Basic Information | |
---|---|
Family ID | F092505 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 107 |
Average Sequence Length | 39 residues |
Representative Sequence | VGEEARTGKRFPLELPIKIHKGETGGDASGITGNLSAAG |
Number of Associated Samples | 99 |
Number of Associated Scaffolds | 107 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 97.20 % |
% of genes near scaffold ends (potentially truncated) | 99.07 % |
% of genes from short scaffolds (< 2000 bps) | 86.92 % |
Associated GOLD sequencing projects | 95 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.18 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (97.196 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (12.149 % of family members) |
Environment Ontology (ENVO) | Unclassified (26.168 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.121 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 5.97% Coil/Unstructured: 94.03% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.18 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 107 Family Scaffolds |
---|---|---|
PF07332 | Phage_holin_3_6 | 9.35 |
PF13365 | Trypsin_2 | 7.48 |
PF02602 | HEM4 | 2.80 |
PF08238 | Sel1 | 1.87 |
PF00848 | Ring_hydroxyl_A | 1.87 |
PF09286 | Pro-kuma_activ | 1.87 |
PF13185 | GAF_2 | 0.93 |
PF07690 | MFS_1 | 0.93 |
PF13807 | GNVR | 0.93 |
PF13487 | HD_5 | 0.93 |
PF00905 | Transpeptidase | 0.93 |
PF13641 | Glyco_tranf_2_3 | 0.93 |
PF01202 | SKI | 0.93 |
PF09972 | DUF2207 | 0.93 |
PF04932 | Wzy_C | 0.93 |
PF02607 | B12-binding_2 | 0.93 |
PF05050 | Methyltransf_21 | 0.93 |
PF08281 | Sigma70_r4_2 | 0.93 |
PF00106 | adh_short | 0.93 |
PF02604 | PhdYeFM_antitox | 0.93 |
PF00072 | Response_reg | 0.93 |
COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
---|---|---|---|
COG4638 | Phenylpropionate dioxygenase or related ring-hydroxylating dioxygenase, large terminal subunit | Inorganic ion transport and metabolism [P] | 3.74 |
COG1587 | Uroporphyrinogen-III synthase | Coenzyme transport and metabolism [H] | 2.80 |
COG4934 | Serine protease, subtilase family | Posttranslational modification, protein turnover, chaperones [O] | 1.87 |
COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.93 |
COG3307 | O-antigen ligase | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.93 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 97.20 % |
Unclassified | root | N/A | 2.80 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2088090014|GPIPI_17051510 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2291 | Open in IMG/M |
2189573000|GPBTN7E01A3CRR | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
3300000567|JGI12270J11330_10040215 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2623 | Open in IMG/M |
3300001131|JGI12631J13338_1035571 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
3300001686|C688J18823_10950762 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101407197 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
3300004633|Ga0066395_10388448 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 784 | Open in IMG/M |
3300005437|Ga0070710_10348779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 979 | Open in IMG/M |
3300005444|Ga0070694_100549860 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 924 | Open in IMG/M |
3300005535|Ga0070684_100308219 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1453 | Open in IMG/M |
3300005537|Ga0070730_10015767 | All Organisms → cellular organisms → Bacteria | 6014 | Open in IMG/M |
3300005537|Ga0070730_10434378 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 847 | Open in IMG/M |
3300006059|Ga0075017_100508410 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
3300006059|Ga0075017_101357252 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
3300006175|Ga0070712_100152760 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1774 | Open in IMG/M |
3300006800|Ga0066660_11201665 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
3300006804|Ga0079221_10516939 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 780 | Open in IMG/M |
3300006871|Ga0075434_101491863 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
3300007788|Ga0099795_10511927 | Not Available | 561 | Open in IMG/M |
3300009093|Ga0105240_10225093 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2183 | Open in IMG/M |
3300009143|Ga0099792_10328758 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
3300009518|Ga0116128_1205394 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
3300009553|Ga0105249_12200682 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
3300009632|Ga0116102_1053744 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1256 | Open in IMG/M |
3300009635|Ga0116117_1116712 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
3300009665|Ga0116135_1288891 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
3300009792|Ga0126374_11169525 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
3300010358|Ga0126370_10967335 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 774 | Open in IMG/M |
3300010359|Ga0126376_12097532 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
3300010366|Ga0126379_10043359 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3644 | Open in IMG/M |
3300010371|Ga0134125_11258079 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 808 | Open in IMG/M |
3300011271|Ga0137393_11259052 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
3300012210|Ga0137378_11483173 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
3300012350|Ga0137372_11065255 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
3300012356|Ga0137371_10645284 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 811 | Open in IMG/M |
3300012362|Ga0137361_10854846 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 826 | Open in IMG/M |
3300012683|Ga0137398_10556543 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
3300012685|Ga0137397_10287441 | Not Available | 1225 | Open in IMG/M |
3300012929|Ga0137404_10309205 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1373 | Open in IMG/M |
3300012929|Ga0137404_12096083 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
3300012957|Ga0164303_10504215 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 775 | Open in IMG/M |
3300012957|Ga0164303_10903184 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
3300012960|Ga0164301_11464611 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
3300012988|Ga0164306_11916732 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
3300012989|Ga0164305_11086994 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 686 | Open in IMG/M |
3300013100|Ga0157373_10551515 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 836 | Open in IMG/M |
3300013308|Ga0157375_12931403 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
3300014201|Ga0181537_11106746 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
3300015052|Ga0137411_1083845 | All Organisms → cellular organisms → Bacteria | 1609 | Open in IMG/M |
3300015371|Ga0132258_13470244 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCGC AG-212-P17 | 1081 | Open in IMG/M |
3300017933|Ga0187801_10503338 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
3300018006|Ga0187804_10315437 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
3300018007|Ga0187805_10435876 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
3300018013|Ga0187873_1012945 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 4733 | Open in IMG/M |
3300018017|Ga0187872_10023546 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3536 | Open in IMG/M |
3300018023|Ga0187889_10433983 | Not Available | 565 | Open in IMG/M |
3300018025|Ga0187885_10075271 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1676 | Open in IMG/M |
3300018025|Ga0187885_10403599 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
3300018085|Ga0187772_11004849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 609 | Open in IMG/M |
3300018086|Ga0187769_10867416 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
3300018090|Ga0187770_11143760 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 628 | Open in IMG/M |
3300019890|Ga0193728_1044690 | All Organisms → cellular organisms → Bacteria | 2169 | Open in IMG/M |
3300019890|Ga0193728_1117477 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1209 | Open in IMG/M |
3300020082|Ga0206353_11590514 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1496 | Open in IMG/M |
3300020580|Ga0210403_10141405 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1965 | Open in IMG/M |
3300020581|Ga0210399_10179871 | All Organisms → cellular organisms → Bacteria | 1755 | Open in IMG/M |
3300020581|Ga0210399_10663652 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
3300021086|Ga0179596_10505722 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
3300021406|Ga0210386_11798688 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
3300022873|Ga0224550_1042993 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
3300025406|Ga0208035_1021116 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1050 | Open in IMG/M |
3300025913|Ga0207695_11396262 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
3300025915|Ga0207693_11053201 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
3300025932|Ga0207690_10973193 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 705 | Open in IMG/M |
3300026021|Ga0208140_1025457 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 815 | Open in IMG/M |
3300026023|Ga0207677_10290902 | All Organisms → cellular organisms → Bacteria | 1345 | Open in IMG/M |
3300026041|Ga0207639_10666732 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 963 | Open in IMG/M |
3300026041|Ga0207639_11643117 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
3300026089|Ga0207648_10139473 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2137 | Open in IMG/M |
3300026294|Ga0209839_10036284 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1843 | Open in IMG/M |
3300026502|Ga0255350_1112332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
3300027439|Ga0209332_1033635 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 963 | Open in IMG/M |
3300027616|Ga0209106_1048019 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 951 | Open in IMG/M |
3300027652|Ga0209007_1086617 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 789 | Open in IMG/M |
3300027681|Ga0208991_1021131 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1966 | Open in IMG/M |
3300027684|Ga0209626_1020893 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1561 | Open in IMG/M |
3300027826|Ga0209060_10336898 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
3300027855|Ga0209693_10005121 | All Organisms → cellular organisms → Bacteria | 5994 | Open in IMG/M |
3300027911|Ga0209698_10126958 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2109 | Open in IMG/M |
3300028047|Ga0209526_10047324 | All Organisms → cellular organisms → Bacteria | 3027 | Open in IMG/M |
3300028381|Ga0268264_12526005 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
3300028556|Ga0265337_1215201 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
3300028560|Ga0302144_10007315 | All Organisms → cellular organisms → Bacteria | 3651 | Open in IMG/M |
3300029907|Ga0311329_10071523 | All Organisms → cellular organisms → Bacteria | 2953 | Open in IMG/M |
3300030019|Ga0311348_11392717 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
3300030707|Ga0310038_10133761 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1253 | Open in IMG/M |
3300030979|Ga0068589_11788067 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
3300031028|Ga0302180_10079508 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1912 | Open in IMG/M |
3300031090|Ga0265760_10151653 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
3300031525|Ga0302326_12264060 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
3300031718|Ga0307474_10171468 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1644 | Open in IMG/M |
3300031754|Ga0307475_10774826 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 762 | Open in IMG/M |
3300031939|Ga0308174_10641639 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 882 | Open in IMG/M |
3300031942|Ga0310916_11011469 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 693 | Open in IMG/M |
3300031954|Ga0306926_12087774 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 634 | Open in IMG/M |
3300031962|Ga0307479_10880503 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 868 | Open in IMG/M |
3300032180|Ga0307471_102996860 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 599 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.15% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.48% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.48% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.61% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.67% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 4.67% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.74% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.74% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.74% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.80% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.80% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.80% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.80% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.87% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.87% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.87% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.87% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.87% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.87% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.87% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.87% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.93% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.93% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.93% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.93% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.93% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.93% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.93% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.93% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.93% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.93% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.93% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.93% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.93% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.93% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
2189573000 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms) | Environmental | Open in IMG/M |
3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
3300001131 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 | Environmental | Open in IMG/M |
3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300022873 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 10-14 | Environmental | Open in IMG/M |
3300025406 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 (SPAdes) | Environmental | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026021 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_404 (SPAdes) | Environmental | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
3300026502 | Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T-25.r1 | Environmental | Open in IMG/M |
3300027439 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Host-Associated | Open in IMG/M |
3300028560 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_2 | Environmental | Open in IMG/M |
3300029907 | I_Bog_N1 coassembly | Environmental | Open in IMG/M |
3300030019 | II_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
3300030979 | Forest soil microbial communities from France, for metatranscriptomics studies - Site 11 - Champenoux / Amance forest (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
GPIPI_00943760 | 2088090014 | Soil | VGEEARTGKRFPLELPIKIHKGETDAKGVTGNLSA |
N55_03165980 | 2189573000 | Grass Soil | VGEEARTGKRFPLELPIKIHKGETGGDAEGVTGNRQRGGSRISAP |
JGI12270J11330_100402154 | 3300000567 | Peatlands Soil | VGEEARTGKRFPLELPIKIHQGETGGDAKGVTGNLSA |
JGI12631J13338_10355712 | 3300001131 | Forest Soil | VSEARTGKRFPLHLPIKIHKEDSVGEISSGMTGDLSAAGVYIRAD |
C688J18823_109507621 | 3300001686 | Soil | VSDARTGKRFPLELPIKIHKGEASGESSGVTGNLSAAG |
JGIcombinedJ26739_1014071973 | 3300002245 | Forest Soil | VSEEARTGKRFPLELPIKLHSDAASGDAKGTTGNLSAA |
Ga0066395_103884481 | 3300004633 | Tropical Forest Soil | VGEEARTGKRFPLELPIKIHKGETDAKGMTGNLSAAGVYIRADAA |
Ga0070710_103487791 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | VSTEARTGKRFPLELPIKIHGLDQGSVTGNMSAAGVYIRGN |
Ga0070694_1005498602 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MTQSFRGGLVSTEARTGKRFPLELPIKIQGVEQGSTTGNMSAAGVYI |
Ga0070684_1003082191 | 3300005535 | Corn Rhizosphere | MSEEARTGKRFPLELPIKIHGESGDDSATTGNMSAAGVYIMADLDLA |
Ga0070730_100157675 | 3300005537 | Surface Soil | VGEEARTGKRFPLELPIKIHKGETGDAKGVTGNLSAAGVY |
Ga0070730_104343783 | 3300005537 | Surface Soil | VSTEARTGKRFPLELPIKIHGVDQGSTTGNMSAAGVYIRGN |
Ga0075017_1005084101 | 3300006059 | Watersheds | MEASYARGGTVTEEARTGKRFPLHLPIKIHGQEASVDASGITGDLSAAGVYIRAD |
Ga0075017_1013572521 | 3300006059 | Watersheds | VTEARTGKRFPLQLPIKIHREDTADDTSSGLTGNLSA |
Ga0070712_1001527605 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEEARTGKRFDLELPIKIHGKGGDDSATTGNMSAAGVYFM |
Ga0066660_112016651 | 3300006800 | Soil | VSEARTGKRFPLELPIKIHKDDSSSDSKGITGNLS |
Ga0079221_105169391 | 3300006804 | Agricultural Soil | VSENRTGKRFPLQLPIRVHKAQAGDEHKAVTGNLSAAGVYIQGDA |
Ga0075434_1014918631 | 3300006871 | Populus Rhizosphere | VSEARTGKRFPLELPIKIHGVEQGSVTGNMSAAGVYIRGNPAL |
Ga0099795_105119271 | 3300007788 | Vadose Zone Soil | MSEEARTGKRFPLELPIMIHGKGGDEGATTGNMSAA |
Ga0105240_102250934 | 3300009093 | Corn Rhizosphere | MIQSSGGHVSTEARTGKRFPLELPIKIHGVDQGSTTGNMSAAGV |
Ga0099792_103287582 | 3300009143 | Vadose Zone Soil | VSEARTGKRFPLELPIKIHGVDQGSVTGNMSAAGVYIRGNAALDL* |
Ga0116128_12053942 | 3300009518 | Peatland | MSEARTGKRFPLHLPIKIHREDTVGDTHTGMTGDLSAAGV |
Ga0105249_122006821 | 3300009553 | Switchgrass Rhizosphere | VSTEARTGKRFPLELPIKIQGVDQGSTTGNMSAASVYIRGNPAL |
Ga0116102_10537442 | 3300009632 | Peatland | VSEARTGKRFPLHLPIKIHREDTAGDTHTGMTGDL |
Ga0116117_11167121 | 3300009635 | Peatland | VSEARTGKRFPLHLPIKIHKEDTAVETSGMTGDLSAAGV |
Ga0116135_12888912 | 3300009665 | Peatland | VSEARTGKRFPLQLPIKIHREDTVDDASSGMTGNLSAAGVYIRA |
Ga0126374_111695251 | 3300009792 | Tropical Forest Soil | VGEEARTGKRFPLELPIKIHKGETGADTKGVTGNLS |
Ga0126370_109673352 | 3300010358 | Tropical Forest Soil | VGEEARTGKRFPLELPIKIHKGETDAKGMTGNLSAAGVYI |
Ga0126376_120975321 | 3300010359 | Tropical Forest Soil | VGEEARTGKRFPLELPIKIHKGETDAKGVTGNLSAAGVY |
Ga0126379_100433595 | 3300010366 | Tropical Forest Soil | VGEEARTGKRFPLELPIKIHKGETGADTKGVTGNLSAAGV |
Ga0134125_112580791 | 3300010371 | Terrestrial Soil | MSEEARTGKRFPLELPIKIHGKGVEDSATTGNMSAAGVY |
Ga0137393_112590521 | 3300011271 | Vadose Zone Soil | VSDARTGKRFPLELPIKIHKAEEGGEHSGVTGDLSAA |
Ga0137378_114831731 | 3300012210 | Vadose Zone Soil | VSEEARTGKRFPVELPIKIHKTDEGTNTSGVTGNLS |
Ga0137372_110652551 | 3300012350 | Vadose Zone Soil | VGEEARTGKRFPLELPIKIHKGETDSKGTTGNLSAAGVYIRAD |
Ga0137371_106452842 | 3300012356 | Vadose Zone Soil | VGEEARTGKRFPLELPIKIHKGESGDAKGVTGNLSAAGVY |
Ga0137361_108548461 | 3300012362 | Vadose Zone Soil | VSEARTGKRFPLHLPIKIHREDTAADASSGMTGNLSAAGV |
Ga0137398_105565431 | 3300012683 | Vadose Zone Soil | VDEARTGKRFPLELPIRIHSGENGTDYKGTTGNLSAA |
Ga0137397_102874412 | 3300012685 | Vadose Zone Soil | VSEEARTGKRFPLELPIKIHQAETSGESKGITGDL |
Ga0137404_103092052 | 3300012929 | Vadose Zone Soil | VSDARTGKRFPLELPIKIHQSEKGGEHKGVTGDLS |
Ga0137404_120960831 | 3300012929 | Vadose Zone Soil | VSDARTGKRFPLELPIKIHKSDQAGEHSGVTGDLSA |
Ga0164303_105042151 | 3300012957 | Soil | MSEEARTGKRFDLELPIKIHGKGGDDSATTGNMSAAGVY |
Ga0164303_109031842 | 3300012957 | Soil | MSEEARTGKRFPLELPIKIHGKSGDDSATTGNMSAAGV |
Ga0164301_114646112 | 3300012960 | Soil | VSTEARTGKRFPLELPIKIQGVEQGSTTGNMSAAGVY |
Ga0164306_119167322 | 3300012988 | Soil | MSEEARTGKRFDLELPIKIHGKGGDDSATTGNMSAAGVYFMA |
Ga0164305_110869941 | 3300012989 | Soil | MSEEARTGKRFPLELPIKIHGKGGDDSATTGNMSAAN |
Ga0157373_105515152 | 3300013100 | Corn Rhizosphere | MIQSSGGHVSTEARTGKRFPLELPIKIHGVDQGSTTGTMSAA |
Ga0157375_129314031 | 3300013308 | Miscanthus Rhizosphere | VSDARTGKRFPLELPIKIHKGEASGESSGVTGNLS |
Ga0181537_111067461 | 3300014201 | Bog | MGKTEGGAVVEEARTGRRFPLELPIKIHKGETGGDASGVTGNLSAAG |
Ga0137411_10838452 | 3300015052 | Vadose Zone Soil | VDEARTGKRFPLELPIRIHRSGNGTDYKGTTGNLSAA |
Ga0132258_134702442 | 3300015371 | Arabidopsis Rhizosphere | MSEEARTGKRFPLELPIKIHGKSGDDSATTGNMSAAGVYIMADL |
Ga0187801_105033381 | 3300017933 | Freshwater Sediment | VGEEARTGKRFPLELPIKIHKGETGGDSEGITGNLSAA |
Ga0187804_103154372 | 3300018006 | Freshwater Sediment | VSEARTGKRFPLQLPIKIHREDAVGDASIGMTGNLSAAGVYIR |
Ga0187805_104358761 | 3300018007 | Freshwater Sediment | VSKARTGKRFPLELPIKIHKAEEGREHDGVTGNLSAAG |
Ga0187873_10129451 | 3300018013 | Peatland | VSEARTGKRFPLQLPIKIHKEDSVGEISSGMTGDLSAAGVYIRA |
Ga0187872_100235464 | 3300018017 | Peatland | VTEARTGKRFPLHLPIKIQKEDSRGEISSGMTGDLSA |
Ga0187889_104339832 | 3300018023 | Peatland | VAEARTGKRFPLQLPIKIHKEDTVGEISSGMTGDL |
Ga0187885_100752711 | 3300018025 | Peatland | VTEARTGKRFPLHLPIKIHKEDSAGEISSGMTGDLSAAGVYIRANA |
Ga0187885_104035991 | 3300018025 | Peatland | VAEARTGKRFPLQLPIKIHKEDTVGEISSGMTGDLSAAGVY |
Ga0187772_110048491 | 3300018085 | Tropical Peatland | VAEARTGKRFPLHLPIKIHKEDSTAEMSGMTGDLS |
Ga0187769_108674162 | 3300018086 | Tropical Peatland | VAEARTGKRFPLHLPIKIHKEDSVGEISSGMTGDLSAAGVYIRAD |
Ga0187770_111437602 | 3300018090 | Tropical Peatland | VAEEARTGKRFPLELPIKIHKGDVDAAGTTGNLSAAG |
Ga0193728_10446901 | 3300019890 | Soil | VSEARTGKRFPLELPIKIQGVDQGSVTGNMSAAGVYIRGNAA |
Ga0193728_11174772 | 3300019890 | Soil | VSEARTGKRFPLELPIKIQGMDQGTVTGNMSAAGVYI |
Ga0206353_115905141 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEEARTGKRFPLELPIKIHGESGDDSATTGNMSAAGVYI |
Ga0210403_101414051 | 3300020580 | Soil | VSEARTGKRFPLELPIKIHKEGASGDAKGTTGDLSAVG |
Ga0210399_101798711 | 3300020581 | Soil | VSEARTGKRFPLQLPIKIHKEDTAGDASGVTGNLRAAGV |
Ga0210399_106636523 | 3300020581 | Soil | VAEARTGKRFPLELPIKIHEENASADTKGLTGNLSAA |
Ga0179596_105057221 | 3300021086 | Vadose Zone Soil | VGEEARTGKRFPLELPIKIHKGEIGGDAEGVTGNLSAAGVYIR |
Ga0210386_117986882 | 3300021406 | Soil | VGEEARTGKRFPLELPIKIHKGELDAAGMTGNLSAAGVFIRADASME |
Ga0224550_10429931 | 3300022873 | Soil | VSEARTGKRFPLHLPIKIHREDTADDASGMTGNLSAA |
Ga0208035_10211162 | 3300025406 | Peatland | VSEARTGKRFPLHLPIKIHKEDTAGEASSGMTGNLSAAGVY |
Ga0207695_113962621 | 3300025913 | Corn Rhizosphere | VSTEARTGKRFPLELPIKIHGVDQGSTTGNMSAAGV |
Ga0207693_110532013 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEEARTGKRFPLELPIKIHGKGGDEGATTGNMSA |
Ga0207690_109731931 | 3300025932 | Corn Rhizosphere | VSTEARTGKRFPLELPIKIQGVEQGSTTGNMSAAGVYIRGNPALDV |
Ga0208140_10254571 | 3300026021 | Rice Paddy Soil | VAENRTGKRFPLQLPIRVHKAQAGDEHKAVTGNLSAAGV |
Ga0207677_102909023 | 3300026023 | Miscanthus Rhizosphere | VSDARTGKRFPLELPIKIHKADVIGDASGVTGNLS |
Ga0207639_106667323 | 3300026041 | Corn Rhizosphere | MSEEARTGKRFPLELPIKIHGKGGEEGATTGNMSAAG |
Ga0207639_116431172 | 3300026041 | Corn Rhizosphere | MSEEARTGKRFPLELPIKIHGKKGDEGGTTANMSAAGV |
Ga0207648_101394731 | 3300026089 | Miscanthus Rhizosphere | VSTEARTGKRFPLELPIKIQGVEQGSTTGNMSAAGVYIRGNTALDV |
Ga0209839_100362841 | 3300026294 | Soil | VAEARTGKRFPLHLPIKIHKEGTAEVDTSGMTGDLSAAGVY |
Ga0255350_11123321 | 3300026502 | Soil | VAEARTGKRFPLHLPIKIHNEDSTAEMSGMTGDLSAA |
Ga0209332_10336351 | 3300027439 | Forest Soil | VSEARTGKRFPLELPIKIHKEGTSGDAKGTTGDLSAA |
Ga0209106_10480191 | 3300027616 | Forest Soil | MSEEARTGKRFPLELPIKIHGKKGDDSATTGNMSAAGVYIMA |
Ga0209007_10866172 | 3300027652 | Forest Soil | VGEEARTGKRFPLELPIKIHKGEPGGDSEGITGNLSAAG |
Ga0208991_10211313 | 3300027681 | Forest Soil | VSEEARTGKRFPLELPIKIHQGEASGDTKGVTGNLS |
Ga0209626_10208931 | 3300027684 | Forest Soil | VSEARTGKRFPLELPIKIHDENASGDTKGLTGNLSAAG |
Ga0209060_103368983 | 3300027826 | Surface Soil | VSEHRTGKRFPLQLPIKIHEADSGAEHKGITSDLSA |
Ga0209693_100051214 | 3300027855 | Soil | VGEEARTGKRFPLELPIKIHQGETGGDAEGITGNLSAAGVYIR |
Ga0209698_101269582 | 3300027911 | Watersheds | VAEEARTGKRFPLELPIKIHKGETGADAKGVTGDLSAAGVYI |
Ga0209526_100473241 | 3300028047 | Forest Soil | VGEEARTGKRFPLELPIKIHKGGKGEVGGDSEGTTGN |
Ga0268264_125260051 | 3300028381 | Switchgrass Rhizosphere | VSTEARTGKRFPLELPIKIQGVEQGSTTGNMSAAGVYIRGKPALDVG |
Ga0265337_12152011 | 3300028556 | Rhizosphere | VGEEARTGKRFPLELPIKIHKGETGGDASGITGNLSAAG |
Ga0302144_100073151 | 3300028560 | Bog | VAEARTGKRFPLQLPIKIHKEDTVGEISSGMTGDLS |
Ga0311329_100715231 | 3300029907 | Bog | VSEARTGKRFPLELPIKIHEEKAGGDTKGLTGNLSA |
Ga0311348_113927171 | 3300030019 | Fen | VGEEARTGKRFPLELPIKIHKGEIDSKGVTGNLSAAGVYIRA |
Ga0310038_101337611 | 3300030707 | Peatlands Soil | VAEEARTGKRFPLELPIKIHKGETGGDASGVTGNLSA |
Ga0068589_117880671 | 3300030979 | Soil | VGEEARTGKRFPLELPIKIHKGEIGGDAEGITGNLSAAGV |
Ga0302180_100795082 | 3300031028 | Palsa | VGEEARTGKRFPLELPIKIHQGETGGDAKGITGNLSA |
Ga0265760_101516531 | 3300031090 | Soil | VSEARTGKRFPLELPIKIHKEGASGDAKGTTGDLSAA |
Ga0302326_122640602 | 3300031525 | Palsa | VSEEARTGKRFPLELPIKLHSEAASGDAKGTTGNL |
Ga0307474_101714682 | 3300031718 | Hardwood Forest Soil | VAEARTGKRFPLHLPIKIHSEDSSAIASGITGDLSAA |
Ga0307475_107748262 | 3300031754 | Hardwood Forest Soil | VGEEARTGKRFPLELPIKIHKGETGGDSEGITGNL |
Ga0308174_106416393 | 3300031939 | Soil | LSSEARTGKRFPLELPIKIHGKRGDDSATTANMSAAGVY |
Ga0310916_110114691 | 3300031942 | Soil | VSEARTGKRFPLELPIKIQGVDQGSVTGNMSAAGVYIRGNPAL |
Ga0306926_120877742 | 3300031954 | Soil | MSEEARTGKRFPLELPIKIHGQGGDDSATTGNMSAAGVYIMAD |
Ga0307479_108805031 | 3300031962 | Hardwood Forest Soil | MSEEARTGKRFDLELPIKIHGKSGDDSATTGNMSAAGVYFMADLDL |
Ga0307471_1029968602 | 3300032180 | Hardwood Forest Soil | VSEARTGKRFPLELPIKIQGVEQGSVTGNMSAAGVYIRGNPALDIG |
⦗Top⦘ |