Basic Information | |
---|---|
Family ID | F092506 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 107 |
Average Sequence Length | 41 residues |
Representative Sequence | MSLLAPIRRHRADQTASSGLLRSVRLFRLFLAEQSDPETF |
Number of Associated Samples | 93 |
Number of Associated Scaffolds | 107 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 100.00 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 96.26 % |
Associated GOLD sequencing projects | 92 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.41 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (69.159 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (43.925 % of family members) |
Environment Ontology (ENVO) | Unclassified (44.860 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Unclassified (43.925 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.71% β-sheet: 0.00% Coil/Unstructured: 60.29% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 107 Family Scaffolds |
---|---|---|
PF13439 | Glyco_transf_4 | 20.56 |
PF13489 | Methyltransf_23 | 0.93 |
PF13692 | Glyco_trans_1_4 | 0.93 |
PF13579 | Glyco_trans_4_4 | 0.93 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 69.16 % |
All Organisms | root | All Organisms | 30.84 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2189573004|GZGWRS402H59CD | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Dermacoccaceae → Dermacoccus → unclassified Dermacoccus → Dermacoccus sp. Ellin185 | 516 | Open in IMG/M |
3300001593|JGI12635J15846_10546504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 678 | Open in IMG/M |
3300001661|JGI12053J15887_10634769 | Not Available | 508 | Open in IMG/M |
3300005587|Ga0066654_10416100 | Not Available | 733 | Open in IMG/M |
3300005591|Ga0070761_11008095 | Not Available | 528 | Open in IMG/M |
3300005610|Ga0070763_10610172 | Not Available | 633 | Open in IMG/M |
3300006028|Ga0070717_11189445 | Not Available | 694 | Open in IMG/M |
3300006059|Ga0075017_101075880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Dermacoccaceae → Dermacoccus → unclassified Dermacoccus → Dermacoccus sp. Ellin185 | 628 | Open in IMG/M |
3300006175|Ga0070712_100096520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2176 | Open in IMG/M |
3300006176|Ga0070765_100981255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 799 | Open in IMG/M |
3300006176|Ga0070765_101491262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 637 | Open in IMG/M |
3300006176|Ga0070765_102126321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Cryptosporangiales → Cryptosporangiaceae → Cryptosporangium → Cryptosporangium arvum | 524 | Open in IMG/M |
3300006804|Ga0079221_11391981 | Not Available | 557 | Open in IMG/M |
3300009683|Ga0116224_10339711 | Not Available | 714 | Open in IMG/M |
3300009698|Ga0116216_10160198 | Not Available | 1383 | Open in IMG/M |
3300009698|Ga0116216_10313017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 956 | Open in IMG/M |
3300010379|Ga0136449_102637792 | Not Available | 715 | Open in IMG/M |
3300012199|Ga0137383_11097792 | Not Available | 576 | Open in IMG/M |
3300012206|Ga0137380_10847537 | Not Available | 787 | Open in IMG/M |
3300012355|Ga0137369_10312250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1162 | Open in IMG/M |
3300012984|Ga0164309_11528970 | Not Available | 571 | Open in IMG/M |
3300014657|Ga0181522_10046479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2434 | Open in IMG/M |
3300015373|Ga0132257_101267378 | Not Available | 935 | Open in IMG/M |
3300016319|Ga0182033_10733560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 867 | Open in IMG/M |
3300016319|Ga0182033_12020789 | Not Available | 525 | Open in IMG/M |
3300016341|Ga0182035_10453289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1088 | Open in IMG/M |
3300016357|Ga0182032_10678454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 863 | Open in IMG/M |
3300016387|Ga0182040_10661533 | Not Available | 851 | Open in IMG/M |
3300017822|Ga0187802_10175914 | Not Available | 820 | Open in IMG/M |
3300017924|Ga0187820_1295561 | Not Available | 532 | Open in IMG/M |
3300017928|Ga0187806_1105001 | Not Available | 905 | Open in IMG/M |
3300017932|Ga0187814_10316937 | Not Available | 599 | Open in IMG/M |
3300017942|Ga0187808_10230657 | Not Available | 826 | Open in IMG/M |
3300017943|Ga0187819_10080754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1941 | Open in IMG/M |
3300017943|Ga0187819_10488712 | Not Available | 703 | Open in IMG/M |
3300017959|Ga0187779_10600930 | Not Available | 736 | Open in IMG/M |
3300017974|Ga0187777_10135712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1636 | Open in IMG/M |
3300017974|Ga0187777_11485102 | Not Available | 502 | Open in IMG/M |
3300018433|Ga0066667_11272134 | Not Available | 642 | Open in IMG/M |
3300020150|Ga0187768_1088856 | Not Available | 701 | Open in IMG/M |
3300020582|Ga0210395_10605089 | Not Available | 822 | Open in IMG/M |
3300020582|Ga0210395_11428998 | Not Available | 504 | Open in IMG/M |
3300021170|Ga0210400_11055780 | Not Available | 659 | Open in IMG/M |
3300021401|Ga0210393_11510202 | Not Available | 534 | Open in IMG/M |
3300021404|Ga0210389_10791261 | Not Available | 741 | Open in IMG/M |
3300021405|Ga0210387_11504896 | Not Available | 576 | Open in IMG/M |
3300021560|Ga0126371_12422125 | Not Available | 635 | Open in IMG/M |
3300025898|Ga0207692_11082457 | Not Available | 531 | Open in IMG/M |
3300025931|Ga0207644_11710341 | Not Available | 527 | Open in IMG/M |
3300025939|Ga0207665_10568803 | Not Available | 882 | Open in IMG/M |
3300026899|Ga0209326_1013736 | Not Available | 626 | Open in IMG/M |
3300027590|Ga0209116_1063524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 803 | Open in IMG/M |
3300027676|Ga0209333_1129748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 681 | Open in IMG/M |
3300027889|Ga0209380_10639468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 614 | Open in IMG/M |
3300027905|Ga0209415_10252738 | Not Available | 1583 | Open in IMG/M |
3300029882|Ga0311368_10254585 | Not Available | 1355 | Open in IMG/M |
3300030582|Ga0210261_1224725 | Not Available | 503 | Open in IMG/M |
3300031544|Ga0318534_10190628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1184 | Open in IMG/M |
3300031544|Ga0318534_10215756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1107 | Open in IMG/M |
3300031546|Ga0318538_10119025 | Not Available | 1378 | Open in IMG/M |
3300031561|Ga0318528_10218205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1022 | Open in IMG/M |
3300031572|Ga0318515_10254184 | Not Available | 942 | Open in IMG/M |
3300031681|Ga0318572_10872186 | Not Available | 535 | Open in IMG/M |
3300031682|Ga0318560_10388773 | Not Available | 755 | Open in IMG/M |
3300031682|Ga0318560_10748489 | Not Available | 528 | Open in IMG/M |
3300031708|Ga0310686_108901995 | Not Available | 841 | Open in IMG/M |
3300031719|Ga0306917_10551375 | Not Available | 906 | Open in IMG/M |
3300031723|Ga0318493_10041761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces varsoviensis | 2136 | Open in IMG/M |
3300031747|Ga0318502_10642771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 640 | Open in IMG/M |
3300031751|Ga0318494_10151115 | Not Available | 1307 | Open in IMG/M |
3300031765|Ga0318554_10510405 | Not Available | 680 | Open in IMG/M |
3300031765|Ga0318554_10848540 | Not Available | 510 | Open in IMG/M |
3300031770|Ga0318521_10148956 | Not Available | 1328 | Open in IMG/M |
3300031771|Ga0318546_10169504 | Not Available | 1480 | Open in IMG/M |
3300031771|Ga0318546_11090526 | Not Available | 561 | Open in IMG/M |
3300031781|Ga0318547_10360524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 889 | Open in IMG/M |
3300031795|Ga0318557_10332261 | Not Available | 698 | Open in IMG/M |
3300031796|Ga0318576_10352243 | Not Available | 696 | Open in IMG/M |
3300031799|Ga0318565_10207423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 953 | Open in IMG/M |
3300031819|Ga0318568_10494210 | Not Available | 763 | Open in IMG/M |
3300031821|Ga0318567_10767764 | Not Available | 546 | Open in IMG/M |
3300031831|Ga0318564_10198122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 894 | Open in IMG/M |
3300031832|Ga0318499_10126397 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 995 | Open in IMG/M |
3300031833|Ga0310917_10459808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 866 | Open in IMG/M |
3300031880|Ga0318544_10439047 | Not Available | 508 | Open in IMG/M |
3300031896|Ga0318551_10666399 | Not Available | 602 | Open in IMG/M |
3300031897|Ga0318520_10038499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 2446 | Open in IMG/M |
3300031897|Ga0318520_11020253 | Not Available | 523 | Open in IMG/M |
3300031946|Ga0310910_10996190 | Not Available | 655 | Open in IMG/M |
3300031947|Ga0310909_10332607 | Not Available | 1275 | Open in IMG/M |
3300031954|Ga0306926_12926363 | Not Available | 512 | Open in IMG/M |
3300031962|Ga0307479_10405631 | Not Available | 1348 | Open in IMG/M |
3300032008|Ga0318562_10223671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1091 | Open in IMG/M |
3300032008|Ga0318562_10890424 | Not Available | 508 | Open in IMG/M |
3300032009|Ga0318563_10408277 | Not Available | 735 | Open in IMG/M |
3300032059|Ga0318533_11417972 | Not Available | 507 | Open in IMG/M |
3300032060|Ga0318505_10413664 | Not Available | 637 | Open in IMG/M |
3300032065|Ga0318513_10608088 | Not Available | 535 | Open in IMG/M |
3300032066|Ga0318514_10374986 | Not Available | 754 | Open in IMG/M |
3300032066|Ga0318514_10626600 | Not Available | 572 | Open in IMG/M |
3300032076|Ga0306924_11974493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 602 | Open in IMG/M |
3300032089|Ga0318525_10313821 | Not Available | 805 | Open in IMG/M |
3300032895|Ga0335074_10330478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1714 | Open in IMG/M |
3300032896|Ga0335075_10976517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 764 | Open in IMG/M |
3300033134|Ga0335073_11280992 | Not Available | 727 | Open in IMG/M |
3300033475|Ga0310811_10689389 | Not Available | 992 | Open in IMG/M |
3300034817|Ga0373948_0185745 | Not Available | 536 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 43.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.48% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 6.54% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.61% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.67% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.67% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.74% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.74% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.80% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.80% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.80% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.93% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.93% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.93% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.93% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.93% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.93% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.93% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.93% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.93% |
Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.93% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.93% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2189573004 | Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen) | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300020150 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MG | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026899 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030582 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO145-ARE022SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FG2_06248630 | 2189573004 | Grass Soil | MSLMAPTRRHSADQAPPSGLLRSVRLFRLFLAEQSDPEKFYSSLA |
JGI12635J15846_105465041 | 3300001593 | Forest Soil | MSLLAPIRRRRGNQAARSGVLRSIRLFRLFLGEQNDQETFYVSLAEDAVQQVAE |
JGI12053J15887_106347691 | 3300001661 | Forest Soil | MSLMAPTSRQCADQATPVGLRRSVRLFRLFLAEQSDPEK |
Ga0066654_104161001 | 3300005587 | Soil | MSLMAPTRRHSADQAPPSGLLRSIRLFRLFLAEQSDPE |
Ga0070761_110080952 | 3300005591 | Soil | MSLLAPIRRHRAEQAARSGLLRSVRLFRLFLAEQAEPE |
Ga0070763_106101721 | 3300005610 | Soil | MSLLGPIRRRRGNQAARSGVLRSIRLFRLFLGEQND |
Ga0070717_111894451 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLLAPIRRHRVDQHSVDRTTRSGLLRSVRLFRLF |
Ga0075017_1010758801 | 3300006059 | Watersheds | MGLLAPIRRHRADQANLSPDQATHSGLRRSVRLFRLFMAEQTDPEKFYASL |
Ga0070712_1000965203 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LSLLAPNRRYRADQATPSGLRRSVRLFRLFLAEQSDPE |
Ga0070765_1009812551 | 3300006176 | Soil | MSLLAPTRRHRADQAPPSGLRRSVRLFRLFLAEQSDP |
Ga0070765_1014912622 | 3300006176 | Soil | MSLLGPIRRRRGNQAARSGVLRSIRLFRLFLGEQNDQETFYLSLAEDAVQQVAEHT |
Ga0070765_1021263211 | 3300006176 | Soil | MSLLAPTRRHCADQPPPAGLRRSVRLFRLFRAEQSDPEKFYAS |
Ga0079221_113919812 | 3300006804 | Agricultural Soil | MSLLAPIRRRSADQATRSADQETSSGLRRSVRLFRLFLAEQTDPEKFYAGLAEAAV |
Ga0116224_103397111 | 3300009683 | Peatlands Soil | MSLLAPIRRHPADQANSSGLLRSVRLFLLFLAEQAEPEKFYA |
Ga0116216_101601981 | 3300009698 | Peatlands Soil | MSLLAPIRRRPAAQAKSSGLLRSVRLFRLFLAEQAEPEK |
Ga0116216_103130172 | 3300009698 | Peatlands Soil | MSLQAPIRRDRADQTARSVVLRSVRLFRLFLAEQSDPETFYTG |
Ga0136449_1026377922 | 3300010379 | Peatlands Soil | MSLLAPIRRHRADQTAHSGVLRSVRLFRLFLAEQSDPE |
Ga0137383_110977921 | 3300012199 | Vadose Zone Soil | MSLLSPIRRRRADQATRSGLLRSIRLFRMFLAEQADPEKFYAYLAEDAVQQVAEHC |
Ga0137380_108475371 | 3300012206 | Vadose Zone Soil | MSLLAPNRRYRADQATPSGLRRSVRLFRLFLAEQSDPEK |
Ga0137369_103122501 | 3300012355 | Vadose Zone Soil | MSLMAPTRRHSADQAPPSGLLRSVRLFRLFLADQRDPEQFYAS |
Ga0164309_115289701 | 3300012984 | Soil | MSLMAPTRRHSADQAPNSGLLRSIRLFRLFLADQGDPGRFNGAWP |
Ga0181522_100464791 | 3300014657 | Bog | MSLLGPIRRRRGNQAARSGVRRSIRLFRLFLGEQNDQETFYV |
Ga0132257_1012673781 | 3300015373 | Arabidopsis Rhizosphere | MSLMAPTRRHSADQAPPSGLLRSVRLFRLFLAEQSDPEKFYASLAEDA |
Ga0182033_107335602 | 3300016319 | Soil | MSLLAPRRPRADHTASSGLLRSVRLFRLFLAEQSDPE |
Ga0182033_120207891 | 3300016319 | Soil | MSLLAPNRLDRADQAVPSGLKRSFRLFRLFLAEQSDPEQFYASLATDAVQQ |
Ga0182035_104532892 | 3300016341 | Soil | MSLQAPIRRHGANQASSTGLLRSVRLFRLFLSEQSDPETFY |
Ga0182032_106784541 | 3300016357 | Soil | MSLLAPIRRHRADQTASSGLLRSVRLFRLFLAEQSDPETF |
Ga0182040_106615332 | 3300016387 | Soil | MSLLAPNRRHVDQAAGSGLLRSVRLFRLFLAEQTDPEKFY |
Ga0187802_101759141 | 3300017822 | Freshwater Sediment | MSLPAPIRRHRDDQTARSGVLRSVRLFRLFLAEQSDPEAFYTGLAED |
Ga0187820_12955612 | 3300017924 | Freshwater Sediment | MSLLAPRRPRADQTASSGLLRSIRLFRLFLAEQSDPETFYGNLAEDAVQQ |
Ga0187806_11050012 | 3300017928 | Freshwater Sediment | MSLLAPIRRHRSDQAAPSGLLRSVRLFRLFLAEQTDPETFYAS |
Ga0187814_103169372 | 3300017932 | Freshwater Sediment | MSLQAPIRRDRADQTARSGVLRSVRLFRLFLAEQS |
Ga0187808_102306571 | 3300017942 | Freshwater Sediment | MSLLAPIRRHRAGQAADSGLLRSVRLFRLFLAEQSDPEK |
Ga0187819_100807543 | 3300017943 | Freshwater Sediment | MSLPAPIRRHRDDQTARSGVLRSVRLFRLFLAEQSDPEAFY |
Ga0187819_104887122 | 3300017943 | Freshwater Sediment | MSLLAPIRRHRADQAAGSGLLRSVRLFRLFLAEQSDPETFYASLAED |
Ga0187779_106009301 | 3300017959 | Tropical Peatland | MSLLAPDRHHPADQARSSGLLRSLRLFRLFLAEQTDPEKFYAS |
Ga0187777_101357121 | 3300017974 | Tropical Peatland | MSLLAPNRRHLDQAAGTGLLRSVRLFRLFLAEQADPEKFYTSLAED |
Ga0187777_114851021 | 3300017974 | Tropical Peatland | MSLLAPIRHRADQTARSGLLRSVRLFRLFLAEQSDPETFYTSLAE |
Ga0066667_112721341 | 3300018433 | Grasslands Soil | MSLMAPTSRPCSDQAPPVRLRRSVRLFRSFPAQHGVPE |
Ga0187768_10888562 | 3300020150 | Tropical Peatland | MSLLAPNRRHLDQAAGTGLLRSVRLFRLFLAEQADPEKFYT |
Ga0210395_106050892 | 3300020582 | Soil | MSLLAPFRRRAAPSGVRRSVRLFRLFLAEQSDPEAFYVSLAEDA |
Ga0210395_114289981 | 3300020582 | Soil | MSLMAPVSRQCADQATPAGLRRSVRLFRLFLAEQSDPEKFYGSLA |
Ga0210400_110557801 | 3300021170 | Soil | LSLLAPNRRYRADQATPSGLRRSVRLFRLFLAEQS |
Ga0210393_115102021 | 3300021401 | Soil | MSLLAPFRRRAAPSGVRRSVRLFRLFLAEQSDPEAF |
Ga0210389_107912611 | 3300021404 | Soil | MSLLAPTRRHCADQPPPAGLRRSVRLFRLFRAEQSDPEKFYVSLAEDA |
Ga0210387_115048961 | 3300021405 | Soil | LSLLAPNRRYRADQATPSGLRRSVRLFRLFRAEQG |
Ga0126371_124221252 | 3300021560 | Tropical Forest Soil | MSLQAPIRRHGADQAPPTGLLRSVRLFRLFLAEQSDPEKFY |
Ga0207692_110824571 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLLAPRRDRANEDGATPATRSGLLRSFRLFRLFLAEQSDP |
Ga0207644_117103412 | 3300025931 | Switchgrass Rhizosphere | MSLLAPNRRNRVDQHRVDRLTRSGLLRSVRLFRLFLA |
Ga0207665_105688031 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLTAPTRRHSADQAPPSGLLRSVRLFRLFLAEQSDPEKFYASLAED |
Ga0209326_10137361 | 3300026899 | Forest Soil | MSLMAPTRRHSADQAPSSGLLRSIRLFRLFLAEQSDPEMFYASLAED |
Ga0209116_10635242 | 3300027590 | Forest Soil | MSLLAPIRRRRGNRAARSGVLRSIRLFRLFLGEQTNRETFYVS |
Ga0209333_11297481 | 3300027676 | Forest Soil | MSLLAPIRRHRAEQAAHSGLRRSVGLFRLFLAEQAEPEKFYAGLAEDAV |
Ga0209380_106394681 | 3300027889 | Soil | MSLLAPIRRHRAEQAARSGLLRSVRLFRLFLAEQAEP |
Ga0209415_102527381 | 3300027905 | Peatlands Soil | MSLLAPFRRRRAASFGLLRSVRLFRLFLAEQSDPEA |
Ga0311368_102545851 | 3300029882 | Palsa | MSLLAPIRRRRGNQAARSGVLRSIRLFRLFLGEQNDQETFYVSLA |
Ga0210261_12247252 | 3300030582 | Soil | MSLLAPIRRHRADQTARSGVLRSVRLFRLFLAEQSDPE |
Ga0318534_101906281 | 3300031544 | Soil | MSLQAPIRRDCADQAPPTGLLRSVRLFRLFLAEQSDPE |
Ga0318534_102157562 | 3300031544 | Soil | MSLLAPIRRHPADQPGRSGLLRSVRLFRLFLAEQTDP |
Ga0318538_101190251 | 3300031546 | Soil | MSLLAPNRLDRADQAAPSGLKRSFRLFRLFLAEQSDPEKFYASLATD |
Ga0318528_102182052 | 3300031561 | Soil | MSLLAPNRLDRADQAAPSGLKRSFRLFRLFLAEQSDPEKF |
Ga0318515_102541842 | 3300031572 | Soil | MSLLAPNRLDRADQAAPSGLKRSFRLFRLFLAEQSDPEQ |
Ga0318572_108721861 | 3300031681 | Soil | MGLMAPIRRRRVDPAARSGLLRSVRLFRLFLAEQADPDTFYTSLAED |
Ga0318560_103887732 | 3300031682 | Soil | MSLLAPIRRHRVDQAARSGLLRSVRLFRLFLAEQTDPEKFY |
Ga0318560_107484892 | 3300031682 | Soil | MSLLAPNRRHRADQAASSGLGRSVRLFRLFLAEQADPE |
Ga0310686_1089019952 | 3300031708 | Soil | MSLLAPIRRHRADPTARSGVLRSVRLFRLFLAEQS |
Ga0306917_105513751 | 3300031719 | Soil | MSLQAPIRRHGANQASSTGLLRSVRLFRLFLSEQSDPETFYASLAED |
Ga0318493_100417613 | 3300031723 | Soil | MSLQAPIRRHGANQASSTGLLRSVRLFRLFLSEQSDPETFYARLAE |
Ga0318502_106427712 | 3300031747 | Soil | MSLLAPRRLHADHPASSGLLRSVRLFRLFLAEQSDP |
Ga0318494_101511152 | 3300031751 | Soil | MSLQAPIRRDCADQAPPTGLLRSVRLFRLFLAEQSD |
Ga0318554_105104052 | 3300031765 | Soil | MSLLAPNRRLPGDQAAPSGLLRSVRLFRLFLAEQTD |
Ga0318554_108485401 | 3300031765 | Soil | MSLLAPNRHHRADQAGRSGLLRSVRLFRLFLAEQTDP |
Ga0318521_101489562 | 3300031770 | Soil | MSLQAPIRRHGANQASSTGLLRSVRLFRLFLSEQSDPETFYA |
Ga0318546_101695041 | 3300031771 | Soil | MSLQAPIRRHSADQAPPAGLLRSVRLFRLFLAEQSDPEKFYASLAE |
Ga0318546_110905262 | 3300031771 | Soil | MSLLAPRRPRADHPASSGLLRSVRLFRLFLAEQSD |
Ga0318547_103605241 | 3300031781 | Soil | MSLLAPRRPRADHTASSGLLRSVRLFRLFLAEQSDP |
Ga0318557_103322611 | 3300031795 | Soil | MSLLAPNRRLPGDQAAPSGLLRSVRLFRLFLAEQTDPETFYSGLA |
Ga0318576_103522432 | 3300031796 | Soil | MSLLAPRRPRADHPASSGLLRSVRLFRLFLAEQSDP |
Ga0318565_102074232 | 3300031799 | Soil | MSLLAPRRPRADHTASSGLLRSVRLFRLFLAEQSDPETFYTSLAED |
Ga0318568_104942102 | 3300031819 | Soil | MSLLAPTRRHCADQPPPAGLRRSVRLFRLFRAEQSDPEKFY |
Ga0318567_107677641 | 3300031821 | Soil | MSLQAPIRRHSADQAPPTGLLRSVRLFRLFLAEQSDPEKFYASLAEDAV |
Ga0318564_101981221 | 3300031831 | Soil | MSLLAPRRPRADHTASSGLLRSVRLFRLFLAEQSDPETFYTSLA |
Ga0318499_101263971 | 3300031832 | Soil | MSLLAPRRLHADHPASSGLLRSVRLFRLFLAEQSDPETF |
Ga0310917_104598081 | 3300031833 | Soil | MSLLAPRRPRADHPASSGLLRSVRLFRLFLAEQSDPETFYTSLA |
Ga0318544_104390472 | 3300031880 | Soil | MSLLAPNRRHVDQAAGSGLLRSVRLFRLFLAEQTDPEKF |
Ga0318551_106663991 | 3300031896 | Soil | MGLMAPIRRRRVDPAARSGLLRSVRLFRLFLAEQAD |
Ga0318520_100384993 | 3300031897 | Soil | MSLLAPIRRHRVDQAARSGLLRSVRLFRLFLAEQTDPEKFYTSLA |
Ga0318520_110202531 | 3300031897 | Soil | MSLLAPRRPRADHTASSGMLRSVRLFRLFLAEQSDPETFYTSLAEY |
Ga0310910_109961901 | 3300031946 | Soil | MSLQAPIRRHSADQAPPAGLLRSVRLFRLFLAEQS |
Ga0310909_103326072 | 3300031947 | Soil | MSLLAPNRLDRADQAAPSGLKRSFRLFRLFLAEQSDPEKFYASLATDAVQ |
Ga0306926_129263631 | 3300031954 | Soil | MSLQAPIRRHSADHDQAPPAGLLRSVRLFRLFLAEQSDPEKFY |
Ga0307479_104056312 | 3300031962 | Hardwood Forest Soil | MSLLAPIRRYRADQATGSGLLRSVRLFRLFLAEQTEPDKFYA |
Ga0318562_102236712 | 3300032008 | Soil | MSLQAPIRRHSADQAPPTGLLRSVRLFRLFLAEQSDP |
Ga0318562_108904241 | 3300032008 | Soil | MSLQAPIRRDCADQAPPTGLLRSVRLFRLFLAEQSDPEKFYASLATDAVQQ |
Ga0318563_104082772 | 3300032009 | Soil | MSLQAPIRRHSADHDQAPPAGLLRSVRLFRLFLAEQSDPEKF |
Ga0318533_114179722 | 3300032059 | Soil | MSLLAPIRRHRVDQATRSGLLRSVRLFRLFMAEQTDPERFYA |
Ga0318505_104136641 | 3300032060 | Soil | MSLLAPNRLDRADQAAPSGLKRSFRLFRLFLAEQSDPEQFYASLATDAVQQ |
Ga0318513_106080882 | 3300032065 | Soil | MSLLAPIRRHHADQTASSGLLRSIRLFRLFLAEQSDPETFY |
Ga0318514_103749862 | 3300032066 | Soil | MSLLAPNRRHRADQAASSSGLGRSVRLFRLFLAEQTDAEAFYARL |
Ga0318514_106266001 | 3300032066 | Soil | MSLLAPIRRHRADQTASSGLLRSVRLFRLFLAEQSD |
Ga0306924_119744931 | 3300032076 | Soil | MSLLAPIRRHRADQVAGSGLLRSVRLFRLFLAEQS |
Ga0318525_103138211 | 3300032089 | Soil | MSLQAPIRRHSADHDQAPPAGLLRSVRLFRLFLAE |
Ga0335074_103304783 | 3300032895 | Soil | MSLLAPIRRRRAGQAARSGLLRSIRLFRLFLAEQADPER |
Ga0335075_109765172 | 3300032896 | Soil | MSLLAPIRRHGTDPAARSGLLRSVRLFRLFLAEQA |
Ga0335073_112809921 | 3300033134 | Soil | MGLLAPTRRHHADQANPPPDQAAGTGLRRSVRLFRLFMAEQS |
Ga0310811_106893892 | 3300033475 | Soil | MSLMAPTSRQCADQATPVGLRRSVRLFRLFLAEQSDPEKFYSS |
Ga0373948_0185745_2_136 | 3300034817 | Rhizosphere Soil | MSLMAPTRRHSAVQAPPSGLLRSVRLFRLFLAEQSDPEKFYASLA |
⦗Top⦘ |