Metagenome / Metatranscriptome Family F092684

Overview

Basic Information

• Family ID: F092684
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 107
• Average Sequence Length: 42 residues
• Representative Sequence: GRDDGKGFLVVTRYKLKEIESGKVQDPLVKPGDRITIHD
• Number of Associated Samples: 93
• Number of Associated Scaffolds: 107

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Bacteria
• % of genes with valid RBS motifs: 1.87 %
• % of genes near scaffold ends (potentially truncated): 98.13 %
• % of genes from short scaffolds (< 2000 bps): 95.33 %
• Associated GOLD sequencing projects: 84
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Bacteria (75.701 % of family members)
• NCBI Taxonomy ID: 2
• Taxonomy: All Organisms → cellular organisms → Bacteria

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere (9.346 % of family members)
• Environment Ontology (ENVO): Unclassified (47.664 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant rhizosphere (61.682 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 8.96%
  β-sheet: 5.97%
  Coil/Unstructured: 85.07%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 107 Family Scaffolds
PF12796	Ank_2	53.27
PF13857	Ank_5	14.02
PF13637	Ank_4	11.21
PF11008	DUF2846	0.93
PF01494	FAD_binding_3	0.93
PF04191	PEMT	0.93
PF00023	Ank	0.93
PF00797	Acetyltransf_2	0.93
PF14066	DUF4256	0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 107 Family Scaffolds
COG0654	2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases	Energy production and conversion [C]	1.87
COG0578	Glycerol-3-phosphate dehydrogenase	Energy production and conversion [C]	0.93
COG0644	Dehydrogenase (flavoprotein)	Energy production and conversion [C]	0.93
COG0665	Glycine/D-amino acid oxidase (deaminating)	Amino acid transport and metabolism [E]	0.93
COG2162	Arylamine N-acetyltransferase	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.93

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	80.37 %
Unclassified	root	N/A	19.63 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	80.37 %
Unclassified	root	N/A	19.63 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	75.70 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	4.67 %
Unclassified	root	N/A	19.63 %

Level 4

Name	Rank	Taxonomy	Distribution
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	26.17 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	1.87 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	3.74 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	3.74 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	0.93 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	33.64 %
Unclassified	root	N/A	19.63 %

Level 5

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.93 %
Blastocatellia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia	25.23 %
Choanoflagellata	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata	0.93 %
Cyanobacteria/Melainabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group	33.64 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.93 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1.87 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	1.87 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	0.93 %
Unclassified	root	N/A	19.63 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	0.93 %

Level 6

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.93 %
Blastocatellales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales	13.08 %
Craspedida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida	0.93 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	33.64 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	1.87 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.93 %
Planctomycetia	class	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia	0.93 %
Thiotrichales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales	0.93 %
Unclassified	root	N/A	19.63 %
unclassified Blastocatellia	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia	4.67 %
unclassified Gemmatimonadetes	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes	1.87 %

Level 7

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.93 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	1.87 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	4.67 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.93 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1.87 %
Isosphaerales	order	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales	0.93 %
Piscirickettsiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae	0.93 %
Pyrinomonadaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae	13.08 %
Salpingoecidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae	0.93 %
Unclassified	root	N/A	19.63 %
unclassified Cyanobacteria	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria	33.64 %

Level 8

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.93 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	4.67 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.93 %
Cyanobacteria bacterium 13_1_40CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	33.64 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1.87 %
Isosphaeraceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae	0.93 %
Methylophaga	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → Methylophaga	0.93 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	1.87 %
Salpingoeca	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Salpingoeca	0.93 %
Unclassified	root	N/A	19.63 %
unclassified Pyrinomonadaceae	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae	13.08 %

Level 9

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.93 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	4.67 %
Cyanobacteria bacterium 13_1_40CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	33.64 %
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	1.87 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1.87 %
Methylophaga	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → Methylophaga	0.93 %
Paludisphaera	genus	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Paludisphaera	0.93 %
Pyrinomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	13.08 %
Salpingoeca rosetta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Salpingoeca → Salpingoeca rosetta	0.93 %
Unclassified	root	N/A	19.63 %
unclassified Bradyrhizobium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium	0.93 %

Level 10

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.93 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	4.67 %
Bradyrhizobium sp. OK095	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. OK095	0.93 %
Cyanobacteria bacterium 13_1_40CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	33.64 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1.87 %
Methylophaga	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → Methylophaga	0.93 %
Paludisphaera rhizosphaereae	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Paludisphaera → Paludisphaera rhizosphaereae	0.93 %
Panarthropoda	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda	1.87 %
Pyrinomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	13.08 %
Salpingoeca rosetta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Salpingoeca → Salpingoeca rosetta	0.93 %
Unclassified	root	N/A	19.63 %

Level 11

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.93 %
Arthropoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	1.87 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	4.67 %
Bradyrhizobium sp. OK095	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. OK095	0.93 %
Cyanobacteria bacterium 13_1_40CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	33.64 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1.87 %
Methylophaga	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → Methylophaga	0.93 %
Paludisphaera rhizosphaereae	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Paludisphaera → Paludisphaera rhizosphaereae	0.93 %
Pyrinomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	13.08 %
Salpingoeca rosetta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Salpingoeca → Salpingoeca rosetta	0.93 %
Unclassified	root	N/A	19.63 %

Level 12

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.93 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	4.67 %
Bradyrhizobium sp. OK095	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. OK095	0.93 %
Chelicerata	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata	0.93 %
Cyanobacteria bacterium 13_1_40CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	33.64 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1.87 %
Mandibulata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata	0.93 %
Methylophaga	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → Methylophaga	0.93 %
Paludisphaera rhizosphaereae	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Paludisphaera → Paludisphaera rhizosphaereae	0.93 %
Pyrinomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	13.08 %
Salpingoeca rosetta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Salpingoeca → Salpingoeca rosetta	0.93 %
Unclassified	root	N/A	19.63 %

Level 13

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.93 %
Arachnida	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida	0.93 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	4.67 %
Bradyrhizobium sp. OK095	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. OK095	0.93 %
Cyanobacteria bacterium 13_1_40CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	33.64 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1.87 %
Methylophaga	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → Methylophaga	0.93 %
Paludisphaera rhizosphaereae	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Paludisphaera → Paludisphaera rhizosphaereae	0.93 %
Pancrustacea	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea	0.93 %
Pyrinomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	13.08 %
Salpingoeca rosetta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Salpingoeca → Salpingoeca rosetta	0.93 %
Unclassified	root	N/A	19.63 %

Level 14

Name	Rank	Taxonomy	Distribution
Acari	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari	0.93 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.93 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	4.67 %
Bradyrhizobium sp. OK095	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. OK095	0.93 %
Cyanobacteria bacterium 13_1_40CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	33.64 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1.87 %
Hexapoda	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda	0.93 %
Methylophaga	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → Methylophaga	0.93 %
Paludisphaera rhizosphaereae	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Paludisphaera → Paludisphaera rhizosphaereae	0.93 %
Pyrinomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	13.08 %
Salpingoeca rosetta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Salpingoeca → Salpingoeca rosetta	0.93 %
Unclassified	root	N/A	19.63 %

Level 15

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.93 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	4.67 %
Bradyrhizobium sp. OK095	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. OK095	0.93 %
Cyanobacteria bacterium 13_1_40CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	33.64 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1.87 %
Insecta	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta	0.93 %
Methylophaga	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → Methylophaga	0.93 %
Paludisphaera rhizosphaereae	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Paludisphaera → Paludisphaera rhizosphaereae	0.93 %
Parasitiformes	superorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes	0.93 %
Pyrinomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	13.08 %
Salpingoeca rosetta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Salpingoeca → Salpingoeca rosetta	0.93 %
Unclassified	root	N/A	19.63 %

Level 16

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.93 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	4.67 %
Bradyrhizobium sp. OK095	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. OK095	0.93 %
Cyanobacteria bacterium 13_1_40CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	33.64 %
Dicondylia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia	0.93 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1.87 %
Mesostigmata	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Mesostigmata	0.93 %
Methylophaga	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → Methylophaga	0.93 %
Paludisphaera rhizosphaereae	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Paludisphaera → Paludisphaera rhizosphaereae	0.93 %
Pyrinomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	13.08 %
Salpingoeca rosetta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Salpingoeca → Salpingoeca rosetta	0.93 %
Unclassified	root	N/A	19.63 %

Level 17

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.93 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	4.67 %
Bradyrhizobium sp. OK095	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. OK095	0.93 %
Cyanobacteria bacterium 13_1_40CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	33.64 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1.87 %
Methylophaga	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → Methylophaga	0.93 %
Monogynaspida	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Mesostigmata → Monogynaspida	0.93 %
Paludisphaera rhizosphaereae	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Paludisphaera → Paludisphaera rhizosphaereae	0.93 %
Pterygota	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota	0.93 %
Pyrinomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	13.08 %
Salpingoeca rosetta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Salpingoeca → Salpingoeca rosetta	0.93 %
Unclassified	root	N/A	19.63 %

Level 18

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.93 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	4.67 %
Bradyrhizobium sp. OK095	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. OK095	0.93 %
Cyanobacteria bacterium 13_1_40CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	33.64 %
Gamasina	infraorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Mesostigmata → Monogynaspida → Gamasina	0.93 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1.87 %
Methylophaga	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → Methylophaga	0.93 %
Neoptera	infraclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	0.93 %
Paludisphaera rhizosphaereae	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Paludisphaera → Paludisphaera rhizosphaereae	0.93 %
Pyrinomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	13.08 %
Salpingoeca rosetta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Salpingoeca → Salpingoeca rosetta	0.93 %
Unclassified	root	N/A	19.63 %

Level 19

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.93 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	4.67 %
Bradyrhizobium sp. OK095	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. OK095	0.93 %
Cyanobacteria bacterium 13_1_40CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	33.64 %
Dermanyssoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Mesostigmata → Monogynaspida → Gamasina → Dermanyssoidea	0.93 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1.87 %
Methylophaga	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → Methylophaga	0.93 %
Paludisphaera rhizosphaereae	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Paludisphaera → Paludisphaera rhizosphaereae	0.93 %
Paraneoptera	cohort	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera	0.93 %
Pyrinomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	13.08 %
Salpingoeca rosetta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Salpingoeca → Salpingoeca rosetta	0.93 %
Unclassified	root	N/A	19.63 %

Level 20

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.93 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	4.67 %
Bradyrhizobium sp. OK095	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. OK095	0.93 %
Cyanobacteria bacterium 13_1_40CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	33.64 %
Dermanyssoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Mesostigmata → Monogynaspida → Gamasina → Dermanyssoidea	0.93 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1.87 %
Hemiptera	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera	0.93 %
Methylophaga	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → Methylophaga	0.93 %
Paludisphaera rhizosphaereae	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Paludisphaera → Paludisphaera rhizosphaereae	0.93 %
Pyrinomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	13.08 %
Salpingoeca rosetta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Salpingoeca → Salpingoeca rosetta	0.93 %
Unclassified	root	N/A	19.63 %

Level 21

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.93 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	4.67 %
Bradyrhizobium sp. OK095	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. OK095	0.93 %
Cyanobacteria bacterium 13_1_40CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	33.64 %
Dermanyssoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Mesostigmata → Monogynaspida → Gamasina → Dermanyssoidea	0.93 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1.87 %
Methylophaga	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → Methylophaga	0.93 %
Paludisphaera rhizosphaereae	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Paludisphaera → Paludisphaera rhizosphaereae	0.93 %
Prosorrhyncha	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Prosorrhyncha	0.93 %
Pyrinomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	13.08 %
Salpingoeca rosetta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Salpingoeca → Salpingoeca rosetta	0.93 %
Unclassified	root	N/A	19.63 %

Level 22

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.93 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	4.67 %
Bradyrhizobium sp. OK095	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. OK095	0.93 %
Cyanobacteria bacterium 13_1_40CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	33.64 %
Dermanyssoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Mesostigmata → Monogynaspida → Gamasina → Dermanyssoidea	0.93 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1.87 %
Heteroptera	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Prosorrhyncha → Heteroptera	0.93 %
Methylophaga	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → Methylophaga	0.93 %
Paludisphaera rhizosphaereae	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Paludisphaera → Paludisphaera rhizosphaereae	0.93 %
Pyrinomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	13.08 %
Salpingoeca rosetta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Salpingoeca → Salpingoeca rosetta	0.93 %
Unclassified	root	N/A	19.63 %

Level 23

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.93 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	4.67 %
Bradyrhizobium sp. OK095	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. OK095	0.93 %
Cyanobacteria bacterium 13_1_40CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	33.64 %
Dermanyssoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Mesostigmata → Monogynaspida → Gamasina → Dermanyssoidea	0.93 %
Euheteroptera	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Prosorrhyncha → Heteroptera → Euheteroptera	0.93 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1.87 %
Methylophaga	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → Methylophaga	0.93 %
Paludisphaera rhizosphaereae	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Paludisphaera → Paludisphaera rhizosphaereae	0.93 %
Pyrinomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	13.08 %
Salpingoeca rosetta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Salpingoeca → Salpingoeca rosetta	0.93 %
Unclassified	root	N/A	19.63 %

Level 24

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.93 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	4.67 %
Bradyrhizobium sp. OK095	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. OK095	0.93 %
Cyanobacteria bacterium 13_1_40CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	33.64 %
Dermanyssoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Mesostigmata → Monogynaspida → Gamasina → Dermanyssoidea	0.93 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1.87 %
Methylophaga	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → Methylophaga	0.93 %
Neoheteroptera	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Prosorrhyncha → Heteroptera → Euheteroptera → Neoheteroptera	0.93 %
Paludisphaera rhizosphaereae	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Paludisphaera → Paludisphaera rhizosphaereae	0.93 %
Pyrinomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	13.08 %
Salpingoeca rosetta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Salpingoeca → Salpingoeca rosetta	0.93 %
Unclassified	root	N/A	19.63 %

Level 25

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.93 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	4.67 %
Bradyrhizobium sp. OK095	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. OK095	0.93 %
Cyanobacteria bacterium 13_1_40CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	33.64 %
Dermanyssoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Mesostigmata → Monogynaspida → Gamasina → Dermanyssoidea	0.93 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1.87 %
Methylophaga	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → Methylophaga	0.93 %
Paludisphaera rhizosphaereae	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Paludisphaera → Paludisphaera rhizosphaereae	0.93 %
Panheteroptera	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Prosorrhyncha → Heteroptera → Euheteroptera → Neoheteroptera → Panheteroptera	0.93 %
Pyrinomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	13.08 %
Salpingoeca rosetta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Salpingoeca → Salpingoeca rosetta	0.93 %
Unclassified	root	N/A	19.63 %

Level 26

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.93 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	4.67 %
Bradyrhizobium sp. OK095	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. OK095	0.93 %
Cimicomorpha	infraorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Prosorrhyncha → Heteroptera → Euheteroptera → Neoheteroptera → Panheteroptera → Cimicomorpha	0.93 %
Cyanobacteria bacterium 13_1_40CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	33.64 %
Dermanyssoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Mesostigmata → Monogynaspida → Gamasina → Dermanyssoidea	0.93 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1.87 %
Methylophaga	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → Methylophaga	0.93 %
Paludisphaera rhizosphaereae	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Paludisphaera → Paludisphaera rhizosphaereae	0.93 %
Pyrinomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	13.08 %
Salpingoeca rosetta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Salpingoeca → Salpingoeca rosetta	0.93 %
Unclassified	root	N/A	19.63 %

Level 27

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.93 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	4.67 %
Bradyrhizobium sp. OK095	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. OK095	0.93 %
Cyanobacteria bacterium 13_1_40CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	33.64 %
Dermanyssoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Mesostigmata → Monogynaspida → Gamasina → Dermanyssoidea	0.93 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1.87 %
Methylophaga	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → Methylophaga	0.93 %
Paludisphaera rhizosphaereae	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Paludisphaera → Paludisphaera rhizosphaereae	0.93 %
Pyrinomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	13.08 %
Reduvioidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Prosorrhyncha → Heteroptera → Euheteroptera → Neoheteroptera → Panheteroptera → Cimicomorpha → Reduvioidea	0.93 %
Salpingoeca rosetta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Salpingoeca → Salpingoeca rosetta	0.93 %
Unclassified	root	N/A	19.63 %

Level 28

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.93 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	4.67 %
Bradyrhizobium sp. OK095	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. OK095	0.93 %
Cyanobacteria bacterium 13_1_40CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	33.64 %
Dermanyssoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Mesostigmata → Monogynaspida → Gamasina → Dermanyssoidea	0.93 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1.87 %
Methylophaga	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → Methylophaga	0.93 %
Paludisphaera rhizosphaereae	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Paludisphaera → Paludisphaera rhizosphaereae	0.93 %
Pyrinomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	13.08 %
Reduviidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Prosorrhyncha → Heteroptera → Euheteroptera → Neoheteroptera → Panheteroptera → Cimicomorpha → Reduvioidea → Reduviidae	0.93 %
Salpingoeca rosetta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Salpingoeca → Salpingoeca rosetta	0.93 %
Unclassified	root	N/A	19.63 %

Level 29

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.93 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	4.67 %
Bradyrhizobium sp. OK095	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. OK095	0.93 %
Cyanobacteria bacterium 13_1_40CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	33.64 %
Dermanyssoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Mesostigmata → Monogynaspida → Gamasina → Dermanyssoidea	0.93 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1.87 %
Methylophaga	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → Methylophaga	0.93 %
Paludisphaera rhizosphaereae	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Paludisphaera → Paludisphaera rhizosphaereae	0.93 %
Pyrinomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	13.08 %
Salpingoeca rosetta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Salpingoeca → Salpingoeca rosetta	0.93 %
Triatominae	subfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Prosorrhyncha → Heteroptera → Euheteroptera → Neoheteroptera → Panheteroptera → Cimicomorpha → Reduvioidea → Reduviidae → Triatominae	0.93 %
Unclassified	root	N/A	19.63 %

Level 30

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.93 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	4.67 %
Bradyrhizobium sp. OK095	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. OK095	0.93 %
Cyanobacteria bacterium 13_1_40CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	33.64 %
Dermanyssoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Mesostigmata → Monogynaspida → Gamasina → Dermanyssoidea	0.93 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1.87 %
Methylophaga	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → Methylophaga	0.93 %
Paludisphaera rhizosphaereae	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Paludisphaera → Paludisphaera rhizosphaereae	0.93 %
Pyrinomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	13.08 %
Rhodnius	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Prosorrhyncha → Heteroptera → Euheteroptera → Neoheteroptera → Panheteroptera → Cimicomorpha → Reduvioidea → Reduviidae → Triatominae → Rhodnius	0.93 %
Salpingoeca rosetta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Salpingoeca → Salpingoeca rosetta	0.93 %
Unclassified	root	N/A	19.63 %

Associated Scaffolds

Scaffold	Taxonomy	Length
2199352025|deepsgr__Contig_62695	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	1411
2228664021|ICCgaii200_c0699296	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	563
3300000559|F14TC_100349942	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	647
3300000559|F14TC_103715835	Not Available	705
3300000789|JGI1027J11758_12469434	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	586
3300000789|JGI1027J11758_12832070	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	757
3300001431|F14TB_103732856	Not Available	692
3300001431|F14TB_109781179	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	568
3300002128|JGI24036J26619_10114292	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	556
3300003321|soilH1_10088624	All Organisms → cellular organisms → Bacteria → Proteobacteria	4836

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	50.47%
Host-Associated	Host-Associated	49.53%

Class

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	1.87%
Plants	Host-Associated → Plants	49.53%
Terrestrial	Environmental → Terrestrial	48.60%

Category

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	0.93%
Rhizoplane	Host-Associated → Plants → Rhizoplane	23.36%
Rhizosphere	Host-Associated → Plants → Rhizosphere	26.17%
Sediment	Environmental → Aquatic → Sediment	0.93%
Soil	Environmental → Terrestrial → Soil	48.60%

Type

Habitat	Taxonomy	Distribution
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	19.63%
Ice	Environmental → Aquatic → Freshwater → Ice	0.93%
Loam	Environmental → Terrestrial → Soil → Loam	13.08%
Soil	Host-Associated → Plants → Rhizosphere → Soil	2.80%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	34.58%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	23.36%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	3.74%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.93%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.93%

Subtype

Habitat	Taxonomy	Distribution
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	1.87%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	7.48%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	9.35%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	5.61%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	3.74%
Tropical Rainforest	Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest	0.93%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	23.36%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	19.63%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	18.69%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	3.74%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	2.80%
Unclassified	Environmental → Aquatic → Freshwater → Ice → Unclassified	0.93%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.93%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.93%

Habitat

Habitat	Taxonomy	Distribution
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	2.80%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	2.80%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.93%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	0.93%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	6.54%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	6.54%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	3.74%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.93%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	2.80%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere	0.93%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.93%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	2.80%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.87%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.87%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.93%
Polar Desert Sand	Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand	0.93%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	6.54%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.93%
Rice Paddy Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil	0.93%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	2.80%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	4.67%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	3.74%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	3.74%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.87%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	1.87%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.93%
Sugarcane Root And Bulk Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil	0.93%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	9.35%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	3.74%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	2.80%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.87%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere	0.93%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.93%
Termite Nest	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest	0.93%
Terrestrial	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial	0.93%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	4.67%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	3.74%
Tropical Rainforest Soil	Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil	0.93%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	1.87%

Associated Samples

Taxon OID	Sample Name	Habitat Type
2199352025	Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL	Environmental
2228664021	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental
3300000559	Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly	Environmental
3300000789	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental
3300001431	Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly	Environmental
3300002128	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5	Environmental
3300003321	Sugarcane bulk soil Sample H1	Environmental
3300004156	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1	Environmental
3300004157	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2	Environmental
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
deepsgr_00797860	2199352025	Soil	VRVGRDDGKGFLVVTRYQLKDIEMGKVQDPLIQPGDRITVIN
ICCgaii200_06992962	2228664021	Soil	IVGKPKEARLGRDDGRGFLIVTKFKLKEIESGKVPDPLVRPGDRIMVQ
F14TC_1003499421	3300000559	Soil	VRIGRDNGKGFLTVTRYRLKEINSGKVADPPIEPGDRITIVN*
F14TC_1037158351	3300000559	Soil	GGLAKNSKEARLARDNGKGXXXXXXYKLKDIDSGKVPDPLVQPGDRITIVK*
JGI1027J11758_124694342	3300000789	Soil	DDGKGFLKETRYKLNEIASGKLLDPLIQPGDRITIIK*
JGI1027J11758_128320701	3300000789	Soil	ARLARDNGKGFLVLSRYKLKDIDSGKVPDPLVQPGDRITVVK*
F14TB_1037328562	3300001431	Soil	HGFLVVNRYKLKDIDSGRVPDPVIQPGDRITIID*
F14TB_1097811792	3300001431	Soil	GKGFLTVTRYRLKEINSGKVADPPIEPGDRITIVN*
JGI24036J26619_101142922	3300002128	Corn, Switchgrass And Miscanthus Rhizosphere	IAREDGNGFLVMTRYKLKDIETGKGRDPQIQPGDRITIVD*
soilH1_100886241	3300003321	Sugarcane Root And Bulk Soil	VTPKAKEARLGRDDGHGFLTITRLKLKDIESGKLPDPVVRPGDRIMIVK*
Ga0062589_1018014411	3300004156	Soil	KKAELARDNGKGFLVVTRFKLKEIESGKVPDPPIQPGDRITIIK*
Ga0062590_1024031991	3300004157	Soil	ARDNGKGFLMVTRFKLKEIESGKVPDPPIQPGDRITIIK*
Ga0063356_1060480142	3300004463	Arabidopsis Thaliana Rhizosphere	ARLARDNGNGYLVMHRFKLKDIDSGKAPDPPIQPGDRITIVK*
Ga0062595_1001862553	3300004479	Soil	KPKEARIGRNDAGGFIVVTRYQLKDIESGKVQDPLVQPGDRIMVSN*
Ga0008092_110191731	3300004629	Tropical Rainforest Soil	AKEVRLARDNGKGFLTISHYKLKEVNSGRTADPVLQPGDRITIGK*
Ga0062591_1005321362	3300004643	Soil	AKEARLGRDDGKGFLVVTRYKLKEIESGKVQDPAVKPGDRITIKE*
Ga0066685_109020782	3300005180	Soil	KEARFARDNGKGFLVVNRYKLKAIESGKVPDPVIQPGDRITIID*
Ga0065705_101326915	3300005294	Switchgrass Rhizosphere	RIGRDDGKGFLVVTRFKLKEIESGKVPDPVIKPGDRITIRD*
Ga0070680_1000410581	3300005336	Corn Rhizosphere	KEARLGRDDGRGFLIITKFKLKDIESGKVPDPLIRPGDRIMVIK*
Ga0070687_1015290242	3300005343	Switchgrass Rhizosphere	KAQLARDNGRGFLAVKRYKLKEIDSGKVPDPVIQPGDRITIID*
Ga0070692_107101991	3300005345	Corn, Switchgrass And Miscanthus Rhizosphere	VTNKAKEARLGRDDGNGYLTVTKIKLKDIESGKAPDPLVRPGDRIMIDK*
Ga0070694_1014486241	3300005444	Corn, Switchgrass And Miscanthus Rhizosphere	EVRLARDDGKGFLNVTRYRLKEIEEGKTQDPLIQPGDRITIIF*
Ga0070681_113504222	3300005458	Corn Rhizosphere	RVARDNGEGFLAVTRYKLKDVESGKVQDPVVKPGDRITIRN*
Ga0070696_1001861091	3300005546	Corn, Switchgrass And Miscanthus Rhizosphere	KPKEARLGRDDGRGFLIITKFKLKDIESGKVPDPLIRPGDRIMVIK*
Ga0066698_107357141	3300005558	Soil	TKKSKEARLARDNGKGFLVVSRYKLKDIESGKVPDPVIQPGDRITIID*
Ga0068854_1010505801	3300005578	Corn Rhizosphere	DNGQGFLAITRYKLKEIESGKVADPSIEPGDRITIND*
Ga0068859_1029298742	3300005617	Switchgrass Rhizosphere	ARIGRDDGKGFLVVTRFKLKEIESGKIQDPIIKPGDRITIGH*
Ga0068864_1019371232	3300005618	Switchgrass Rhizosphere	TPKAKEARLGRDDGKGFLTVTKYKLKEIESGKVQDPAVKPGDRITIKE*
Ga0068866_112994201	3300005718	Miscanthus Rhizosphere	SRDSGNGFLMMTRYKLQEIDSGKRPDPLVQPGDRITVVK*
Ga0068866_113059821	3300005718	Miscanthus Rhizosphere	VRLARDDGKGFLIVNHYKLKDIESGNVKDPLIQAGDRITINE*
Ga0068861_1014968621	3300005719	Switchgrass Rhizosphere	TSKGKEARIGRDDGNGFLVVTRFKLKEIESGKIPDPVVKPGDRITIKD*
Ga0068851_106552591	3300005834	Corn Rhizosphere	TPKAKEARLGRDDGKGFLVVTKFKLKDIESGKVQDPTIKPGDRITIKE*
Ga0068858_1006495161	3300005842	Switchgrass Rhizosphere	QLGRDDGKGFLVVTKFKLKEIESGKAQDPVVKPGDRITIKE*
Ga0068858_1008366771	3300005842	Switchgrass Rhizosphere	DGKGFLVVTRYKLKEIESGKVQDPAVKPGDRITIKE*
Ga0068860_1008276882	3300005843	Switchgrass Rhizosphere	VTTKAKEARLGRDDGKGFLVVTRYKLKEIESGKVQDPAVKPGDRITIKE*
Ga0068862_1010995411	3300005844	Switchgrass Rhizosphere	LGRDDGRGFLIVTKFKLKDIESGKVPDPLVRPGDRITVVQ*
Ga0068862_1016553171	3300005844	Switchgrass Rhizosphere	DGRGFLIITKFKLKDIESGKVPDPLIRPGDRIMVIK*
Ga0075293_10477341	3300005875	Rice Paddy Soil	PKGKEARLGRDDGKGYLVVTKFKLKDVEAGKVQDPTLKPGDRITIKE*
Ga0082029_13121472	3300006169	Termite Nest	DGKGFLTVTKFKLKDIETGKVQDPGVKPGDRITIKE*
Ga0075430_1016796942	3300006846	Populus Rhizosphere	LARDDGKGFLIVNRYKLQDIESGKMKDPLIEPGDRITIND*
Ga0075425_1007381021	3300006854	Populus Rhizosphere	RDNGKGFLGVKRYKLKEIESGKVPDPPILPGDRITIIK*
Ga0075434_1026613821	3300006871	Populus Rhizosphere	TAREAQVARDNGKGFLAVTRYKLKEIDSGKIADPAIQPGDRITITD*
Ga0079217_104881652	3300006876	Agricultural Soil	GKPKEARLGRDDGRGFLIVTKFKLKDIESGKVPDPLVRPGDRITVVQ*
Ga0075424_1005755782	3300006904	Populus Rhizosphere	GRGFLGVKRYKLKEIESGKVPDPPILPGDRITIIK*
Ga0097620_1018609151	3300006931	Switchgrass Rhizosphere	VTNKAKEARLGRDDGNGYLTITKIKLKDIESGKAPDPLVRPGDRIMIVD*
Ga0079218_135616482	3300007004	Agricultural Soil	GRGFLIVTKFKLKDIESGKVPDPLIRPGDRITVVE*
Ga0105240_114470821	3300009093	Corn Rhizosphere	LTKNPKEARLARDSGKGFLVQSRYKLKDIDSGKVPDPLVQPGDRITIVK*
Ga0105240_124089472	3300009093	Corn Rhizosphere	GGVTALAKQARLGRDNGKGFLVVNSYKLKDVDSGKIPDPVLQPGDRITIE*
Ga0105247_108354272	3300009101	Switchgrass Rhizosphere	RDDGNGFLVVNRYKLKDIESGKVQDPVVKPGDRIVIRD*
Ga0105247_109323281	3300009101	Switchgrass Rhizosphere	LGRDDGKGFLVVTRYKLKEIESGKVQDPGVKPGDRITIKE*
Ga0114129_130143092	3300009147	Populus Rhizosphere	GRDNGDGFLVVTRYKLKDIDSGKVQDPVVKPGDRITIHD*
Ga0105243_115089272	3300009148	Miscanthus Rhizosphere	GDGFLVVTRYKLKDIESGKVQDPLVKPGDRITIHD*
Ga0075423_102566931	3300009162	Populus Rhizosphere	RDDGKGFLKETRYKLNEIASGKLLDPLIQPGDRITIIK*
Ga0105241_122260381	3300009174	Corn Rhizosphere	PRKLKEARLSRDNGKGFLVVNRYKLKDIDSGRMPDPLLQPGDRVTVTK*
Ga0105237_102256013	3300009545	Corn Rhizosphere	GKGFLVVTRFKLKEIESGKIQDPVIKPGDRITIGH*
Ga0105249_117248951	3300009553	Switchgrass Rhizosphere	EATLGRDDGKGFLVVTKYKLKEIESGKVQDPVVKPGDRITIKE*
Ga0126315_105848402	3300010038	Serpentine Soil	NGFLVVTRYKLKDIESGKVPDPAVKPGDRITIRD*
Ga0126308_109050741	3300010040	Serpentine Soil	PKAKEARLGRDDGKGFLIVTRYKLKEIESGKVQDPAVKPGDRITIKE*
Ga0126312_109281712	3300010041	Serpentine Soil	GKGFLVITTYKLKEIESGKAQDPAVKPGDRITIKE*
Ga0126384_125060471	3300010046	Tropical Forest Soil	ARIGRDDGKGFLVVTRFKLKEIESGKIQDPLVKPGDRITIRD*
Ga0126382_123562143	3300010047	Tropical Forest Soil	DNGKGFLVVNRYKLKDINSGKVPDPLIQAGDRITIE*
Ga0134128_108768502	3300010373	Terrestrial Soil	KGFLNVIRYKLEEIESGKLQDPLIQPGDRILIVN*
Ga0105239_120576042	3300010375	Corn Rhizosphere	KAKEARLGRDDGSGFLAVTVYKLKDIESGKAQDPVLKPGDRITIKD*
Ga0134126_102292223	3300010396	Terrestrial Soil	GKGFLIVTKFKLKEIESGKVQDPTVKPGDRITIKE*
Ga0134124_129264431	3300010397	Terrestrial Soil	TEARLWRDDGKGFLKETRYKLKEIASGKLLDPLIQPGDRITIIN*
Ga0134127_108617491	3300010399	Terrestrial Soil	GKPKEARLGRDDGRGFLIVTKFKLKEIESGKVPDPLVRPGDRITVIQ*
Ga0134123_106661412	3300010403	Terrestrial Soil	KEARLGRDDGKGFLVVTRYKLKEIESGKVQDPAVKPGDRITIKE*
Ga0120187_10175922	3300012015	Terrestrial	KEARLARDDGKGFLAVTRYKLKEIESGKVQDPLVKPGDRITIKE*
Ga0136623_100323373	3300012045	Polar Desert Sand	DDGKGFLSVSRYKLKDIDSGKQPDPLIQPGDRITIVD*
Ga0150985_1112000712	3300012212	Avena Fatua Rhizosphere	VTPKAKEARLGRDDGKGFLVVTKYKLKEIESGKVQDPAVKPGDRITIKE*
Ga0137370_109065381	3300012285	Vadose Zone Soil	QARLGRDDGNGFLVINHFKLKDIESGKVPDPVVKPGDRIMIVE*
Ga0137390_115652901	3300012363	Vadose Zone Soil	EARIARDDGKGFLVVNRYKLKDIDSGKLPDPLIQPGDRITIVD*
Ga0126375_110526092	3300012948	Tropical Forest Soil	GKGFLAVSRYKLKDIEKGKVADPVIQPGDRITIIK*
Ga0126375_115598462	3300012948	Tropical Forest Soil	KEARLARDNGKGFLSVTRYKLKEINSGKVPDPVIQAGDRITIEH*
Ga0164299_114788461	3300012958	Soil	RDDGKGFLVVTKYKLNEIESGKVQDPAVKPGDRITIKE*
Ga0157380_103048182	3300014326	Switchgrass Rhizosphere	GRGLLAVKRYKLKEIDSGKVPDPVIQPGDRITIID*
Ga0157380_121513291	3300014326	Switchgrass Rhizosphere	GKGFLVVTSYKLKEIDSGKVQDPLVKAGDRITIKD*
Ga0157377_103798882	3300014745	Miscanthus Rhizosphere	RDDGKGFLTVTKYKLKEIESGKVQDPAVKPGDRITIKE*
Ga0157377_115920651	3300014745	Miscanthus Rhizosphere	PREVRVGRDDGKGFLAVTRYQLKDIEMGKVQDPLIQPGDRITVIN*
Ga0132257_1009875631	3300015373	Arabidopsis Rhizosphere	ARLARDDGKGFLIITKYKLKDIDSAKLPDPIIQPGDRITIID*
Ga0132257_1013177422	3300015373	Arabidopsis Rhizosphere	RDNGKGFLMVKRYKLKEIESGKVPDPPIQTGDRITIIK*
Ga0132255_1035540072	3300015374	Arabidopsis Rhizosphere	GKGFLVQSRYKLKDIDSGKVPGPLVQPGDRITIVK*
Ga0184605_101881732	3300018027	Groundwater Sediment	GKPKEARLARDDGKGFLVVSRYKLKDIDSGKLPDPSIQPGDRITIVD
Ga0207642_110447572	3300025899	Miscanthus Rhizosphere	VRLARDDGKGFLIVNHYKLKDIESGNVKDPLIQAGDRITINE
Ga0207710_106510281	3300025900	Switchgrass Rhizosphere	KAKEARLGRDNGEGFLVVTRYKLKDIESGKVADPIVKPGDRITIHD
Ga0207647_103664011	3300025904	Corn Rhizosphere	GRDDGKGFLVVTRYKLKEIESGKVQDPAVKPGDRITIKE
Ga0207654_102415872	3300025911	Corn Rhizosphere	DNGEGFLVVTRYRLKDIESGKVPDPVVKPGDRITIHD
Ga0207654_113165021	3300025911	Corn Rhizosphere	GRDDGKGFLVVTRYKLKEIESGKVQDPLVKPGDRITIHD
Ga0207707_106085771	3300025912	Corn Rhizosphere	KGKEARLGRDDGHGFLTVTKFKLKEIESGKIADPVVHPGDRITIME
Ga0207660_102563671	3300025917	Corn Rhizosphere	GGVVDKPKEARLGRDDGRGFLIITKFKLKDIESGKVPDPLIRPGDRIMVIK
Ga0207662_104424622	3300025918	Switchgrass Rhizosphere	AQLARDNGRGFLAVKRYKLKEIDSGKVPDPVIQPGDRITIID
Ga0207687_109142733	3300025927	Miscanthus Rhizosphere	MCAVRDDGKGFLVVTKFKLKDIESGKVQDPTIKPGDRITIKE
Ga0207706_105596291	3300025933	Corn Rhizosphere	RLGRDDGNGFLVVTRYKLKEIESGKVQDPAVKPGDRITIKE
Ga0207670_117474561	3300025936	Switchgrass Rhizosphere	DGNGFLVVTRFKLKEIESGKIPDPVVKPGDRITIKD
Ga0207669_109923391	3300025937	Miscanthus Rhizosphere	GNGFLVMTRYKLKDIETGKGRDPQIQPGDRITIVD
Ga0207651_106315702	3300025960	Switchgrass Rhizosphere	KVKEARLARDDGKGFLVVTSYKLKEIDSGKVQDPLVKAGDRITIKD
Ga0207640_109129531	3300025981	Corn Rhizosphere	KEAQVGRDNGQGFLAITRYKLKEIESGKVADPSIEPGDRITIND
Ga0207639_118520721	3300026041	Corn Rhizosphere	DGKGFLVVTRYKLKEIESGKVQDPDVKPGDRITIKE
Ga0207674_102966571	3300026116	Corn Rhizosphere	NGEGFLVVTRYKLKEIESGKVQDPVVKPGDRITIRD
Ga0207674_108568762	3300026116	Corn Rhizosphere	KEARLGRDDGRGFLILTKFKLKDIESGKVPDPLLRPGDRITVVK
Ga0209177_103743152	3300027775	Agricultural Soil	GKKAELARDNGKGFLMVKRYKLKEIESGKVPDPPIQTGDRITIIK
Ga0209382_123323551	3300027909	Populus Rhizosphere	DGNGFLVMTRYKLKDIETGKGRDPQIQPGDRITIVD
Ga0268265_104022301	3300028380	Switchgrass Rhizosphere	KAKEARLGRDDGKGFLVVTRYKLKEIESGKVQDPAVKPGDRITIKE
Ga0307406_116763991	3300031901	Rhizosphere	VLGKPKEARLGRDDGRGFLIVTKFKLKEIESGKVPDPLVRPGDRVTVIE
Ga0310900_118376801	3300031908	Soil	AGGVVEKPKEARLGRDDGRGFLIVTKFKLKDIESGKVPDPLVRPGDRIMVVK
Ga0310906_103966491	3300032013	Soil	DDGKGFLIVNRYKLQEIESGKLKDPLIEPGDRITIND
Ga0310810_102580471	3300033412	Soil	RDDGKGFLTVTKYKLKDIESGKVQDPVVKPGDRITIKD