Basic Information | |
---|---|
Family ID | F092645 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 107 |
Average Sequence Length | 45 residues |
Representative Sequence | KRNPGRHAERDPLGAKRRAELSLRVGAVLPWIMVGNTVWRIKRRPV |
Number of Associated Samples | 101 |
Number of Associated Scaffolds | 107 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.93 % |
% of genes near scaffold ends (potentially truncated) | 79.44 % |
% of genes from short scaffolds (< 2000 bps) | 90.65 % |
Associated GOLD sequencing projects | 96 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.40 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (58.879 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil (11.215 % of family members) |
Environment Ontology (ENVO) | Unclassified (16.822 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (59.813 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.89% β-sheet: 0.00% Coil/Unstructured: 58.11% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 107 Family Scaffolds |
---|---|---|
PF11741 | AMIN | 20.56 |
PF00575 | S1 | 8.41 |
PF00912 | Transgly | 2.80 |
PF13808 | DDE_Tnp_1_assoc | 0.93 |
COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
---|---|---|---|
COG0744 | Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidase | Cell wall/membrane/envelope biogenesis [M] | 2.80 |
COG4953 | Membrane carboxypeptidase/penicillin-binding protein PbpC | Cell wall/membrane/envelope biogenesis [M] | 2.80 |
COG5009 | Membrane carboxypeptidase/penicillin-binding protein | Cell wall/membrane/envelope biogenesis [M] | 2.80 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 58.88 % |
Unclassified | root | N/A | 41.12 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2124908009|FWIRA_GRAM18401BPSMQ | Not Available | 502 | Open in IMG/M |
3300001081|JGI12662J13196_1007266 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 895 | Open in IMG/M |
3300001137|JGI12637J13337_1026279 | Not Available | 526 | Open in IMG/M |
3300001160|JGI12654J13325_1003004 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1044 | Open in IMG/M |
3300001661|JGI12053J15887_10366620 | Not Available | 695 | Open in IMG/M |
3300001661|JGI12053J15887_10517006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 570 | Open in IMG/M |
3300002886|JGI25612J43240_1084455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 504 | Open in IMG/M |
3300002914|JGI25617J43924_10310134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 544 | Open in IMG/M |
3300003369|JGI24140J50213_10274769 | Not Available | 515 | Open in IMG/M |
3300004782|Ga0062382_10393249 | Not Available | 651 | Open in IMG/M |
3300005327|Ga0070658_10651509 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 914 | Open in IMG/M |
3300005335|Ga0070666_10423992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 958 | Open in IMG/M |
3300005336|Ga0070680_101770029 | Not Available | 535 | Open in IMG/M |
3300005365|Ga0070688_100545585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 881 | Open in IMG/M |
3300005436|Ga0070713_102181968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 537 | Open in IMG/M |
3300005439|Ga0070711_100240413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 1416 | Open in IMG/M |
3300005456|Ga0070678_100478363 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1095 | Open in IMG/M |
3300005458|Ga0070681_11966187 | Not Available | 512 | Open in IMG/M |
3300005530|Ga0070679_100396219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 1327 | Open in IMG/M |
3300005538|Ga0070731_10315716 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1038 | Open in IMG/M |
3300005555|Ga0066692_10893323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 545 | Open in IMG/M |
3300005575|Ga0066702_10037210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 2540 | Open in IMG/M |
3300005618|Ga0068864_100945278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 853 | Open in IMG/M |
3300005840|Ga0068870_10048774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2231 | Open in IMG/M |
3300006041|Ga0075023_100063552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1192 | Open in IMG/M |
3300006055|Ga0097691_1047351 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1519 | Open in IMG/M |
3300006057|Ga0075026_100127206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1289 | Open in IMG/M |
3300006172|Ga0075018_10644215 | Not Available | 568 | Open in IMG/M |
3300006354|Ga0075021_10069016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2065 | Open in IMG/M |
3300006354|Ga0075021_10666932 | Not Available | 667 | Open in IMG/M |
3300006604|Ga0074060_11976120 | Not Available | 802 | Open in IMG/M |
3300006606|Ga0074062_12966250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 826 | Open in IMG/M |
3300006638|Ga0075522_10004480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069 | 9944 | Open in IMG/M |
3300006642|Ga0075521_10550866 | Not Available | 567 | Open in IMG/M |
3300006642|Ga0075521_10624876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 531 | Open in IMG/M |
3300006795|Ga0075520_1184456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 893 | Open in IMG/M |
3300006796|Ga0066665_10593675 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 892 | Open in IMG/M |
3300006796|Ga0066665_10845690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 716 | Open in IMG/M |
3300006893|Ga0073928_10127640 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2085 | Open in IMG/M |
3300006894|Ga0079215_11240435 | Not Available | 571 | Open in IMG/M |
3300009029|Ga0066793_10671954 | Not Available | 589 | Open in IMG/M |
3300009174|Ga0105241_10698272 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 926 | Open in IMG/M |
3300009500|Ga0116229_10474135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1038 | Open in IMG/M |
3300009500|Ga0116229_10567584 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 935 | Open in IMG/M |
3300009651|Ga0105859_1038028 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1217 | Open in IMG/M |
3300009660|Ga0105854_1181400 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 692 | Open in IMG/M |
3300009662|Ga0105856_1158582 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 693 | Open in IMG/M |
3300009792|Ga0126374_11301214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium valentinum | 587 | Open in IMG/M |
3300010326|Ga0134065_10286663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium valentinum | 626 | Open in IMG/M |
3300010861|Ga0126349_1290422 | Not Available | 582 | Open in IMG/M |
3300011269|Ga0137392_10361269 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1203 | Open in IMG/M |
3300012074|Ga0154001_1035203 | Not Available | 761 | Open in IMG/M |
3300012201|Ga0137365_10942549 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 628 | Open in IMG/M |
3300012202|Ga0137363_10818960 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 790 | Open in IMG/M |
3300012353|Ga0137367_11226177 | Not Available | 500 | Open in IMG/M |
3300012582|Ga0137358_10207353 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1337 | Open in IMG/M |
3300012898|Ga0157293_10100682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium valentinum | 744 | Open in IMG/M |
3300012900|Ga0157292_10177292 | Not Available | 698 | Open in IMG/M |
3300012909|Ga0157290_10285346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium valentinum | 602 | Open in IMG/M |
3300012925|Ga0137419_11162514 | Not Available | 645 | Open in IMG/M |
3300012977|Ga0134087_10509828 | Not Available | 607 | Open in IMG/M |
3300012986|Ga0164304_11149222 | Not Available | 624 | Open in IMG/M |
3300012987|Ga0164307_10746723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium valentinum | 772 | Open in IMG/M |
3300013503|Ga0120127_10013234 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1389 | Open in IMG/M |
3300014201|Ga0181537_10815098 | Not Available | 633 | Open in IMG/M |
3300014492|Ga0182013_10042257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3595 | Open in IMG/M |
3300015077|Ga0173483_10533889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium valentinum | 632 | Open in IMG/M |
3300017947|Ga0187785_10725951 | Not Available | 523 | Open in IMG/M |
3300018054|Ga0184621_10109774 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 981 | Open in IMG/M |
3300018066|Ga0184617_1114572 | Not Available | 765 | Open in IMG/M |
3300018920|Ga0190273_12098638 | Not Available | 527 | Open in IMG/M |
3300019377|Ga0190264_11964050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium valentinum | 534 | Open in IMG/M |
3300020069|Ga0197907_10764132 | Not Available | 519 | Open in IMG/M |
3300020580|Ga0210403_11303939 | Not Available | 554 | Open in IMG/M |
3300020580|Ga0210403_11353089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium valentinum | 541 | Open in IMG/M |
3300021477|Ga0210398_10369771 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1169 | Open in IMG/M |
3300021478|Ga0210402_11269858 | Not Available | 663 | Open in IMG/M |
3300022911|Ga0247783_1132813 | Not Available | 693 | Open in IMG/M |
3300023272|Ga0247760_1187079 | Not Available | 533 | Open in IMG/M |
3300025916|Ga0207663_10172987 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1536 | Open in IMG/M |
3300025939|Ga0207665_11416808 | Not Available | 553 | Open in IMG/M |
3300026220|Ga0209855_1075920 | Not Available | 567 | Open in IMG/M |
3300026494|Ga0257159_1001705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2914 | Open in IMG/M |
3300026498|Ga0257156_1089566 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 639 | Open in IMG/M |
3300026527|Ga0209059_1222852 | Not Available | 633 | Open in IMG/M |
3300026551|Ga0209648_10104617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2312 | Open in IMG/M |
3300027105|Ga0207944_1003434 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1397 | Open in IMG/M |
3300027505|Ga0209218_1031681 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1031 | Open in IMG/M |
3300027528|Ga0208985_1029481 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1067 | Open in IMG/M |
3300027616|Ga0209106_1122796 | Not Available | 582 | Open in IMG/M |
3300027635|Ga0209625_1094810 | Not Available | 669 | Open in IMG/M |
3300027678|Ga0209011_1206142 | Not Available | 534 | Open in IMG/M |
3300027783|Ga0209448_10099891 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 972 | Open in IMG/M |
3300027817|Ga0209112_10087780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 993 | Open in IMG/M |
3300027862|Ga0209701_10060295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2418 | Open in IMG/M |
3300027894|Ga0209068_10109916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1463 | Open in IMG/M |
3300028733|Ga0302261_1151200 | Not Available | 553 | Open in IMG/M |
3300028747|Ga0302219_10445318 | Not Available | 508 | Open in IMG/M |
3300028874|Ga0302155_10212325 | Not Available | 843 | Open in IMG/M |
3300029636|Ga0222749_10707368 | Not Available | 551 | Open in IMG/M |
3300029944|Ga0311352_11391353 | Not Available | 528 | Open in IMG/M |
3300030580|Ga0311355_10121377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069 | 2863 | Open in IMG/M |
3300031726|Ga0302321_103064148 | Not Available | 545 | Open in IMG/M |
3300031795|Ga0318557_10334925 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 695 | Open in IMG/M |
3300032068|Ga0318553_10749923 | Not Available | 511 | Open in IMG/M |
3300033513|Ga0316628_103944274 | Not Available | 531 | Open in IMG/M |
3300034268|Ga0372943_0573171 | Not Available | 740 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 11.21% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.35% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.48% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.54% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 5.61% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 5.61% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.67% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 3.74% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.74% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.80% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.80% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.80% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.80% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.87% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.87% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.87% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 1.87% |
Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 1.87% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.93% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.93% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.93% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.93% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.93% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.93% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.93% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.93% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.93% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.93% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.93% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.93% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.93% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.93% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.93% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.93% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.93% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.93% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.93% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.93% |
Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.93% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.93% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908009 | Soil microbial communities from sample at FACE Site Metagenome WIR_Amb2 | Environmental | Open in IMG/M |
3300001081 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 | Environmental | Open in IMG/M |
3300001137 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 | Environmental | Open in IMG/M |
3300001160 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 | Environmental | Open in IMG/M |
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300002886 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm | Environmental | Open in IMG/M |
3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
3300003369 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 002-22A | Environmental | Open in IMG/M |
3300004782 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh | Environmental | Open in IMG/M |
3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
3300006055 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 | Environmental | Open in IMG/M |
3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006604 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
3300006795 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009500 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
3300009651 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-063 | Environmental | Open in IMG/M |
3300009660 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-058 | Environmental | Open in IMG/M |
3300009662 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060 | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010861 | Boreal forest soil eukaryotic communities from Alaska, USA - C4-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300012074 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ085 MetaG | Host-Associated | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
3300012900 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1 | Environmental | Open in IMG/M |
3300012909 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1 | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300013503 | Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M | Environmental | Open in IMG/M |
3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300022911 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L064-202C-5 | Environmental | Open in IMG/M |
3300023272 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L171-409R-4 | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026220 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-063 (SPAdes) | Environmental | Open in IMG/M |
3300026494 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-A | Environmental | Open in IMG/M |
3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300027105 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF018 (SPAdes) | Environmental | Open in IMG/M |
3300027505 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027528 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027817 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028733 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E2_4 | Environmental | Open in IMG/M |
3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
3300028874 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_1 | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FWIRA_03043020 | 2124908009 | Soil | RSERDPDGARRRAELPLRVVASLPWIMVGNTVWRIKRRPV |
JGI12662J13196_10072661 | 3300001081 | Forest Soil | DGPPDSGVRGRPKRNPGRHAERDPVGAIRRAELSLRVGAIVPWIMVGNTVWRIKRRPV* |
JGI12637J13337_10262791 | 3300001137 | Forest Soil | VRGRPKRNLRRRSEPDPDKARRRAELALRVGAILPWIMVGNTVWRIKRRPV* |
JGI12654J13325_10030043 | 3300001160 | Forest Soil | VRGRPKRNPGRHAERDPVGAIRRAELSLRVGAIVPWIMVGNTVWRIKRRPV* |
JGI12053J15887_103666201 | 3300001661 | Forest Soil | GEAKRRAELSLRIGVDLPWIMLGNTFWRIKRRPV* |
JGI12053J15887_105170062 | 3300001661 | Forest Soil | VRGRPKRNPGRRAERDRNGAKRRAELSLRIGAVLPWIMVGNTVWRIKRRPV* |
JGI25612J43240_10844552 | 3300002886 | Grasslands Soil | VRGRPKRNPGRRAERDPGEAKRRAELSLRIGAILNRIMVGNTVWRIKRRPV* |
JGI25617J43924_103101342 | 3300002914 | Grasslands Soil | VRGRPKRNPGRHAERDPVGAKRRAELSLRVGAVVPWIMVGNTVWRIKRRPV* |
JGI24140J50213_102747692 | 3300003369 | Arctic Peat Soil | DGPPDSGVRGRPKRNPGRRAERDPLGAKRRVELSLRVGAVVPWIMVGNTVWRIKRRPV* |
Ga0062382_103932492 | 3300004782 | Wetland Sediment | PGRRSERDPWGAKRRVELSPRVGAVVPWIMVGNTVWRIKRRPV* |
Ga0070658_106515093 | 3300005327 | Corn Rhizosphere | PGRVSGVRGRPKRDPERRTEHIPRRAKRRAELSLRIGAVPWWIMVGNTVWRIKRRPV* |
Ga0070666_104239921 | 3300005335 | Switchgrass Rhizosphere | VRGRPKRKPWRRAERGPTGTERRAKLSLRIGAIVSWVLVGNTVWRIKRRPV |
Ga0070680_1017700292 | 3300005336 | Corn Rhizosphere | VRGRPKRNPGRHAERDPVGAKRRAKLSLRVGAVPWIMVGNTVWRIKRRPV* |
Ga0070688_1005455852 | 3300005365 | Switchgrass Rhizosphere | VRGRPKRNPGRPCDRDPVAGRRPKLSLRIGAILAWVLVGISVWRIK |
Ga0070713_1021819682 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VRGRPKRNPGRHAERNPVGAIRRAELSLRVGAVVPWIMVGNTVWRIKRRPV* |
Ga0070711_1002404132 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VRGRPKRNPGRLAEPDDREGTRRAELSFRAAADTSRVLVGNTVWRIKRRPVWNTMATA |
Ga0070678_1004783633 | 3300005456 | Miscanthus Rhizosphere | VRGRPKRKPWRRAERGPTGAIRRAKLSLRFVAVAPLILVGNTVWRIKRRPV* |
Ga0070681_119661872 | 3300005458 | Corn Rhizosphere | RDGPPDSGVRGRPKRNPGRHAERDPVGAKRRAKLSLRVGAVPWIMVGNTVWRIKRRPV* |
Ga0070679_1003962192 | 3300005530 | Corn Rhizosphere | VRGRPKRNPGRPAERCAGTTRRRTELALRVGVIVAWLMVGNTVWRIKRRPV* |
Ga0070731_103157161 | 3300005538 | Surface Soil | VRGRPKRNPRRRAERYPVEAQRRAKLALSFGVLFPLVVGNTVWRIKSRPV* |
Ga0066692_108933231 | 3300005555 | Soil | VRGRPKRNPERRSERDPDEAKRRAKLPLRVGAILPWIMVGNTVWRIKRRPV* |
Ga0066702_100372103 | 3300005575 | Soil | SERDRCGAKRRAELSLRIGAVLRGIFVGITVWRIKRRPV* |
Ga0068864_1009452782 | 3300005618 | Switchgrass Rhizosphere | VKGRPKRNPERRSERDPDRAKRRAELPPRVGAILPWIMVGNTVWRIKRRPV* |
Ga0068870_100487743 | 3300005840 | Miscanthus Rhizosphere | TPGRRAERDPVGAKRRAELSLRGGAILPGIKVGNSVWRIKRRPV* |
Ga0075023_1000635522 | 3300006041 | Watersheds | VRGRPKRNPRRRAERDPGGAIRRAELSLPVGAILPWIIVGNTVWRIKRRPV* |
Ga0097691_10473512 | 3300006055 | Arctic Peat Soil | PGRRAERDPRRAKRRAELSLRVGAILPWILVGNTVWRIKRRPV* |
Ga0075026_1001272062 | 3300006057 | Watersheds | VRGRPKRNLQRLAERDPVDAIRRAEFSLRVGAIISWIMVGNTVWRIKRRPV* |
Ga0075018_106442151 | 3300006172 | Watersheds | KRNPGRRAERDRGAKHRGELSLRLGAVLTRITVGNTVWRIKRRPV* |
Ga0075021_100690162 | 3300006354 | Watersheds | VRGRPKRNLLRLAERDPVDAMRRAKFSLRVGAIISWIMVGNTVWRIKRRPV* |
Ga0075021_106669321 | 3300006354 | Watersheds | SGVRGRPKRNRERLADPDPQAARRRAEHWLRVGSLLPWIMVGITVWRIKRRPV* |
Ga0074060_119761202 | 3300006604 | Soil | VRGRPKRNPGRHAERDPLGAKRRAELSLRVGAVVPWIMVGNTVWRIKRRPV* |
Ga0074062_129662502 | 3300006606 | Soil | VRGRPKRKPWRRAERGSARAIRRVKLSLRSVAVVPRILIGNTVWRIKRRPV* |
Ga0075522_100044807 | 3300006638 | Arctic Peat Soil | MIRTEQWRVELSLRSVAVLPWILVGNTVWRIKRRPV* |
Ga0075521_105508661 | 3300006642 | Arctic Peat Soil | VRGRPKRNPGRLAERDPLGAKRRVELSLRVGAVVPWIMVGNTVWRIKRRPV* |
Ga0075521_106248761 | 3300006642 | Arctic Peat Soil | VRGRPKRNPGRRAERDPLGAKRRVELSLRIGAVVPWIMVGNTVWRIKRRPV* |
Ga0075520_11844561 | 3300006795 | Arctic Peat Soil | VRGRPKRNPGRRAERDPGGAKRRAELSLRVGAIFPWIMVGNT |
Ga0066665_105936752 | 3300006796 | Soil | VRGRPKRNPERRSERDPDEAKRRAKLPLRVRAILPWIMVGNTVWRIKRRPV* |
Ga0066665_108456902 | 3300006796 | Soil | VRGRPKRNPARRAERDRGAKQRVELSLRIGAILTRIMVGNTVWRIKRRPV* |
Ga0073928_101276403 | 3300006893 | Iron-Sulfur Acid Spring | GRRAERDLGGAKRRAELSLRVGAVVPWIIVDNTVWRIKRRPV* |
Ga0079215_112404351 | 3300006894 | Agricultural Soil | PGRRAERDPVGAKRRAELSLRGGAILPGILVGNTVWRIKRRPV* |
Ga0066793_106719541 | 3300009029 | Prmafrost Soil | PGRPAERNPGAKRRAELSLRFGAILPKIVGNTVWRIKRRPV* |
Ga0105241_106982721 | 3300009174 | Corn Rhizosphere | NPGRRAERDPATRRRAELSLRVGAIVAGILVGISVWRIKRRPV* |
Ga0116229_104741351 | 3300009500 | Host-Associated | VRGRPKRNHGRRAERDPVETERRAKLSLRIGGFIPWIVVGNTVWR |
Ga0116229_105675842 | 3300009500 | Host-Associated | RNHGRRAERDPVGTERRAELSLRIGAFIPWIVIGNTVWRIKRRPV* |
Ga0105859_10380281 | 3300009651 | Permafrost Soil | RNPGRRAERDPGAKHRAELSLRLGAVLTRITVGNTVWRIKRRPV* |
Ga0105854_11814001 | 3300009660 | Permafrost Soil | RDPLEAKRRVELSLRVGAVVSWIMVGNTVWRIKRRPV* |
Ga0105856_11585821 | 3300009662 | Permafrost Soil | SGVRGRPKRNPRRPAERDSGAALRRAELPLRVGAILSGITVGNTVWRIKRRPV* |
Ga0126374_113012142 | 3300009792 | Tropical Forest Soil | HAEWGLTGAMRRAMLSLRVGAIVPWILVGNTVWRIKRRPV* |
Ga0134065_102866631 | 3300010326 | Grasslands Soil | RRAERGPAGTRRRAKLSLRVGAIVPWILVGNTVWRIKRRPV* |
Ga0126349_12904221 | 3300010861 | Boreal Forest Soil | MDAKRRAELSLRIDAILPWIMVGNTVWRIKRRPVWNTLAAK |
Ga0137392_103612692 | 3300011269 | Vadose Zone Soil | PPDSGVRGRPKRNPGRHAERDPVGAKRRAELWLRVGAVVPWIMVGNTVWRIKRRPV* |
Ga0154001_10352031 | 3300012074 | Attine Ant Fungus Gardens | RGPAGAIRRAKLSLRIVAVVPRILVGNTVWRIKRRPV* |
Ga0137365_109425491 | 3300012201 | Vadose Zone Soil | SERDPDGAKRRAELPLRVGASLPWIMVGNTVWRIKRRPV* |
Ga0137363_108189601 | 3300012202 | Vadose Zone Soil | RNPERRSERDPDGAKRRAELPLRVVASLPWIMVGNTVWRIKRRPV* |
Ga0137367_112261771 | 3300012353 | Vadose Zone Soil | RDPGGATRRAELSTRFGVIIPWTMVGNTVWRIKRRPV* |
Ga0137358_102073531 | 3300012582 | Vadose Zone Soil | RDGPPDSGVRGRPKRNPERRSERDPDGARRRAELPLRLGAILPWIMVGNTVWRIKRRPV* |
Ga0157293_101006821 | 3300012898 | Soil | ERGATGTRRRAKLSLRVGAIVPWILVGNTVWRIKRRPV* |
Ga0157292_101772921 | 3300012900 | Soil | AERDPVGAKRRAKLSLRGGATLPWIMVGNTVWRIERRPV* |
Ga0157290_102853461 | 3300012909 | Soil | TTKARRRAKLSPRVGAIVPWILVGNTVWRIKRRPV* |
Ga0137419_111625141 | 3300012925 | Vadose Zone Soil | RDGPPDSGVRGRPKRNPGRRAERNREEAMRIGAMVPVIGVGNTVWRIKRRPV* |
Ga0134087_105098281 | 3300012977 | Grasslands Soil | RPKRNLERRSERDPDEAKRRAKLPLRVGAILPWIMVGNTVWRIKRRPV* |
Ga0164304_111492221 | 3300012986 | Soil | VKGRPKRNPERRSERDPDRAKRRTELPLRVGAILPWIMVGNTVWRIKRRPV* |
Ga0164307_107467231 | 3300012987 | Soil | LERRAEPLPTGTRRRAKLSPRVVAIVWGNLVGNTVWRIKRRPV* |
Ga0120127_100132342 | 3300013503 | Permafrost | RNPGRPAERDLTDAKRRAELSLRVGAILPWIWIGNTVWRIKRRPV* |
Ga0181537_108150982 | 3300014201 | Bog | PKRNMERRSERDAGEAERRAELSLRVGAVLPWILVGNTVWRIKRRPV* |
Ga0182013_100422573 | 3300014492 | Bog | GRPAERDPGAKRRAELSLRFGAILPKIVGNTVWRIKRRPV* |
Ga0173483_105338891 | 3300015077 | Soil | PKRNSWRRADRGPTGAVRRAKLSHRVGAIVPWILVGNTVWRIKRRPV* |
Ga0187785_107259511 | 3300017947 | Tropical Peatland | DFREEQRRVRIAARNGAILPGFVGNTVWRIKRRPV |
Ga0184621_101097741 | 3300018054 | Groundwater Sediment | DPDGAKRRAELPLRVGASLPWIMVGNKVWRIKRRPV |
Ga0184617_11145721 | 3300018066 | Groundwater Sediment | KRNPGRRAERDPGGANRRAELSPRIGAIVPWTMVGNTVWRIKRRPV |
Ga0190273_120986382 | 3300018920 | Soil | RRAERDPVEATRRAELSLRVGAIVSWIKVGNTVWRIKRRPV |
Ga0190264_119640501 | 3300019377 | Soil | RDPVGAKRRAELSLRGGAILPWIMIGNTVWRIKRRPV |
Ga0197907_107641321 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | GKPKRNLGRPAEHDSRRTKRRAELLLRSGAVLPSILIGNTVWRIKRRPV |
Ga0210403_113039391 | 3300020580 | Soil | PKRDPERRSERDPDGARRRAELPLRVVASLPWIMVGNTVWRIKRRPV |
Ga0210403_113530891 | 3300020580 | Soil | KRNPGRRSERDPCGAKRRAELSLRVGAILPWILIGNTVWRIKRRPV |
Ga0210398_103697711 | 3300021477 | Soil | AERYPADAKRRAELSFRVAAILPWIMIGNIVWRIKRRPV |
Ga0210402_112698581 | 3300021478 | Soil | GFRGRPKRNPGAADPVARRRAEVLLRVGAIFSGIMVGNTVWRIKRRPV |
Ga0247783_11328131 | 3300022911 | Plant Litter | PRRRAERDPVGAKRRAELSLRGGAILPWIMVGNTVWRIERRPV |
Ga0247760_11870791 | 3300023272 | Plant Litter | EREPRVGRRAKLVLRIGAFWVSVGITVWRIKRRPV |
Ga0207663_101729872 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | LMDAKRRAEISLRVGAILPWIMVGNTVWRIKRRPV |
Ga0207665_114168081 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | ERDPGRAKRRAELSLRIGAALPWIMVGNNSVWRIKRRPV |
Ga0209855_10759201 | 3300026220 | Permafrost Soil | DPGAKHRAELSLRLGAVLTRITVGNTVWRIKRRPV |
Ga0257159_10017053 | 3300026494 | Soil | PDSGVRGRPKRNPGRRAERDPGAKHRAELSLRLGAVLTRITVGNTVWRIKRRPV |
Ga0257156_10895661 | 3300026498 | Soil | PDGAKRRAELPLRVVASLPWIMVGNTVWRIKRRPV |
Ga0209059_12228522 | 3300026527 | Soil | PSERDRCGAKRRAELSLRIGAVLRGIFVGITVWRIKRRPV |
Ga0209648_101046171 | 3300026551 | Grasslands Soil | DSGVRGRPKRNPGRRAERDPGAKRRAELSLRLGAVLTRIMVGNTVWRIKRRPV |
Ga0207944_10034341 | 3300027105 | Forest Soil | RDPVEAKRRAQFSLCVGAILRWIMVGNTVWRIKRRPV |
Ga0209218_10316812 | 3300027505 | Forest Soil | PGEAQRRAELSLRVGAVLPWILVGNTVWRIKRRPV |
Ga0208985_10294812 | 3300027528 | Forest Soil | NTGRRSERDAGEVARRAELSLRVGAVLPWIVVGNTVWRIKRRPV |
Ga0209106_11227961 | 3300027616 | Forest Soil | LAEREPGAKRRAELLLRIGAVVPQVMVGNTVWRIKRRPV |
Ga0209625_10948101 | 3300027635 | Forest Soil | ERDPVEAKRRAEFSLCVGAILPWIMVGNTVWRIKRRPV |
Ga0209011_12061421 | 3300027678 | Forest Soil | KRNPGRHAERDPLGAKRRAELSLRVGAVLPWIMVGNTVWRIKRRPV |
Ga0209448_100998911 | 3300027783 | Bog Forest Soil | DGPPDSGVRGRPKRNPGRLADRDPTDAKRRAEFSLRVGAILPRIMIGNTVWRIKRRPV |
Ga0209112_100877801 | 3300027817 | Forest Soil | GVRGRPKRNPGRRAERDLGEAKRRAELSLRVGAVVSWIIVGNTVWRIKRRPV |
Ga0209701_100602951 | 3300027862 | Vadose Zone Soil | NPERRSERDPDGAKPSAELPLRVGASLPWIMVGNTVWRIKRRPV |
Ga0209068_101099162 | 3300027894 | Watersheds | VRGRPKRNLLRLAERDPVDAMRRAKFSLRVGAIISWIMVGNTVWRIKRRPV |
Ga0302261_11512001 | 3300028733 | Fen | VRGRPKRNPGRRAERDPGEAKRRAELSLRIGAILNRIMVGNTVWRIKRRPV |
Ga0302219_104453181 | 3300028747 | Palsa | NPGANRRAELSLRVGAFLPWIIVGNTVWRIKRRPV |
Ga0302155_102123252 | 3300028874 | Bog | RNPGGAKRRAELSLRVGAVLPWIMVGNTVWRIKRRPV |
Ga0222749_107073681 | 3300029636 | Soil | KRNPGRPAERDSVGARRRAKLSLRVGAILPWIMVGFTVWRIKRRPV |
Ga0311352_113913531 | 3300029944 | Palsa | DSGVRGRPKRNPGRPAERDPIGASRAELSLRVGAVPWIMVGNTVWRIKRRPV |
Ga0311355_101213771 | 3300030580 | Palsa | RDLGGTRRRAELSLRVGAVLPWIIVGNTVWRIKRRPV |
Ga0302321_1030641481 | 3300031726 | Fen | EPDPCGARRRAELSLRIGAVIPWILVGNTVWRIKRRPV |
Ga0318557_103349251 | 3300031795 | Soil | PEPEADEATRRAEVSLRGDANCPSDLVGTVWRIKRRPV |
Ga0318553_107499231 | 3300032068 | Soil | PGDTKRRAERRLRIGAVFPGILVDNTVWRIKRRPV |
Ga0316628_1039442741 | 3300033513 | Soil | PMDEKRRAELSLRIGAFLPWILVGNTVWRIKRRPV |
Ga0372943_0573171_632_739 | 3300034268 | Soil | EPATRRRAELSLRVGAILGWVLVGISVWRIKRRPV |
⦗Top⦘ |