NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F092626

Metagenome / Metatranscriptome Family F092626

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F092626
Family Type Metagenome / Metatranscriptome
Number of Sequences 107
Average Sequence Length 47 residues
Representative Sequence TEEDLDWFVSALEETVARAEKMPRALVRFVLQAARAGRTPRRRLARA
Number of Associated Samples 93
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 92.52 %
Associated GOLD sequencing projects 90
AlphaFold2 3D model prediction Yes
3D model pTM-score0.48

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (90.654 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(25.234 % of family members)
Environment Ontology (ENVO) Unclassified
(34.579 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(52.336 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 42.67%    β-sheet: 0.00%    Coil/Unstructured: 57.33%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.48
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF01061ABC2_membrane 26.17
PF02412TSP_3 5.61
PF01243Putative_PNPOx 5.61
PF07883Cupin_2 2.80
PF00005ABC_tran 2.80
PF00294PfkB 1.87
PF13304AAA_21 1.87
PF13340DUF4096 0.93
PF07992Pyr_redox_2 0.93
PF09985Glucodextran_C 0.93
PF13669Glyoxalase_4 0.93
PF12698ABC2_membrane_3 0.93
PF13683rve_3 0.93
PF00300His_Phos_1 0.93



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms90.65 %
UnclassifiedrootN/A9.35 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000956|JGI10216J12902_106701350All Organisms → cellular organisms → Bacteria1744Open in IMG/M
3300000956|JGI10216J12902_109833765All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium733Open in IMG/M
3300000956|JGI10216J12902_118652007All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium678Open in IMG/M
3300002568|C688J35102_119376356All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium683Open in IMG/M
3300003321|soilH1_10143524All Organisms → cellular organisms → Bacteria1715Open in IMG/M
3300004156|Ga0062589_100956047All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium795Open in IMG/M
3300004479|Ga0062595_100069347All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1722Open in IMG/M
3300004479|Ga0062595_101065248Not Available702Open in IMG/M
3300004643|Ga0062591_100445498All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1090Open in IMG/M
3300005164|Ga0066815_10055883All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300005177|Ga0066690_10290510All Organisms → cellular organisms → Bacteria → Proteobacteria1103Open in IMG/M
3300005181|Ga0066678_10994127All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300005343|Ga0070687_100100018All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1622Open in IMG/M
3300005356|Ga0070674_101006105All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium732Open in IMG/M
3300005435|Ga0070714_101005446All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium811Open in IMG/M
3300005441|Ga0070700_101306788All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium610Open in IMG/M
3300005456|Ga0070678_100026127All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3942Open in IMG/M
3300005456|Ga0070678_100199115All Organisms → cellular organisms → Bacteria1652Open in IMG/M
3300005544|Ga0070686_100110124All Organisms → cellular organisms → Bacteria1875Open in IMG/M
3300005614|Ga0068856_102504855All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium523Open in IMG/M
3300005843|Ga0068860_102104063All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium586Open in IMG/M
3300006031|Ga0066651_10101785All Organisms → cellular organisms → Bacteria1448Open in IMG/M
3300006173|Ga0070716_100156300All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1473Open in IMG/M
3300006237|Ga0097621_101910294All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium566Open in IMG/M
3300006806|Ga0079220_10075893All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1671Open in IMG/M
3300006903|Ga0075426_11355365All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium540Open in IMG/M
3300009098|Ga0105245_10036992All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4338Open in IMG/M
3300009137|Ga0066709_102773120All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300009137|Ga0066709_104134820All Organisms → cellular organisms → Bacteria → Terrabacteria group528Open in IMG/M
3300009156|Ga0111538_10339830All Organisms → cellular organisms → Bacteria1901Open in IMG/M
3300009174|Ga0105241_10279565All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1425Open in IMG/M
3300009553|Ga0105249_12753669All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium563Open in IMG/M
3300009553|Ga0105249_13559307All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium502Open in IMG/M
3300010145|Ga0126321_1347771All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium683Open in IMG/M
3300010326|Ga0134065_10126905All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium871Open in IMG/M
3300010366|Ga0126379_10950637All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium963Open in IMG/M
3300010403|Ga0134123_11131899All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium808Open in IMG/M
3300012200|Ga0137382_10935549Not Available624Open in IMG/M
3300012208|Ga0137376_11629093Not Available536Open in IMG/M
3300012211|Ga0137377_11710122All Organisms → cellular organisms → Bacteria → Terrabacteria group550Open in IMG/M
3300012350|Ga0137372_10146506All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1932Open in IMG/M
3300012356|Ga0137371_10215415All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1502Open in IMG/M
3300012356|Ga0137371_10576566Not Available865Open in IMG/M
3300012469|Ga0150984_104220277All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium531Open in IMG/M
3300012492|Ga0157335_1004590All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium936Open in IMG/M
3300012985|Ga0164308_10610787All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium929Open in IMG/M
3300012985|Ga0164308_11426320Not Available633Open in IMG/M
3300012987|Ga0164307_11470972All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium575Open in IMG/M
3300013308|Ga0157375_11896688All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium707Open in IMG/M
3300014969|Ga0157376_11096292All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium822Open in IMG/M
3300015356|Ga0134073_10436250All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium501Open in IMG/M
3300015374|Ga0132255_100787170All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1417Open in IMG/M
3300015374|Ga0132255_104121633All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium617Open in IMG/M
3300018051|Ga0184620_10306652All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium536Open in IMG/M
3300018089|Ga0187774_10978206All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300019885|Ga0193747_1005287All Organisms → cellular organisms → Bacteria3133Open in IMG/M
3300019887|Ga0193729_1170330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium770Open in IMG/M
3300021078|Ga0210381_10213401All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium677Open in IMG/M
3300022756|Ga0222622_10715368All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium728Open in IMG/M
3300023057|Ga0247797_1004528All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1490Open in IMG/M
3300024177|Ga0247686_1016989All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium806Open in IMG/M
3300024251|Ga0247679_1030778All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium905Open in IMG/M
3300024317|Ga0247660_1048445All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium700Open in IMG/M
3300025898|Ga0207692_10533336All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium748Open in IMG/M
3300025912|Ga0207707_11575371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium518Open in IMG/M
3300025917|Ga0207660_10341323All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1199Open in IMG/M
3300025927|Ga0207687_10899001All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium758Open in IMG/M
3300025932|Ga0207690_10651120All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium863Open in IMG/M
3300025935|Ga0207709_11406912Not Available578Open in IMG/M
3300025942|Ga0207689_10977670All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium714Open in IMG/M
3300025945|Ga0207679_11700792Not Available577Open in IMG/M
3300025961|Ga0207712_10731261All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium866Open in IMG/M
3300025961|Ga0207712_11337747All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium640Open in IMG/M
3300026023|Ga0207677_10187831All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1632Open in IMG/M
3300026300|Ga0209027_1257502All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium560Open in IMG/M
3300026325|Ga0209152_10091483All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1135Open in IMG/M
3300026343|Ga0209159_1092323All Organisms → cellular organisms → Bacteria → Terrabacteria group1334Open in IMG/M
3300028145|Ga0247663_1006188All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1582Open in IMG/M
3300028381|Ga0268264_12382677All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium535Open in IMG/M
3300028596|Ga0247821_11034285All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium552Open in IMG/M
3300028705|Ga0307276_10039348All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1014Open in IMG/M
3300028715|Ga0307313_10258195All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium542Open in IMG/M
3300028717|Ga0307298_10014732All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1985Open in IMG/M
3300028722|Ga0307319_10239134Not Available597Open in IMG/M
3300028744|Ga0307318_10247821All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium620Open in IMG/M
3300028768|Ga0307280_10014544All Organisms → cellular organisms → Bacteria2192Open in IMG/M
3300028768|Ga0307280_10354585Not Available542Open in IMG/M
3300028782|Ga0307306_10089584All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium809Open in IMG/M
3300028784|Ga0307282_10064656All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1654Open in IMG/M
3300028787|Ga0307323_10087457All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1113Open in IMG/M
3300028793|Ga0307299_10196686All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium758Open in IMG/M
3300028793|Ga0307299_10314922All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium587Open in IMG/M
3300028807|Ga0307305_10163638All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1026Open in IMG/M
3300028807|Ga0307305_10261350All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium790Open in IMG/M
3300028814|Ga0307302_10027338All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2610Open in IMG/M
3300028819|Ga0307296_10664543Not Available570Open in IMG/M
3300028876|Ga0307286_10013249All Organisms → cellular organisms → Bacteria2579Open in IMG/M
3300028876|Ga0307286_10172613All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium779Open in IMG/M
3300028880|Ga0307300_10077856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium975Open in IMG/M
3300028881|Ga0307277_10274058All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium746Open in IMG/M
3300028884|Ga0307308_10618344All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300028885|Ga0307304_10269278All Organisms → cellular organisms → Bacteria746Open in IMG/M
3300031995|Ga0307409_100101962All Organisms → cellular organisms → Bacteria2383Open in IMG/M
3300032180|Ga0307471_101918007All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium741Open in IMG/M
3300032770|Ga0335085_10171437All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2693Open in IMG/M
3300032782|Ga0335082_10856111All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium771Open in IMG/M
3300033004|Ga0335084_11752323All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium609Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil25.23%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.48%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.74%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere3.74%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.80%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.80%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.80%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.80%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.87%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.87%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.87%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.87%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere1.87%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.87%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.87%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.93%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.93%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.93%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.93%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.93%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.93%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.93%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.93%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.93%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.93%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.93%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.93%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.93%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.93%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.93%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.93%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300003321Sugarcane bulk soil Sample H1EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005164Soil and rhizosphere microbial communities from Laval, Canada - mgLACEnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010145Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012492Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610Host-AssociatedOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015356Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300019885Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2EnvironmentalOpen in IMG/M
3300019887Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2EnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300023057Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S136-409B-6EnvironmentalOpen in IMG/M
3300024177Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK27EnvironmentalOpen in IMG/M
3300024251Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20EnvironmentalOpen in IMG/M
3300024317Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK01EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026300Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300026343Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes)EnvironmentalOpen in IMG/M
3300028145Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028596Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14EnvironmentalOpen in IMG/M
3300028705Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115EnvironmentalOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028717Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158EnvironmentalOpen in IMG/M
3300028722Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368EnvironmentalOpen in IMG/M
3300028744Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028782Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300028880Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10216J12902_10670135013300000956SoilVVTEEDLEWFVAALEQTVARAEKMPRALVRFALTAARAGRPSRLRPVRA*
JGI10216J12902_10983376533300000956SoilEDLEWFASALDETVARAEKMPRALVRFAVGAARAGRTPRRKLARA*
JGI10216J12902_11865200713300000956SoilLVVTEDDLDWFVSALEDTVARAEKMPRALVRFAVQAARSGRAPRPRRRLVRA*
C688J35102_11937635613300002568SoilDEDDLDWFVTALDETVSRAEKMPRALVRFALHAARAGRTPRKRLARA*
soilH1_1014352443300003321Sugarcane Root And Bulk SoilHGLNVIKAIPPLVITEDDLEQFSGALDETVARAEKMPRALVRFALGAARAGRTPRRRPLARA*
Ga0062589_10095604733300004156SoilLEWFASALDETVARAEKMPRALVRFAVGAARAGRTPRRKLARA*
Ga0062595_10006934713300004479SoilLVVTEEDVDWFGSALEDTIARAEKMPRALVRFALRAASGRPRSAPRRASRLARAR*
Ga0062595_10106524823300004479SoilTEEDVDWFVSALEETITSAEKMPRALVRFALQAARAGRTPKRRLARA*
Ga0062591_10044549813300004643SoilTEDDLDWFVTALEETISKAEHMPRALVRFALGAARAGRGPRRRLVRA*
Ga0066815_1005588323300005164SoilVVTEDDIEWLVAGLDDTIARAEKMPRALVRFGLTAARAGRTKRPRLARA*
Ga0066690_1029051033300005177SoilIPPLVVIEEDVDWFVSALEETITRAEKMPRALVRFALQAARAGRTPRRRLARA*
Ga0066678_1099412713300005181SoilTTPPLVVTEQDVDWFVAALEETISRAEKMPRALVRFALGAARAGRAPRRRLARA*
Ga0070687_10010001813300005343Switchgrass RhizosphereLPPLVIDEDDLDWFVTALDETVARAERMPRALVRFALQAARAGRTPRRRLVRS*
Ga0070674_10100610513300005356Miscanthus RhizosphereLDWFVTALDETVARAEKMPRALVRFALQAARAGRTPRGRLVRS*
Ga0070714_10100544633300005435Agricultural SoilTEDDLDWFVGSLEETVAQAEKMPRALVRFALQAARAGAPRRRPVRA*
Ga0070700_10130678813300005441Corn, Switchgrass And Miscanthus RhizosphereVTEDDLDWFVSALEETITRAERMPRALVRFALGAARAGRTPRRRLMRA*
Ga0070678_10002612713300005456Miscanthus RhizospherePLVVTEDDLDWFVGSLEETVAQAEKMPRALVRFALQAARAGAPRRRPVRA*
Ga0070678_10019911513300005456Miscanthus RhizosphereLPPLVVDEDDLDWFVTALDETVSKAEKMPRALVRFALTAARAGRTPRKRLARA*
Ga0070686_10011012413300005544Switchgrass RhizospherePPLVVDEDDLDLFVAALDETVSKAEKMPRALVRFALTAARAGRTPRKRLARA*
Ga0068856_10250485523300005614Corn RhizosphereTQDDLDWFVSSLEETIMRAERMPRALVRFALGAARAGRTPRRRLTRA*
Ga0068860_10210406313300005843Switchgrass RhizosphereLPPLVVDGDDLDWFVTALDETVARAEKMPRALVRFGLQAARAGRTPRKRLARVSS*
Ga0066651_1010178533300006031SoilVTAEDVDWFVSALEETVADAEKMPRALVRFALGAARAGRPKRKRLVRA*
Ga0070716_10015630033300006173Corn, Switchgrass And Miscanthus RhizosphereGLNVLKALPPLVVIEDDLDWFVGSLEETVAQAEKMPRALIRFALQAARAGRTPRSRMARA
Ga0097621_10191029423300006237Miscanthus RhizosphereVGSLEETVAQAEKMPRALVRFALQAARAGAPRRRPVRA*
Ga0079220_1007589313300006806Agricultural SoilLVVDEDDLDWFVAALDETVLKAEKMPRALVRFALTAARAGRTPRKRLARA*
Ga0075426_1135536513300006903Populus RhizosphereETIGKAEHMPRALVRFALGAARAGRGPRRRLVRA*
Ga0105245_1003699293300009098Miscanthus RhizosphereLDWFVTALDETVARAEKMPRALVRFALQAARAGRTPRRRLVRS*
Ga0066709_10277312013300009137Grasslands SoilNVVKALPPLVVTGDDLDGFVSALEETIDRAEKMPRALVRFALTAARAGRTPKRRLARA*
Ga0066709_10413482023300009137Grasslands SoilETVAGAEKMPRALVRFALQAARAGRTPRRRLARA*
Ga0111538_1033983013300009156Populus RhizosphereLNVIKAIPPLVVSEDDLDWFASALEETIAKAEHMPRALVRFALGTARAGRGPRRRLVRA*
Ga0105241_1027956543300009174Corn RhizosphereFVAALDETVSKAEKMPRALVRFALTAARAGRTPRKRLARA*
Ga0105249_1275366913300009553Switchgrass RhizosphereFVSALEETIARAEKMPRALVRFALQAARAGRTPRRRPARV*
Ga0105249_1355930723300009553Switchgrass RhizosphereDLEWFAAALDETVARAEKMPRALVRFAVGAARAGRTPRRKLARA*
Ga0126321_134777113300010145SoilTEEDLDWFVSALEETVARAEKMPRALVRFVLQAARAGRTPRRRLARA*
Ga0134065_1012690523300010326Grasslands SoilVTEEDVDWFVTALEETIARAEKMPRALVRFALGAARAGRSPRRKLARV*
Ga0126379_1095063713300010366Tropical Forest SoilIPPLVVTEEDVDWFVSALEETIASAEKMPRALVRLALQAARAGRTPRRRPARV*
Ga0134123_1113189923300010403Terrestrial SoilEEDLDWFVSALEETIARAEKMPRALVRFALQAARSGRTPKRRLARA*
Ga0137382_1093554923300012200Vadose Zone SoilLVVNGDDLDGFVTALEETIDRSEKMPRALVRFALTAARAGRTPKRRLARA*
Ga0137376_1162909313300012208Vadose Zone SoilWFVSALEETVARAEKMPRALVRFALRAARAGRAPRRRLTRA*
Ga0137377_1171012213300012211Vadose Zone SoilIPPLVVMEEDVDWFVSALEETITQAEKMPRALVRFALQAARAGRTPRRRLTRA*
Ga0137372_1014650613300012350Vadose Zone SoilKAIPPLVVIEEDLDWFVSALEETVAGAEKMPRALVRFALQAARAGRPQRRRLARA*
Ga0137371_1021541533300012356Vadose Zone SoilNVLKAIPPLVVTEEDLDWFVSALEETVAGAEKMPRALVRFALQAARAGRPQRRRLARA*
Ga0137371_1057656633300012356Vadose Zone SoilEETIARAEKTPRALVRFALGAARAGRTPRRRLARA*
Ga0150984_10422027723300012469Avena Fatua RhizosphereLKAIPPLVVTEEDVDWFANALDETIARAEKMPRALVRFALGAARAGRAPKRKLARERATA
Ga0157335_100459013300012492Arabidopsis RhizospherePPLVVSEDDLDWFVSALEETIGKAERMPRALVRFALGAARAGRGPRRRLARA*
Ga0164308_1061078713300012985SoilALDETVTRAEKMPRALVRFGLQAARAGRTPRKRLARA*
Ga0164308_1142632013300012985SoilLVIDEDDLDWFVAALDETVARAETMPRALVRFALHAASAGRTPRKRLARA*
Ga0164307_1147097223300012987SoilPLVVTEEDVDWFATALDETIGRAEKMPRALVRFALGAARAGRAPKRKLARV*
Ga0157375_1189668813300013308Miscanthus RhizosphereDLDWFVTALEETVSKAEKMPRALMRFALTAARAGRTPRKRLARA*
Ga0157376_1109629233300014969Miscanthus RhizosphereLVVDEDDLDWFVTALEETVSKAEKMPRALMRFALTAARAGRTPRKRLARA*
Ga0134073_1043625023300015356Grasslands SoilLDWFVSALEETIGRAEKMPRALVRFALRAARAGRTPRRRPVRA*
Ga0132255_10078717043300015374Arabidopsis RhizosphereVLKALPPLVVDEDDLDWFVTALDETVGRAEKMPRALVRFALQAARGGRTPRKRLARA*
Ga0132255_10412163323300015374Arabidopsis RhizosphereKAIPPLVVSEDDLDWFVSALDETIGKAEHMPRALVRFALGAARAGRGPRRRPARA*
Ga0184620_1030665223300018051Groundwater SedimentLPPLVVTEEDLDSFASALEGTIGRAERMPRALVRFALGAARAGGKPRRRMARA
Ga0187774_1097820613300018089Tropical PeatlandHGVNVIKAIPPLVVTEEDVDWLASALEETIAHAEKMPRALVRFALTAARAGRTKRRRLAR
Ga0193747_100528713300019885SoilCELVTGDDLDGFVVALEETIDRAEKMPRALVRFALTAARAGRTPKRRLARA
Ga0193729_117033013300019887SoilLDSFASALEDTVSRAERMPRALVRFALGAARASGRPRRRLTRV
Ga0210381_1021340113300021078Groundwater SedimentDLDWFVSALEETITRAERMPRALVRFALGAARAGRTPRRRLMRA
Ga0222622_1071536813300022756Groundwater SedimentWFVSALEETVTKAERMPRALVRFALQAARAGRAPRRRPVRA
Ga0247797_100452813300023057SoilEDDLEWFASALDETVARAEKMPRALVRFAVGAARAGRNPRRKLARA
Ga0247686_101698913300024177SoilLEETVAQAEKMPRALVRFALQAARAGAPRRRPVRA
Ga0247679_103077833300024251SoilFVGSLEETVAQAEKMPRALVRFALQAARAGAPRRRPVRA
Ga0247660_104844513300024317SoilLVVTEDDLDWFVGSLEETVAQAEKMPRALVRFALQAARAGAPRRRPVRA
Ga0207692_1053333633300025898Corn, Switchgrass And Miscanthus RhizosphereDLDWLVGSLEETVAQAEKMPRALVRFALQAARAGAPRRRPVRA
Ga0207707_1157537123300025912Corn RhizosphereVVTEDDLDWFVGSLEETVAQAEKMPRALVRFALQAARAGAPRRRPVRA
Ga0207660_1034132313300025917Corn RhizosphereWFANALDETIARAEKMPRALVRFALGAARAGRAPKRKLVRA
Ga0207687_1089900133300025927Miscanthus RhizosphereVSALEETITRAERMPRALVRFALGAARAGRTPRRRLMRA
Ga0207690_1065112033300025932Corn RhizosphereKALPPLVIDEDDLDWFVTSLDETVVRAERMPRALVRFALQAARAGRTPRRRLVRS
Ga0207709_1140691233300025935Miscanthus RhizosphereLVIDEDDLDWFVTALDETVARAERMPRALVRFALQAARAGRTPRRRLVRS
Ga0207689_1097767013300025942Miscanthus RhizosphereDDLDWFVAALEETVSKAEKMPRALVRFALTAARAGRTPRKRLARA
Ga0207679_1170079233300025945Corn RhizosphereLNVLKALPPLVVTEDDLDWFVGSLEKTVTQAEKMPRALVRFALTAARAGRTPRKRLARA
Ga0207712_1073126133300025961Switchgrass RhizosphereALPPLVIDEDDLDWFVTALDETVARAERMPRALVRFALQAARAGRTPRRRLVRS
Ga0207712_1133774733300025961Switchgrass RhizosphereDLEWFAAALDETVARAEKMPRALVRFAVGAARAGRTPRRKLARA
Ga0207677_1018783113300026023Miscanthus RhizosphereKALPPLGVDEDDLDWFVAALDETVSKAEKMPRALVRFALTAARAGRTPRKRLARA
Ga0209027_125750223300026300Grasslands SoilEEAVAGAEKMPRALVRFALGAAKAGRPARKRLTRA
Ga0209152_1009148313300026325SoilPLVVGEDDLDWFATALDDTVARAEKMPRALVRFALHAARAGRKPRKRLARA
Ga0209159_109232313300026343SoilVVTEEDVDWFVSALEETVAGAEKMPRALVRFALGAAKAGRTPGKRVARA
Ga0247663_100618843300028145SoilEDDLDWFVGSLEETVAQAEKMPRALVRFALQAARAGAPRRRPVRA
Ga0268264_1238267713300028381Switchgrass RhizosphereLPPLVVDGDDLDWFVTALDETVARAEKMPRALVRFGLQAARAGRTPRKRLARVSS
Ga0247821_1103428513300028596SoilFVTALDETVARAEKMPRALVRFALQAARAGRTPRKRLARV
Ga0307276_1003934813300028705SoilTEEDLDSFASALEDTVRRAERMPRALVRFALGAARAGGKPRGRLTRV
Ga0307313_1025819513300028715SoilPLVVTEDDLDWFVSALEETITRAERMPRALVRFALGAARAGRTPRRRLMRA
Ga0307298_1001473213300028717SoilVDEDDLDWFVTALDETVTRAEKMPRALVRFALQAARAGRTPRKRLARA
Ga0307319_1023913433300028722SoilLVVTDDDLDWFVSALEETVTKAERMPRALVRFALQAARAGRAPRRRPVRA
Ga0307318_1024782133300028744SoilPFASALEETIGRAERMPRALVRFALGAARAGGKPRRRLIRA
Ga0307280_1001454413300028768SoilLVVDADDLDWFVSALDETVARAEKMPRALVRFGLQAARAGRTPRKRLARA
Ga0307280_1035458513300028768SoilEETVTKAERMPRALVRFALQAARAGRAPRRRPVRA
Ga0307306_1008958433300028782SoilNVLKALPSLVVDADDLDWFVSALDETVARAEKMPRALVRFGLQAARAGRTPRKRLARA
Ga0307282_1006465613300028784SoilVDADDLDWFVSALDETVARAEKMPRALVRFGLQAARAGRTPRKRLARA
Ga0307323_1008745713300028787SoilWFVSALEETITRAERMPRALVRFALGAARAGRTPRRRLIRA
Ga0307299_1019668623300028793SoilLVVTEDDVDWFANALDETIARAEKMPRALVRFALGAARAGRAPKRKLARV
Ga0307299_1031492213300028793SoilVVDEDDLDWFVTALDETVTRAEKMPRALVRFALQAARAGRTPRKRLARA
Ga0307305_1016363833300028807SoilLEGTIGRAERMPRALVRFALGAARAGGKPRRRMARA
Ga0307305_1026135033300028807SoilDLDWFVSALDETVARAEKMPRALVRFGLHAARVGRTPRKRLARA
Ga0307302_1002733813300028814SoilALEETVARAEKMPRALVRFALQAARAGRTPRRRSLARA
Ga0307296_1066454333300028819SoilDADALDWFVSALDETVARAEKMPRALVRFGLQAARAGRTPRKRLARA
Ga0307286_1001324913300028876SoilDDLDWFVTALDETVTRAEKMPRALVRFALQAARAGRTPRKRLARA
Ga0307286_1017261313300028876SoilDLDWFVSALEETITRAERMPRALVRFALGAARAGRTPRRRLIRA
Ga0307300_1007785613300028880SoilLDETVARAEKMPRALVRFALQATRAGRSPRRRPVRA
Ga0307277_1027405823300028881SoilEDDLDWFVAALDETVSRAEKMPRALVRFALHAARAGRSPRRRPVRA
Ga0307308_1061834413300028884SoilDVDWFVSALEETIASAEKMPRALVRFALQAARSGRAPKRRLART
Ga0307304_1026927813300028885SoilEETIARAEKMPRALVRFALQAARAGRTPRRRLARA
Ga0307409_10010196213300031995RhizosphereLNVLKGLPPLVIGEDDLDWFVSGLEDTVSRAERMPRALVRFALHAARAGRTSRRRLVRA
Ga0307471_10191800713300032180Hardwood Forest SoilDLDWFVSALEETIARAEKMPRALVRFALQAARAGRTPRRRPARV
Ga0335085_1017143753300032770SoilDLDGFVVALEETIERAEKMPRALVRFALTAARAGRMPRRRLARA
Ga0335082_1085611123300032782SoilKAIPPLVVTGDDLDGFVVALEETIERAEKMPRALVRFALGAARAGRMPKRRLARA
Ga0335084_1175232323300033004SoilDLDGFVVALEETIERAEKMPRALVRFALGAARAGRMPKRRLARA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.