NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F092673

Metagenome Family F092673

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F092673
Family Type Metagenome
Number of Sequences 107
Average Sequence Length 49 residues
Representative Sequence AIGSDVTFYSKPSILDSIYGSNPVSWKLFFRIRPSPMTMSRMHGTH
Number of Associated Samples 88
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 94.39 %
% of genes from short scaffolds (< 2000 bps) 84.11 %
Associated GOLD sequencing projects 82
AlphaFold2 3D model prediction Yes
3D model pTM-score0.18

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.262 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere
(14.953 % of family members)
Environment Ontology (ENVO) Unclassified
(52.336 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(72.897 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 9.46%    β-sheet: 0.00%    Coil/Unstructured: 90.54%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.18
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF13798PCYCGC 42.99
PF00578AhpC-TSA 12.15
PF11604CusF_Ec 7.48
PF13414TPR_11 1.87
PF04234CopC 0.93
PF13088BNR_2 0.93
PF00484Pro_CA 0.93
PF13620CarboxypepD_reg 0.93
PF01432Peptidase_M3 0.93
PF04366Ysc84 0.93
PF13474SnoaL_3 0.93
PF13508Acetyltransf_7 0.93
PF02518HATPase_c 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 107 Family Scaffolds
COG0288Carbonic anhydraseInorganic ion transport and metabolism [P] 0.93
COG0339Zn-dependent oligopeptidase, M3 familyPosttranslational modification, protein turnover, chaperones [O] 0.93
COG1164Oligoendopeptidase FAmino acid transport and metabolism [E] 0.93
COG2372Copper-binding protein CopC (methionine-rich)Inorganic ion transport and metabolism [P] 0.93
COG2930Lipid-binding SYLF domain, Ysc84/FYVE familyLipid transport and metabolism [I] 0.93

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.26 %
UnclassifiedrootN/A3.74 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_105567795All Organisms → cellular organisms → Bacteria823Open in IMG/M
3300000550|F24TB_13048664All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae541Open in IMG/M
3300000956|JGI10216J12902_110052107All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1155Open in IMG/M
3300001089|JGI12683J13190_1020612All Organisms → cellular organisms → Bacteria → Acidobacteria577Open in IMG/M
3300002897|JGI24804J43974_1000714All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium2435Open in IMG/M
3300003323|rootH1_10013116All Organisms → cellular organisms → Bacteria1219Open in IMG/M
3300004157|Ga0062590_100473238All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1057Open in IMG/M
3300004479|Ga0062595_101957358All Organisms → cellular organisms → Bacteria → Acidobacteria564Open in IMG/M
3300005093|Ga0062594_100645139All Organisms → cellular organisms → Bacteria941Open in IMG/M
3300005288|Ga0065714_10212759All Organisms → cellular organisms → Bacteria862Open in IMG/M
3300005293|Ga0065715_10582753All Organisms → cellular organisms → Bacteria719Open in IMG/M
3300005293|Ga0065715_11080677All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300005328|Ga0070676_10072941All Organisms → cellular organisms → Bacteria2065Open in IMG/M
3300005337|Ga0070682_101097491All Organisms → cellular organisms → Bacteria666Open in IMG/M
3300005340|Ga0070689_100508729All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1033Open in IMG/M
3300005340|Ga0070689_101422134All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300005343|Ga0070687_101075659All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300005434|Ga0070709_11565551All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300005438|Ga0070701_10926605All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300005440|Ga0070705_101193002All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300005440|Ga0070705_101685670All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae535Open in IMG/M
3300005441|Ga0070700_100026506All Organisms → cellular organisms → Bacteria3424Open in IMG/M
3300005536|Ga0070697_101586932All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300005536|Ga0070697_101861276All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium539Open in IMG/M
3300005564|Ga0070664_100682716All Organisms → cellular organisms → Bacteria956Open in IMG/M
3300005615|Ga0070702_101245793All Organisms → cellular organisms → Bacteria602Open in IMG/M
3300005618|Ga0068864_100750422All Organisms → cellular organisms → Bacteria956Open in IMG/M
3300005618|Ga0068864_101414167All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300005618|Ga0068864_102194320All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300005719|Ga0068861_100558891All Organisms → cellular organisms → Bacteria1044Open in IMG/M
3300005719|Ga0068861_101332827All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300005840|Ga0068870_10478144All Organisms → cellular organisms → Bacteria826Open in IMG/M
3300005843|Ga0068860_100455327All Organisms → cellular organisms → Bacteria1272Open in IMG/M
3300005844|Ga0068862_100955792All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae845Open in IMG/M
3300005844|Ga0068862_101052725All Organisms → cellular organisms → Bacteria807Open in IMG/M
3300006058|Ga0075432_10056891All Organisms → cellular organisms → Bacteria1387Open in IMG/M
3300006169|Ga0082029_1767914All Organisms → cellular organisms → Bacteria822Open in IMG/M
3300006237|Ga0097621_100049979All Organisms → cellular organisms → Bacteria3399Open in IMG/M
3300006755|Ga0079222_10291514All Organisms → cellular organisms → Bacteria1058Open in IMG/M
3300006755|Ga0079222_12113148All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae557Open in IMG/M
3300006852|Ga0075433_10225617All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1664Open in IMG/M
3300006876|Ga0079217_10017338All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia2468Open in IMG/M
3300006880|Ga0075429_101552408All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300006904|Ga0075424_100469157All Organisms → cellular organisms → Bacteria1344Open in IMG/M
3300006904|Ga0075424_100657262All Organisms → cellular organisms → Bacteria1119Open in IMG/M
3300007004|Ga0079218_11463434All Organisms → cellular organisms → Bacteria736Open in IMG/M
3300009098|Ga0105245_10350976All Organisms → cellular organisms → Bacteria1462Open in IMG/M
3300009098|Ga0105245_11121786All Organisms → cellular organisms → Bacteria833Open in IMG/M
3300009100|Ga0075418_10143214All Organisms → cellular organisms → Bacteria2543Open in IMG/M
3300009101|Ga0105247_11479553All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300009162|Ga0075423_10394699All Organisms → cellular organisms → Bacteria1452Open in IMG/M
3300009174|Ga0105241_11488446All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300009174|Ga0105241_11713461All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300009176|Ga0105242_13002918All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300009177|Ga0105248_13243820All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300010037|Ga0126304_10358451All Organisms → cellular organisms → Bacteria970Open in IMG/M
3300010045|Ga0126311_10011972All Organisms → cellular organisms → Bacteria → Acidobacteria4908Open in IMG/M
3300010046|Ga0126384_10618715All Organisms → cellular organisms → Bacteria950Open in IMG/M
3300010375|Ga0105239_10776867All Organisms → cellular organisms → Bacteria1097Open in IMG/M
3300010397|Ga0134124_11679630All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300012189|Ga0137388_11657255All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium574Open in IMG/M
3300012893|Ga0157284_10226641All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300012986|Ga0164304_10256507All Organisms → cellular organisms → Bacteria1175Open in IMG/M
3300013100|Ga0157373_11590236All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300013102|Ga0157371_11658095All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300013297|Ga0157378_11607584All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia696Open in IMG/M
3300013306|Ga0163162_12445342All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300013307|Ga0157372_10576528All Organisms → cellular organisms → Bacteria1311Open in IMG/M
3300013308|Ga0157375_10526044All Organisms → cellular organisms → Bacteria1345Open in IMG/M
3300014325|Ga0163163_12645629All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300014745|Ga0157377_10703060All Organisms → cellular organisms → Bacteria734Open in IMG/M
3300015052|Ga0137411_1301091All Organisms → cellular organisms → Bacteria2919Open in IMG/M
3300015085|Ga0167632_1022847All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium852Open in IMG/M
3300015265|Ga0182005_1184412All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300015371|Ga0132258_12323739All Organisms → cellular organisms → Bacteria1344Open in IMG/M
3300015372|Ga0132256_101195274Not Available874Open in IMG/M
3300015372|Ga0132256_102592677All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300018466|Ga0190268_12171880All Organisms → cellular organisms → Bacteria → Acidobacteria518Open in IMG/M
3300025899|Ga0207642_10950788All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300025911|Ga0207654_10732968All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300025936|Ga0207670_10690833All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae844Open in IMG/M
3300025936|Ga0207670_11256811All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300025945|Ga0207679_11586284All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300026023|Ga0207677_11441972All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300026035|Ga0207703_10142186All Organisms → cellular organisms → Bacteria2084Open in IMG/M
3300026041|Ga0207639_10050519All Organisms → cellular organisms → Bacteria → Acidobacteria3158Open in IMG/M
3300026088|Ga0207641_11955326All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300026089|Ga0207648_10237940All Organisms → cellular organisms → Bacteria1620Open in IMG/M
3300026089|Ga0207648_10582450All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1030Open in IMG/M
3300026095|Ga0207676_10123753All Organisms → cellular organisms → Bacteria2186Open in IMG/M
3300026116|Ga0207674_10806215All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae906Open in IMG/M
3300026116|Ga0207674_11194782All Organisms → cellular organisms → Bacteria730Open in IMG/M
3300026118|Ga0207675_100122509All Organisms → cellular organisms → Bacteria2461Open in IMG/M
3300027639|Ga0209387_1000314All Organisms → cellular organisms → Bacteria → Acidobacteria14155Open in IMG/M
3300027691|Ga0209485_1149382All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium697Open in IMG/M
3300027775|Ga0209177_10203018All Organisms → cellular organisms → Bacteria707Open in IMG/M
3300027909|Ga0209382_11398869All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium703Open in IMG/M
3300028381|Ga0268264_10065926All Organisms → cellular organisms → Bacteria3052Open in IMG/M
3300028381|Ga0268264_10941753All Organisms → cellular organisms → Bacteria868Open in IMG/M
3300028381|Ga0268264_12288987All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300031548|Ga0307408_100247440All Organisms → cellular organisms → Bacteria1469Open in IMG/M
3300032004|Ga0307414_10159948All Organisms → cellular organisms → Bacteria1788Open in IMG/M
3300032180|Ga0307471_103809674All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300033412|Ga0310810_10802559All Organisms → cellular organisms → Bacteria850Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere14.95%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.48%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere7.48%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil6.54%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere5.61%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere4.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.74%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.80%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere2.80%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.80%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.80%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.80%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.80%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.87%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.87%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.87%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.87%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.87%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.93%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.93%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.93%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.93%
Termite NestEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest0.93%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.93%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.93%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.93%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.93%
Sugarcane Root And Bulk SoilHost-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil0.93%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001089Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3EnvironmentalOpen in IMG/M
3300002897Soil microbial communities from Manhattan, Kansas, USA - Sample 500um NexteraEnvironmentalOpen in IMG/M
3300003323Sugarcane root Sample H1Host-AssociatedOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005288Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1Host-AssociatedOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006169Termite nest microbial communities from Madurai, IndiaEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1EnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015052Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015085Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4B, Ice margin, adjacent to proglacial lake)EnvironmentalOpen in IMG/M
3300015265Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027639Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes)EnvironmentalOpen in IMG/M
3300027691Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300032004Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3Host-AssociatedOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10556779523300000364SoilIGSDVTFYSKPAILDSVYGNNPVSWKLFFRIRPGKMTMQMH*
F24TB_1304866423300000550SoilEIWNPKKTSVALGSDLTFYSKPEILDSIYGDHPVSWKFFVRLRPTKMTMSDLHGKH*
JGI10216J12902_11005210713300000956SoilSDLTFYSKPSILDSVYGTNPVSWKIFFRLRPSKMNMSGTHGTH*
JGI12683J13190_102061213300001089Forest SoilIGSDLTFYSKPAILDRIYGANPVSWKLFLRIRPGKMDMSSMHGTHGKH*
JGI24804J43974_100071413300002897SoilSVALGSDVTFYSKPAALDQIYGSSPVSWKVFVRLRPAKMDMQRMHGGH*
rootH1_1001311623300003323Sugarcane Root And Bulk SoilLTFYSKPSILDPIYGSNPVSWKVFVRIRPGQMHMSSMHGMH*
Ga0062590_10047323813300004157SoilFYSKPSILDSIYGAHPVSWKLFVRVRPAAMNMTGMHSMH*
Ga0062595_10195735823300004479SoilVTFYSKPSILDSIYGSNPVSWKLFVRVRPAQMNMSGMHATH*
Ga0062594_10064513913300005093SoilALAIGSDVTFYSKPSILDSVYGNNPVSWKLFFRIRPGKMTMHMH*
Ga0066688_1042625823300005178SoilSLAVGSDVTFYSKPAALDPIYGQRPVSWKLFFRIRPGKMEMSHAHDGMQMPQGQQ*
Ga0065714_1021275933300005288Miscanthus RhizosphereNTEKASFAIGSDLTLYSTPSVLDPIYGSNPVSWKLFVRVRPGPMNMSSMHGMH*
Ga0065715_1058275323300005293Miscanthus RhizosphereGGARDIWNTEKTSLAIGSDLTFYSKPSLLDPIYGANPVSWKLFFRVRPAQMNMSAMHGTH
Ga0065715_1108067713300005293Miscanthus RhizosphereKTSVAIGSDVTFYSKPPILDSIYGSNPVSWKVFVRVRPGPMNMSSSMHGTH*
Ga0070676_1007294113300005328Miscanthus RhizosphereGGSREIWNTEKHSLALGSDVTFYSKPSILDSIYGKNPVSWKFFIRLRPQKMTHGTH*
Ga0070690_10115651213300005330Switchgrass RhizosphereGIGSDLTFYSKPSILDTLYGNNPVSWKIFFRIRPGKMDMHSMHGTSGDKNKK*
Ga0070682_10109749113300005337Corn RhizosphereAGGARDIWNTEKTSVAIGSDVTFYSKPSILDPIYGTNPVSWKVFVRVRPGPMNMSSMHGTH*
Ga0070689_10050872913300005340Switchgrass RhizosphereAIGSDLTFYSKPSILDSIYGTNPVSWKAFVRIRPGQMNMGSMHGMH*
Ga0070689_10142213413300005340Switchgrass RhizosphereEKVSLAIGSDLTFYSKPSILDSIYGANPVSWKAFVRIRPGQMNMSSMHGTH*
Ga0070687_10107565913300005343Switchgrass RhizosphereDVTFYSKPSILDSVYGENPVSWKIFFRLRPAKMTMHGSHQTH*
Ga0070709_1156555123300005434Corn, Switchgrass And Miscanthus RhizosphereFAIGSDLTFYSKPSLLDSVYGTNPISWKAFFRIRPGKIDMHGGH*
Ga0070701_1092660523300005438Corn, Switchgrass And Miscanthus RhizosphereTEKTSVAIGSDVTFYSKPSILDSIYGSNPVSWKVFVRVRPGPMNMSSMHGTH*
Ga0070705_10119300213300005440Corn, Switchgrass And Miscanthus RhizosphereTSFAIGSDLTFYSKPSLLDPIYGSNPVSWKLFFRLRPNEMNMSAMH*
Ga0070705_10168567023300005440Corn, Switchgrass And Miscanthus RhizosphereGTRDIWNTEKTSLAIGSDVTFYSKPSILDSIYGAHPVSWKLFVRVRPAAMNMTGMHSMH*
Ga0070700_10002650613300005441Corn, Switchgrass And Miscanthus RhizosphereAIGSDVTFYSKPSILDSIYGKNPVSWKFFIRLRPQKMTHGTH*
Ga0070697_10158693223300005536Corn, Switchgrass And Miscanthus RhizosphereSLAIGSDVTFYSKPSILDSIYGQHPVSWKVFVRLRPGPMNMNGMH*
Ga0070697_10186127623300005536Corn, Switchgrass And Miscanthus RhizosphereDLTFYSKPAILDRIYGTNPVSWKLFLRFSAGKMDMSSVHGMH*
Ga0070664_10068271633300005564Corn RhizosphereIGSDVTFYSKPSILDPIYGANPVSWKIFVRVRPGPMDMSSMHGTH*
Ga0070702_10124579323300005615Corn, Switchgrass And Miscanthus RhizosphereGSDVTFYSKPSILDSVYGQNPVSWKLFVRIRPAPMNMSGMHSMH*
Ga0068864_10075042213300005618Switchgrass RhizosphereDVTFYSKPSILDSIYGAHPVSWKLFVRVRPAAMNMTGMHSMH*
Ga0068864_10141416723300005618Switchgrass RhizosphereTAGGARDIWNTEKTSVAIGSDVTFYSKPSILDPIYGSHPVSWKVFVRVRPGPMNMSSSMHGTH*
Ga0068864_10219432023300005618Switchgrass RhizosphereRDIWNTEKVSLAIGSDLTFYSKPSILDPIYGANPVSWKAFVRIRPGQMNMSSMHGTH*
Ga0068861_10055889113300005719Switchgrass RhizosphereAIGSDVTFYSKPSILDSIYGSNPVSWKLFFRIRPSPMTMSRMHGTH*
Ga0068861_10133282723300005719Switchgrass RhizosphereIGSDLTFYSKPSILDPIYGANPVSWKAFVRIRPGPMKMSSMHDMH*
Ga0068870_1047814413300005840Miscanthus RhizosphereIWNTEKHSFAVGSDVTFYSKPSILDAIYGTNPVSWKIFFRLRPQKMSMSGMHGTH*
Ga0068860_10045532723300005843Switchgrass RhizosphereYTFGGVRDLWNSRRLSLAIGSDLTFYSKPSVLDQIYGSNPVSWKLFFRVRPAKMK*
Ga0068862_10095579213300005844Switchgrass RhizosphereGSDVTFYSKPSILDPIYGSNPVSWKLFVRLRPAPMTMSRMMHGMH*
Ga0068862_10105272513300005844Switchgrass RhizosphereNTEKVSLAIGSDLTFYSKPSILDSIYGANPVSWKAFVRIRPGQMNMSSMHGTH*
Ga0068862_10142750433300005844Switchgrass RhizosphereGIGSDLTFYSKPAILDSIYGNKPISWKLFFRIRPGKMDMHGTH*
Ga0075432_1005689143300006058Populus RhizosphereKTSFAIGSDLTFYSKPSLLDSIYGSNPVSWKLFFRLRPSRMNMSAMHGTH*
Ga0082029_176791433300006169Termite NestIGADTFGGAREIWNTEKTSFAVGSDLTFYSKPSLLDPIYGSNPVSWKLFFRVRPSQMNMSAMHGTH*
Ga0097621_10004997913300006237Miscanthus RhizosphereGSDLTFYSKPSVLDQIYGSNPVSWKLFFRVRPAKMK*
Ga0079222_1029151433300006755Agricultural SoilVAIGTDLTFYSKPSILDPIYGSNPVSWKAFVRISPGPMNMSSMHGMH*
Ga0079222_1211314823300006755Agricultural SoilSLAVGSDVTFYSKPSILDPIYGSHPVSWKLFFRLRPAPMNMSGMH*
Ga0075433_1022561713300006852Populus RhizosphereFAIGSDLTFYSKPSLLDPIYGSNPVSWKLFFRLRPSEMNMSAMHGTH*
Ga0079217_1001733853300006876Agricultural SoilGSDLTFYSKPSILDSIYGTNPVSWKLFIRLRPQKMNMSGMHGTH*
Ga0075429_10155240823300006880Populus RhizosphereWNTEKHSLAIGSDVTFYSKPSILDSIYGTNPVSWKIFFRLRPQKMSMSGMHGTH*
Ga0075424_10046915733300006904Populus RhizosphereVGSDVTFYSKPSILDSIYGSNPVSWKLFVRVRPAQMNMSGMHATH*
Ga0075424_10065726233300006904Populus RhizosphereSDLTFYSTPSILDPIYGSNPVSWKLFFRLRPSEMNMSAMHGMH*
Ga0079218_1146343413300007004Agricultural SoilTEKHSLAIGSDVTFYSKPSILDSIYGTNPVSWKIFFRLRPQKMSMSGMHGTH*
Ga0105245_1035097633300009098Miscanthus RhizosphereSIAAGSDVTFYSKPAVLDQLYGNNPVSWKLFLRFRPGKMEMSSMHPTH*
Ga0105245_1112178633300009098Miscanthus RhizosphereFYSTPSLLDPIYGSNPVSWKLFFRLRPSQMNMSSMHGTH*
Ga0075418_1014321443300009100Populus RhizosphereGAREIWNTDRASLAIGTDLTFYSKPSILDTVYGTHPVSWKAFFRVRPGKMKMHGMH*
Ga0105247_1147955313300009101Switchgrass RhizosphereDIWNTEKTLLAIGSDVTFYSKPSLLDSVYGQNPVSWKLFVRVRPAPMNMSGMHSMH*
Ga0075423_1039469943300009162Populus RhizosphereEKTSFAIGSDLTFYSKPSLLDPIYGSNPVSWKLFFRLRPSEMNMSAMHGMH*
Ga0105241_1148844613300009174Corn RhizosphereLTFYSKPALLDPIYGGNPVSWKAYLRFRPGKMDMASMHGTH*
Ga0105241_1171346113300009174Corn RhizospherePSILDPIYGSNPVSWKVFVRVRPGPMNMSSMHGMH*
Ga0105242_1300291823300009176Miscanthus RhizosphereIGSDLTFYSKPSLLDPIYGSNPVSWKLFFRLRPNEMNMSAMHGTH*
Ga0105248_1324382023300009177Switchgrass RhizosphereRDIWNTEKASVAIGSDLTFYSKPSILDPIYGANPVSWKAFVRIRPGPMKMSSMHDMH*
Ga0126304_1035845113300010037Serpentine SoilIGSDLTFYSKPAILDSIYGSNPVSWKIFFRVRPGPMNMSSMHGTH*
Ga0126311_1001197213300010045Serpentine SoilSDVTFYSKPSILDPVYGSNPVSWKVFVRLRPGPMSMTH*
Ga0126384_1061871533300010046Tropical Forest SoilAIGSDVTFYSKPSLLDPIYGSHPVSWKLFFRLRPAPMSMSGMHGMH*
Ga0105239_1077686733300010375Corn RhizosphereIGSDLTFYSTPSILDPIYGSNPVSWKLFVRVRPGPMNMSSMHGMH*
Ga0134124_1167963013300010397Terrestrial SoilIGAYTAGGARDIWNTEKTSVAIGSDVTFYSKPSILDPIYGANPVSWKIFVRVRPGPMDMSSMHGTH*
Ga0137388_1165725523300012189Vadose Zone SoilGSDLTFYSKPAVLDQIYGANPVSWKLFLRFRPGKMDMSMHGRH*
Ga0157284_1022664123300012893SoilVWNTAKTSLAIGSDVTFYSKPSILDSVYGENPVSWKIFFRLRPAKMTMHGSHQTH*
Ga0164304_1025650713300012986SoilSARVSIALGSDVTFYSKPALLDQLYGNNPVSWKLFFRIRPGKMEMSEPHGTH*
Ga0157373_1159023623300013100Corn RhizosphereEKTSFAIGSDLTFYSKPSLLDPIYGLNPVSWKLFFRLRPNEMNMSAMHGTH*
Ga0157371_1165809523300013102Corn RhizosphereGGARDIWNTEKTSLAIGSDVTFYSKPSILDSIYGAHPVSWKLFVRVRPAAMNITGMHSMH
Ga0157378_1160758433300013297Miscanthus RhizosphereELFTSTKVSLAVGSDVTFYSKPAMLDQIYGNNPVSWKLFLRFRPGKMEMSSMHGGH*
Ga0163162_1244534213300013306Switchgrass RhizosphereTFGGARDIWNTEKTSLAIGSDLTFYSKPSILDSIYGTNPVSWKAFVRIRPGQMNMGSMHGMH*
Ga0157372_1057652813300013307Corn RhizosphereTSVAIGSDVTFYSKPSILDPVYGSNPVSWKVFVRLRPSPMSMTH*
Ga0157375_1052604413300013308Miscanthus RhizosphereDIWNTEKTLLAIGSDVTFYSKPSLLDSVYGQNPVSWKLFVRIRPAPMNMSGMHSMH*
Ga0163163_1264562913300014325Switchgrass RhizosphereARDIWNTEKTSVAIGSDLTFYSKPSILDPIYGTNPVSWKVFVRVRPGPMNMSSMHGTH*
Ga0157377_1070306013300014745Miscanthus RhizosphereTEKTSVAIGSDVTFYSKPSILDPIYGSHPVSWKVFVRVRPGPMNMSSSMHGTH*
Ga0137411_130109143300015052Vadose Zone SoilMAIGSDVTFYSKPSALDRLYGANPVSWRLFLRLRPSKMDMSGTKYTAI*
Ga0167632_102284723300015085Glacier Forefield SoilKISFAIGSDLTFYSKPALLDPIYGNPVSWKLFVRLRPARMKMGNIQSTHENH*
Ga0182005_118441213300015265RhizosphereSDVTFYSKASILDPIYGSHPVSWKLFFRLRPAPMSMGGMHGTH*
Ga0132258_1232373943300015371Arabidopsis RhizosphereDLTFYSKSSLLDPIYGSNPVSWKLFFRLRPNEMNMSAMHGTH*
Ga0132256_10119527413300015372Arabidopsis RhizosphereAIGSDVTFYSKPAALDVIYGNNPVSWKVFFRLRPAKMKMDVHGSHDQMTKPE*
Ga0132256_10259267713300015372Arabidopsis RhizosphereGSDLTFYSKPSVLDQIYGSNPVSWKLFFRVRPAKM*
Ga0190268_1217188013300018466SoilGSDVTFYSKPSILDSIYGANPVSWKLFVRLRPSQMTMSRMH
Ga0207642_1095078823300025899Miscanthus RhizosphereRDIWNTEKTSVAIGSDVTFYSKPPILDSIYGSNPVSWKVFVRVRPGPMNMSSAMHGTH
Ga0207654_1073296813300025911Corn RhizosphereTEKTSLAIGSDVTFYSKPSILDSIYGAHPVSWKLFVRVRPAAMNMTGMHSMH
Ga0207670_1069083313300025936Switchgrass RhizospherePSLLDPIYGSNPVSWKLFFRLRPNEMNMSAMHGTH
Ga0207670_1125681123300025936Switchgrass RhizosphereEKVSLAIGSDLTFYSKPSILDSIYGANPVSWKAFVRIRPGQMNMSSMHGTH
Ga0207679_1158628413300025945Corn RhizosphereFRIGAYTAGGARDIWNTEKTSVAIGSDLTFYSKPSILDPIYGTNPVSWKVFVRVRPGPMNMSSMHGSH
Ga0207677_1144197223300026023Miscanthus RhizosphereAIGSDVTFYSKPSILDPIYGAHPVSWKLFFRLRPAPMSMGGMHGTH
Ga0207703_1014218613300026035Switchgrass RhizosphereIGSDLTFYSKPSLLDPIYGSNPVSWKLFFRLRPSQMKMGAMHGTH
Ga0207639_1005051963300026041Corn RhizosphereIWNTGTTSFAIGSDLTFYSKPSLLDPIYGSNPVSWKLFFRLRPSQMNMGAMHGTH
Ga0207641_1195532613300026088Switchgrass RhizosphereIWNTEKTSLAIGSDLTFYSKPSLLDPIYGSNPVSWKLFFRLRPSQMNMSAMHGTH
Ga0207648_1023794043300026089Miscanthus RhizosphereSLAVGSDLTFYSKPSLLDPIYGSNPVSWKLFFRLRPNEMNMSGMHGTH
Ga0207648_1058245033300026089Miscanthus RhizosphereGSDVTFYSKPSILDSIYGKNPVSWKFFIRLRPQKMTHGTH
Ga0207676_1012375313300026095Switchgrass RhizosphereEKTSLAIGSDVTFYSKPSILDSIYGAHPVSWKLFVRVRPAAMNMTGMHSMH
Ga0207674_1080621513300026116Corn RhizosphereSLAIGSDLTFYSKPSILDPIYGTNPVSWKIFVRLRPQKMSMSGMHGTH
Ga0207674_1119478213300026116Corn RhizosphereSDVTFYSKPSILNPIYGSNPVSWKVFVRIRPGPMNMSSSMHGMH
Ga0207675_10012250953300026118Switchgrass RhizosphereFYSKPSILDSIYGKNPVSWKFFIRLRPQKMTHGTH
Ga0209387_100031413300027639Agricultural SoilNTEKHSLAIGSDVTFYSKPSILDSIYGTNPVSWKIFFRLRPQKMSMSGMHGTH
Ga0209485_114938213300027691Agricultural SoilSKPSILDSIYGTNPVSWKIFFRLRPQKMSMSGMHGTH
Ga0209177_1020301813300027775Agricultural SoilAVGSDVTFYSKPSLLDPIYGSHPVSWKLFFRLRPAPMNMSGMH
Ga0209382_1139886913300027909Populus RhizosphereLAVGTDITFYSKPSILDSIYGTNPVSWKIFLRLRPQKMSMSGMHGTH
Ga0268264_1006592663300028381Switchgrass RhizosphereKTSVAIGSDVTFYSKPPILDPIYGSNPVSWKVFVRVRPGPMSMSSSMHGTH
Ga0268264_1094175313300028381Switchgrass RhizosphereIGAYTIGGARDIWNTEKTLLAIGSDVTFYSKPSLLDSVYGQNPVSWKLFVRIRPAPMNMSGMHSMH
Ga0268264_1228898723300028381Switchgrass RhizosphereSILDPIYGSNPVSWKLFFRVRPAPMTMSRMMHGMH
Ga0307408_10024744013300031548RhizosphereVVTGGARDIWNPESTSVAIGSDVTFYSKPPILDSIYGSNPVSWKVFVRVRPGAMNMSSMHGTQ
Ga0307414_1015994843300032004RhizosphereNTERTSLAIGSDVTFYSKPSLLDSVYGSNPVSWKVFFRLRPGPMSMTH
Ga0307471_10380967423300032180Hardwood Forest SoilGAYTLGGARDIWNTEKTSLALGSDVTFYSKPSVLDSIYGDNPVSWKLFVRLRPSQMSMTH
Ga0310810_1080255913300033412SoilDVTFYSKPSILDPIYGSHPVSWKLFFRLRPAPMSMGGMHGTH

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.