEELFAWNQETSTFWKGFLEDNLAVLEQPCDIGGVLTVQQFV
Ga0210389_1095857313300021404SoilMTPALTLEELLHWNDEASRWWKAHLGANLGLLELPCDI
Ga0224532_104065913300022863SoilMTAAITLAELLAWNQEASNFWKAHLEANPALLELP
Ga0224555_103106143300023088SoilMSAAITLEELLAWNDEAARYWKSHLEANPHLLALPCDIGPAKNVQEFV
Ga0224559_105213313300023091SoilMTIAISLEELLAWNRESSNFWKLHLDANPALLQLPCGIGGTANV
Ga0224556_105236813300024295SoilMTHAVSMEELLTWNDEASTFWKAHLDANPALLQLPCGIGG
Ga0208691_106011413300025612PeatlandMTPAITLEELLAWNEEVSRFWKVHLDANPALLELPCGIGGNVDVQ
Ga0207698_1083510713300026142Corn RhizosphereVDVGISLKELLAWNEEVADFWKAHLDANPHLLELPCDIGGDE
Ga0255355_101225613300028068SoilMTTAISLEELLAWNRESSNFWKLHLDANPALLQLPCGIGGTANVQ
Ga0255354_104141723300028087SoilMTAAITLNELLAWNQEASDFWKAHLEANPALLELPCGIGGT
Ga0302147_1008704213300028566BogMTVGITMEELLAWNNESAGFWKAHLEANPALLELPCGIGGTANV
Ga0302152_1026016213300028572BogMTPAITLEELLAWNDEASKFWKAHLDANPALLALPCGIGGA
Ga0302202_1005281743300028762BogMSVGITLEELLAWNDEAARYWKAHLEANPHLLALPCDIGPATSVQE
Ga0302198_1003232943300028765BogMTSAISMEELLAWSEESAAFWKAHLEANPALLELPCGIGGTANVQ
Ga0302279_1021208013300028783BogMTPAITLEELLAWDQEASSFWKTWLDANPAVLELPCDIGRAKSVQEF
Ga0302189_1002534713300028788BogMTIGITLEELLAWNNESAGFWKAHLEANPSLLELPCGIGGTAN
Ga0302157_1019311513300028813BogMSLAISIEELLAWNDEASAWWKTHLEANQALLELPCGIGGAPTV
Ga0302278_1045157413300028866BogMTAAVTLAELLAWNQESSNFWKAHLEANPALLALPCGIGGT
Ga0302197_1012950623300028873BogVTPAITLEELLAWSCQNSAWWKAHFDANPALLELPCDINRGS
Ga0302197_1048270813300028873BogMTPAITLEELVAWDHESAVFWKTYLEANQALLRLPCGIGGAMDVQEF
Ga0302154_1031463613300028882BogMTPAITLEELLTWNKEASNFWKTHLDANPALLELPCGIGGAANV
Ga0311368_1030973013300029882PalsaMTPAITLEELLAWNQESSDFWKAHLDANPALLELPCGIGGNA
Ga0311327_1032494923300029883BogMTPAITLEELLTWNKEASNFWKTHLDANPALLELPCGIG
Ga0311327_1081461213300029883BogMSVGISLTELLVWNDEASQFWKAHLDANPQVLPLPCDIGSAT
Ga0311341_1065505313300029908BogMSAAISMQELLVWNQEASNWWKAHLDTNPALLELPCGIGGTANV
Ga0311341_1067518913300029908BogMTAAITLNELLAWNQEASDFWKAHLEANPALLELPCGIGGTV
Ga0311362_1027196313300029913BogVSVGITLEELLAWNDEAAIVWKNHLDINPALLDAACDIGG
Ga0311359_1090194413300029914BogMSTVAGVSLEELLAWSQESASFWKSHLDANPALLELPCS
Ga0302148_116676713300029916BogMTPAITLNELLAWNQQSSNFWKAHLEANPALLELPCGIGGAA
Ga0311326_1008066913300029917BogMSAAITLEELLAWNDEAARYWKSHLEANPHLLALPCDIGPAKNV
Ga0311363_1009270213300029922FenMTPAITLEELLGWNQQSSVFWKAWLDANPAALALPCDIDRTTNVQE
Ga0311363_1025304913300029922FenMTPAITLEELLTWNEEASNFWKAHLDANPALLELPCGI
Ga0311330_1106819713300029945BogMTAAITLEELLAWNEESSAFWKGHLEANPGLLELPCDIGGTKTVQ
Ga0311331_1147645123300029954BogMSVGITLEELLVWCQDSSAYWKAHLDANPALLELP
Ga0302280_127679013300029985FenMTPAITLEELLAWNRESADFWKAHFDANPALLALPCG
Ga0311336_1113818413300029990FenMSTGITLQELLAWNQEASNFWKAHFDSNPHLLELACGIGG
Ga0311338_1132083913300030007PalsaVNLAITVEEFLAWSDEASTWWKTHLDANPALLELPCG
Ga0302274_1039271313300030041BogMSVAVTLEELSRWNQETSAFWNQHLDANPTLLELPCDI
Ga0302282_120605413300030045FenMTPAITLEELLIWNQESSNFWKAHLDANPALLELPCGIGGAAN
Ga0302191_1012419513300030049BogMTAAITLNELLAWNQEASDFWKAHLEANPALLELPCGI
Ga0302195_1037437423300030051BogMTPAITLEELLVWNQETSSFWKTWLDANPAVLELPCDIGRAKSVQEF
Ga0311353_1150313413300030399PalsaMATGITLEELMGWSEEAAEFWKDHLEANPALLELPCGIGGTANV
Ga0302194_1001019063300030506BogMTIGITLEELLAWNNESAGFWKAHLEANPSLLELPCGIGG
Ga0302194_1020226613300030506BogMTPAITLEELLAWSDEASNFWKAHLDANPALLEPP
Ga0302192_1001463863300030507BogMTPAITLNELLAWNQQSSNFWKAHLEANPALLELPCG
Ga0302192_1019916413300030507BogMSVAISMQELLVWNQEASNWWKAHLDTNPALLELP
Ga0302193_1002399213300030519BogMTPAITLEELLAWSDEASNFWKVHLDANPALLEPPCGIGES
Ga0311356_1202793723300030617PalsaMTIGITLEELLAWNQESANFWKAHLEANPTLLELPCGIGGTANVQEL
Ga0311345_1060078713300030688BogMTPAISLDELLAWSQESSRFWKEHFDANPVLLELPCSIDNSGTVLGL
Ga0302311_1028249313300030739PalsaMTHGISLEELLDWNEEVSAFWKAHFETSPALLQLPCGI
Ga0302324_10239319413300031236PalsaMATGITLEELMGWSEEAAEFWKDHLEANPALLELPCGIGGT
Ga0265325_1026952913300031241RhizosphereMSAGITLRELLVWNQEASNFWNAHFNANPHLLELECGIGGAATV
Ga0265329_1008702323300031242RhizosphereMTPAITLEELLAWNHESAAFWKAHLEANLSLLELPCDIGGTASV
Ga0265340_1001929313300031247RhizosphereMCVGITLQELLAWNRESSRFWKDHLDANPHLLALSCDIGGTTN
Ga0302318_1036861513300031258BogMTPAITLEELLTWNKEASNFWKTHLDANPALLELPCGI
Ga0302187_1029474013300031259BogMTPAITLEELLTWNEEASNFWKAHLDANPALLELP
Ga0310686_10893615923300031708SoilLTPAITLEELLTWNQESADFWKAHLDANPVLLELPCGIGGNVHVQAF
Ga0310686_11087003433300031708SoilMTPAITHEELLAWNCESADFWKAHLGANPALLQLPCGIGGN
Ga0265342_1032623023300031712RhizosphereMTPAITFEELLAWNEESSDFWKAHLDANPTLLQMPC
Ga0302319_1001783413300031788BogMTPAITLDELLAWSCQSSNFWKAHLDANPALLALPCGIGGA
Ga0302322_10016491713300031902FenMIPAISLEELLVWNDEASQFWKRHLEANPALLALPCEIGGTA
Ga0302322_10160809013300031902FenMTPAITLEELLGWNQEAALFWKEHLEANPALLELPCDIGDTK
Ga0311367_1129258323300031918FenMIPAISLEELLVWNDEASQFWKRHLEANPALLALPCEIGGTAN
Ga0348332_1428227513300032515Plant LitterVTPAITFEGVFAWSDEASRFWKAHLDANPSLLELPSGIGGTATVQSW
Ga0316227_125328923300032677FreshwaterMTPAITIEELLAWNQESAGFWKSHLEANPALLELPCDI
Ga0335077_1134248223300033158SoilMSVGITLEELLAWNVDSSNYWKAYFDANPASLELPCDIG
Ga0326728_1089073513300033402Peat SoilMSVGNTLDELLAWNEQSANYWKTHFDANPALLGLTCEIGG
Ga0326727_1007170253300033405Peat SoilMSVGITLEELLAWNEQSSDYWKTHLETNPALLELPCDIGGTST
Ga0371490_105316713300033561Peat SoilMSVGITLEELLAWNEQSAAYWKTHLATNPALLELPCDIGGTA
Ga0334804_080786_2_1213300033818SoilMTPAITLEELLTWNKEASNFWKTHLDANPALLELPCGIGG
Ga0326724_0285308_821_9253300034091Peat SoilMSVGISLEELLAWHEQSAAWWKTHLETNPALLELP
Ga0370492_0448942_403_5223300034282Untreated Peat SoilMTPAITLEELLAWNQETSSFWKTWLDANPAALELPCDIGR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.