NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F092296

Metagenome / Metatranscriptome Family F092296

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F092296
Family Type Metagenome / Metatranscriptome
Number of Sequences 107
Average Sequence Length 44 residues
Representative Sequence VLEKLQGYGYAAEGSTPERLLEINRDDLALWRKLVREAGIPLE
Number of Associated Samples 94
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 6.54 %
% of genes near scaffold ends (potentially truncated) 90.65 %
% of genes from short scaffolds (< 2000 bps) 97.20 %
Associated GOLD sequencing projects 89
AlphaFold2 3D model prediction Yes
3D model pTM-score0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.262 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(14.953 % of family members)
Environment Ontology (ENVO) Unclassified
(35.514 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(37.383 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 39.44%    β-sheet: 0.00%    Coil/Unstructured: 60.56%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.45
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF07799DUF1643 19.63
PF07690MFS_1 7.48
PF00355Rieske 6.54
PF01734Patatin 4.67
PF00005ABC_tran 4.67
PF03401TctC 3.74
PF12796Ank_2 2.80
PF13180PDZ_2 2.80
PF04972BON 2.80
PF03328HpcH_HpaI 2.80
PF01844HNH 2.80
PF14833NAD_binding_11 1.87
PF07963N_methyl 1.87
PF13744HTH_37 1.87
PF00270DEAD 1.87
PF00472RF-1 1.87
PF04471Mrr_cat 1.87
PF08378NERD 0.93
PF13365Trypsin_2 0.93
PF01797Y1_Tnp 0.93
PF13544Obsolete Pfam Family 0.93
PF00462Glutaredoxin 0.93
PF13649Methyltransf_25 0.93
PF11604CusF_Ec 0.93
PF10049DUF2283 0.93
PF08450SGL 0.93
PF12848ABC_tran_Xtn 0.93
PF08388GIIM 0.93
PF08309LVIVD 0.93
PF07992Pyr_redox_2 0.93
PF01738DLH 0.93
PF01042Ribonuc_L-PSP 0.93
PF13561adh_short_C2 0.93
PF01144CoA_trans 0.93
PF13470PIN_3 0.93
PF04365BrnT_toxin 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 107 Family Scaffolds
COG4333Uncharacterized conserved protein, DUF1643 domainFunction unknown [S] 19.63
COG1752Predicted acylesterase/phospholipase RssA, containd patatin domainGeneral function prediction only [R] 4.67
COG4667Predicted phospholipase, patatin/cPLA2 familyLipid transport and metabolism [I] 4.67
COG3621Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotRGeneral function prediction only [R] 4.67
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 3.74
COG0469Pyruvate kinaseCarbohydrate transport and metabolism [G] 2.80
COG2301Citrate lyase beta subunitCarbohydrate transport and metabolism [G] 2.80
COG38362-keto-3-deoxy-L-rhamnonate aldolase RhmACarbohydrate transport and metabolism [G] 2.80
COG1186Protein chain release factor PrfBTranslation, ribosomal structure and biogenesis [J] 1.87
COG0216Protein chain release factor RF1Translation, ribosomal structure and biogenesis [J] 1.87
COG2929Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin systemDefense mechanisms [V] 0.93
COG5276Uncharacterized secreted protein, contains LVIVD repeats, choice-of-anchor domainFunction unknown [S] 0.93
COG4670Acyl CoA:acetate/3-ketoacid CoA transferaseLipid transport and metabolism [I] 0.93
COG3391DNA-binding beta-propeller fold protein YncEGeneral function prediction only [R] 0.93
COG3386Sugar lactone lactonase YvrECarbohydrate transport and metabolism [G] 0.93
COG2057Acyl-CoA:acetate/3-ketoacid CoA transferase, beta subunitLipid transport and metabolism [I] 0.93
COG1943REP element-mobilizing transposase RayTMobilome: prophages, transposons [X] 0.93
COG1788Acyl CoA:acetate/3-ketoacid CoA transferase, alpha subunitLipid transport and metabolism [I] 0.93
COG0251Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 familyDefense mechanisms [V] 0.93

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.26 %
UnclassifiedrootN/A3.74 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2162886013|SwBSRL2_contig_4977117Not Available818Open in IMG/M
3300001305|C688J14111_10031298All Organisms → cellular organisms → Bacteria → Proteobacteria1585Open in IMG/M
3300002907|JGI25613J43889_10072058All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium934Open in IMG/M
3300005175|Ga0066673_10377797All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae827Open in IMG/M
3300005175|Ga0066673_10466491All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae743Open in IMG/M
3300005184|Ga0066671_10087988All Organisms → cellular organisms → Bacteria → Proteobacteria1691Open in IMG/M
3300005184|Ga0066671_10750682All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300005186|Ga0066676_11058906All Organisms → cellular organisms → Bacteria → Proteobacteria536Open in IMG/M
3300005187|Ga0066675_11096036All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales595Open in IMG/M
3300005340|Ga0070689_100571812All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales976Open in IMG/M
3300005347|Ga0070668_101522866All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria612Open in IMG/M
3300005459|Ga0068867_100871544All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria808Open in IMG/M
3300005466|Ga0070685_10647715All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria765Open in IMG/M
3300005530|Ga0070679_101811090All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria559Open in IMG/M
3300005545|Ga0070695_100549717All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus900Open in IMG/M
3300006032|Ga0066696_10524119All Organisms → cellular organisms → Bacteria776Open in IMG/M
3300006047|Ga0075024_100844026All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales516Open in IMG/M
3300006224|Ga0079037_101472280All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria679Open in IMG/M
3300006604|Ga0074060_12067161All Organisms → cellular organisms → Bacteria → Proteobacteria1214Open in IMG/M
3300006605|Ga0074057_11162073All Organisms → cellular organisms → Bacteria → Proteobacteria504Open in IMG/M
3300006800|Ga0066660_10320856All Organisms → cellular organisms → Bacteria → Proteobacteria1245Open in IMG/M
3300006853|Ga0075420_100781245All Organisms → cellular organisms → Bacteria → Proteobacteria822Open in IMG/M
3300006853|Ga0075420_101097861All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria684Open in IMG/M
3300007004|Ga0079218_10032243All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria3052Open in IMG/M
3300007258|Ga0099793_10368758All Organisms → cellular organisms → Bacteria703Open in IMG/M
3300007258|Ga0099793_10666162All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium524Open in IMG/M
3300009053|Ga0105095_10124397All Organisms → cellular organisms → Bacteria1403Open in IMG/M
3300009081|Ga0105098_10579050All Organisms → cellular organisms → Bacteria → Proteobacteria582Open in IMG/M
3300009087|Ga0105107_10075004All Organisms → cellular organisms → Bacteria → Proteobacteria2386Open in IMG/M
3300009088|Ga0099830_10269077All Organisms → cellular organisms → Bacteria → Proteobacteria1353Open in IMG/M
3300009089|Ga0099828_11178037All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium680Open in IMG/M
3300009090|Ga0099827_11421096All Organisms → cellular organisms → Bacteria → Proteobacteria604Open in IMG/M
3300009147|Ga0114129_11386906All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria868Open in IMG/M
3300009171|Ga0105101_10083776All Organisms → cellular organisms → Bacteria → Proteobacteria1549Open in IMG/M
3300009233|Ga0103856_10052721All Organisms → cellular organisms → Bacteria726Open in IMG/M
3300009610|Ga0105340_1084054All Organisms → cellular organisms → Bacteria → Proteobacteria1265Open in IMG/M
3300010399|Ga0134127_12629229All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales583Open in IMG/M
3300010401|Ga0134121_10487960All Organisms → cellular organisms → Bacteria1132Open in IMG/M
3300010401|Ga0134121_12531297All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium556Open in IMG/M
3300010403|Ga0134123_13430215All Organisms → cellular organisms → Bacteria → Proteobacteria512Open in IMG/M
3300011402|Ga0137356_1103453All Organisms → cellular organisms → Bacteria → Proteobacteria538Open in IMG/M
3300011421|Ga0137462_1052385All Organisms → cellular organisms → Bacteria → Proteobacteria891Open in IMG/M
3300011430|Ga0137423_1167312All Organisms → cellular organisms → Bacteria → Proteobacteria663Open in IMG/M
3300011430|Ga0137423_1244754All Organisms → cellular organisms → Bacteria → Proteobacteria531Open in IMG/M
3300011435|Ga0137426_1235030All Organisms → cellular organisms → Bacteria → Proteobacteria547Open in IMG/M
3300012038|Ga0137431_1227976All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium523Open in IMG/M
3300012096|Ga0137389_11083516All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium686Open in IMG/M
3300012157|Ga0137353_1079886All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300012163|Ga0137355_1085537All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium607Open in IMG/M
3300012212|Ga0150985_111231250All Organisms → cellular organisms → Bacteria → Proteobacteria1756Open in IMG/M
3300012685|Ga0137397_11362051All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria501Open in IMG/M
3300012925|Ga0137419_11235117All Organisms → cellular organisms → Bacteria → Proteobacteria626Open in IMG/M
3300012925|Ga0137419_11352543All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium600Open in IMG/M
3300012927|Ga0137416_11573544Not Available598Open in IMG/M
3300012927|Ga0137416_11654196All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria583Open in IMG/M
3300012927|Ga0137416_11661376All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium582Open in IMG/M
3300012972|Ga0134077_10072212All Organisms → cellular organisms → Bacteria1304Open in IMG/M
3300012986|Ga0164304_10515985All Organisms → cellular organisms → Bacteria876Open in IMG/M
3300013297|Ga0157378_10603544All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1109Open in IMG/M
3300013297|Ga0157378_12324247All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300013760|Ga0120188_1053140All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium526Open in IMG/M
3300014745|Ga0157377_10934592All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300014871|Ga0180095_1047130Not Available757Open in IMG/M
3300015245|Ga0137409_10229868All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Lautropia → unclassified Lautropia → Lautropia sp.1656Open in IMG/M
3300015245|Ga0137409_10676082All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium866Open in IMG/M
3300018083|Ga0184628_10094413All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1535Open in IMG/M
3300018422|Ga0190265_10855813All Organisms → cellular organisms → Bacteria1032Open in IMG/M
3300018429|Ga0190272_12040739All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium609Open in IMG/M
3300018429|Ga0190272_12091299All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. WSM3983603Open in IMG/M
3300018433|Ga0066667_10872940All Organisms → cellular organisms → Bacteria772Open in IMG/M
3300018476|Ga0190274_13764009All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium513Open in IMG/M
3300019789|Ga0137408_1155204All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1021Open in IMG/M
3300022694|Ga0222623_10345788All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria568Open in IMG/M
3300024177|Ga0247686_1014918All Organisms → cellular organisms → Bacteria850Open in IMG/M
3300024232|Ga0247664_1036739All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1140Open in IMG/M
3300025885|Ga0207653_10238151All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium695Open in IMG/M
3300025885|Ga0207653_10265540All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium660Open in IMG/M
3300025901|Ga0207688_10870678All Organisms → cellular organisms → Bacteria → Proteobacteria571Open in IMG/M
3300025910|Ga0207684_10957529All Organisms → cellular organisms → Bacteria718Open in IMG/M
3300025936|Ga0207670_10558886All Organisms → cellular organisms → Bacteria936Open in IMG/M
3300025941|Ga0207711_10271377All Organisms → cellular organisms → Bacteria → Proteobacteria1561Open in IMG/M
3300026285|Ga0209438_1228731All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium503Open in IMG/M
3300026324|Ga0209470_1273111All Organisms → cellular organisms → Bacteria656Open in IMG/M
3300026327|Ga0209266_1264360All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium547Open in IMG/M
3300026331|Ga0209267_1291929All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300027713|Ga0209286_1140598All Organisms → cellular organisms → Bacteria → Proteobacteria888Open in IMG/M
3300027840|Ga0209683_10420867Not Available613Open in IMG/M
3300027886|Ga0209486_10664077All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300027915|Ga0209069_10907480All Organisms → cellular organisms → Bacteria → Proteobacteria534Open in IMG/M
3300028536|Ga0137415_10498689All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1025Open in IMG/M
3300028608|Ga0247819_10137963All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1262Open in IMG/M
3300028802|Ga0307503_10754800All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium551Open in IMG/M
3300028812|Ga0247825_11380210All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium516Open in IMG/M
3300031170|Ga0307498_10323152All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria584Open in IMG/M
3300031547|Ga0310887_10188640All Organisms → cellular organisms → Bacteria1112Open in IMG/M
3300031740|Ga0307468_101236508All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium676Open in IMG/M
3300032005|Ga0307411_10990778All Organisms → cellular organisms → Bacteria → Proteobacteria752Open in IMG/M
3300032075|Ga0310890_11103403All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium642Open in IMG/M
3300032122|Ga0310895_10351954All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium710Open in IMG/M
3300032157|Ga0315912_10282965All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1306Open in IMG/M
3300032180|Ga0307471_101227043All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium914Open in IMG/M
3300032205|Ga0307472_101618423All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria637Open in IMG/M
3300032782|Ga0335082_10258739All Organisms → cellular organisms → Bacteria → Proteobacteria1621Open in IMG/M
3300032828|Ga0335080_10003480All Organisms → cellular organisms → Bacteria → Proteobacteria15925Open in IMG/M
3300032955|Ga0335076_11008667All Organisms → cellular organisms → Bacteria → Proteobacteria715Open in IMG/M
3300033812|Ga0364926_126934All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300034663|Ga0314784_090965All Organisms → cellular organisms → Bacteria623Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil14.95%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil9.35%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.41%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil5.61%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment4.67%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.74%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.74%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.80%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.80%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.80%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.80%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere2.80%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.80%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.80%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.87%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.87%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.93%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.93%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water0.93%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.93%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.93%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.93%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial0.93%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.93%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.93%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.93%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.93%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.93%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2162886013Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300001305Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300002907Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cmEnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006224Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaGEnvironmentalOpen in IMG/M
3300006604Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006605Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009053Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009087Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009171Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009233Microbial communities of water from Amazon river, Brazil - RCM9EnvironmentalOpen in IMG/M
3300009610Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011402Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT830_2EnvironmentalOpen in IMG/M
3300011421Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT769_2EnvironmentalOpen in IMG/M
3300011430Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2EnvironmentalOpen in IMG/M
3300011435Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2EnvironmentalOpen in IMG/M
3300012038Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012157Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT760_2EnvironmentalOpen in IMG/M
3300012163Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT800_2EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013760Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C3.rep2EnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014871Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231_16_1DaEnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300024177Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK27EnvironmentalOpen in IMG/M
3300024232Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026285Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026327Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes)EnvironmentalOpen in IMG/M
3300026331Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes)EnvironmentalOpen in IMG/M
3300027713Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027840Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028608Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6EnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032122Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4EnvironmentalOpen in IMG/M
3300032157Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soilEnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033812Sediment microbial communities from East River floodplain, Colorado, United States - 65_j17EnvironmentalOpen in IMG/M
3300034663Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
SwBSRL2_0015.000033202162886013Switchgrass RhizosphereGYGYSPEGSTPERLTEINRDDLALWRRLVREANIPLE
C688J14111_1003129813300001305SoilAALKRPEVLEKLQSYGYAAEGSTAERLFEINRDDLALWKKLVAEAGIALE*
JGI25613J43889_1007205833300002907Grasslands SoilVTAVVKRPDVVAKLQSYGYAAESSTPERMWEINRDDLVLWKKLIAEANLALE*
Ga0066673_1037779723300005175SoilKLQSYGYAAEGSTPERLLEINRDDLALWRKLVREANIPLE*
Ga0066673_1046649113300005175SoilVNAALKRPDVLEQLQRYGYAAEGSTPEGLTAINRDDLALWRRLVREAGIALE*
Ga0066671_1008798813300005184SoilVRRPEVVEKMQSYGYAAEGSTPERLFEINRDDLALWRKLIAEARLELD*
Ga0066671_1075068213300005184SoilPEVIERMQSYGYAAEGSTPERLLEINRDDLALWRKLITDAGLELD*
Ga0066676_1105890613300005186SoilKRPDVLEQLQRYGYAAEGSTPEGLTAINRDDLALWRRLVREAGIPLE*
Ga0066675_1109603613300005187SoilVKRPEVIERMQSYGYAAEGSTPERLLEINRDDLALWRKLITDAGLELD*
Ga0070689_10057181213300005340Switchgrass RhizosphereAALKRPDVIEKLLSYGYSPEGSTPERLTEINRDDLALWRRLVREANIPLE*
Ga0070668_10152286623300005347Switchgrass RhizosphereAKLQSYGYSPEGSTPERLLELNRADLELWRRLVKEAGIPLE*
Ga0068867_10087154413300005459Miscanthus RhizosphereDVLEKLQSYGYAAEGSTPERLLEINRADLELWRKLVKEAGIPLE*
Ga0070685_1064771523300005466Switchgrass RhizospherePEMVEKLQSYGYAPEGSTPERLFEINRDDLALWKKLVQQAKLPLE*
Ga0070679_10181109013300005530Corn RhizosphereQRPDVIAKLQSYGYSPEGSTPERLLELNRADLDLWRRLVKEAGIPLE*
Ga0070695_10054971733300005545Corn, Switchgrass And Miscanthus RhizosphereEKLLGYGYSPEGSTPERLTEINRDDLALWRRLVREASIPLE*
Ga0066696_1052411933300006032SoilSYGYAAEGSTPERLFEINRDDLALWRKLIADARIELD*
Ga0075024_10084402613300006047WatershedsPDVLEKLQSYGYAAEGSTPERLLDINREDLALWRRLVREAGIPLE*
Ga0079037_10147228023300006224Freshwater WetlandsVTALKRPEVLDKLLSYGYVVEGSTPEGLATINRDDLVLWRRLVKEAGIPVE*
Ga0074060_1206716123300006604SoilNAALKRPEVLEKLQSYGYAAEGSTPERLFEINRDDLALWRKLVKQAAIPLE*
Ga0074057_1116207323300006605SoilLGYGYSPEGSTPERLLEINRDDLALWRKLVKQAAIPLE*
Ga0066660_1032085623300006800SoilAKLQSYGYAVEGSTPERLLEINRDDLALWRKLVREANIPLE*
Ga0075420_10078124533300006853Populus RhizosphereRPDVIAKLQSYGYSPEGSTPERLLEVNRADLELWRRLVKEAGIPLE*
Ga0075420_10109786123300006853Populus RhizosphereKLLSYGYAAEGSSPERLLEINRDDLALWRKLVGEARIPLE*
Ga0079218_1003224313300007004Agricultural SoilKLQSYGYAAEGSTPERLLEINRADLELWRKLVKEAGIPLE*
Ga0099793_1036875823300007258Vadose Zone SoilNAALKRPDVLEQLQRYGYAAEGSTPEGLTAINRADLALWRKLVAEAGIALE*
Ga0099793_1066616223300007258Vadose Zone SoilPDVLEQLQRYGYAAEGSTPEGLTAINREDLALWRKLVAEAGIALE*
Ga0105095_1012439723300009053Freshwater SedimentMDRLLKAALPRSDVLEKRQGYGYAAEGSTPERLAAIIRDDLALWRRLVHEAGIPLD*
Ga0105098_1057905023300009081Freshwater SedimentVLEKLQGYGYAAEGSTPERLLEINRDDLALWRKLVREAGIPLE*
Ga0105107_1007500433300009087Freshwater SedimentMDRLLKAALPRPDVLEKRQGYGYAAEGSTPERLAAIIRDDLALWRRLVHEAGIPLD*
Ga0099830_1026907713300009088Vadose Zone SoilVLEQLQRYGYAAEGSTPEGLTAINREDLALWRRLVKEAGIPLE*
Ga0099828_1117803713300009089Vadose Zone SoilQRYGYAAEGSTPEGLTAINREDLALWRKLVREAGIPLE*
Ga0099827_1142109613300009090Vadose Zone SoilKRPDVLEQLQRYGYAAEGSTPEGLTAINREDLALWRRLVREAGIPLE*
Ga0114129_1138690623300009147Populus RhizosphereYATEGSTPERVLEINREDLALWRRLVKEAGIPLE*
Ga0105101_1008377633300009171Freshwater SedimentAAILYSDAWKAAMDRLLKAALPRSDVLEKRQGYGYAAEGSTPERLAAIIRDDLALWRRLVHEAGIPLD*
Ga0103856_1005272133300009233River WaterKNFLSFGYAIEGSTPEELAAINRNDLVLWRRLVKEANVTLD*
Ga0105340_108405413300009610SoilNAALKRPDVLEKLQGYGYAAEGSTPERLLEINRDDLALWRKLVREAGIPLD*
Ga0134127_1262922913300010399Terrestrial SoilRADVREKLLSYGYAAEGSTPERLLEINRDDLALWRKLVKEAGIPLE*
Ga0134121_1048796013300010401Terrestrial SoilRPDVIERMQSYGYVAESSTPERLLEINRDDLALWRKLVADAGMALD*
Ga0134121_1253129713300010401Terrestrial SoilGYGFAAEGSTPDGLAAINRDDLALWRRLVREANIPLE*
Ga0134123_1343021513300010403Terrestrial SoilLLSYGYSPEGSTPERLLEINRDDLALWRRLVKEANIPLE*
Ga0137356_110345313300011402SoilLQGYGYAAEGSTPERLLEINRDDLALWRKLVNEAGIPLE*
Ga0137462_105238513300011421SoilGYSAEGSTPERLLEINRDDLALWRKLVKEAGIPLE*
Ga0137423_116731213300011430SoilYGYAAEGSTPERLLEINRDDLALWRKLVREAGIPLE*
Ga0137423_124475413300011430SoilVNAALKRPEVLEKMQSYGYAAEGSTAERLLEINRDDLALWRKLVNEAGIPLE*
Ga0137426_123503013300011435SoilPEVLEKLQGYGYAAEGSTPERLLEINRDDLALWRKLVNQAGIPLE*
Ga0137431_122797623300012038SoilEVNILLKRKDVLDKLQSYGYAAEGSTPERLLEINRADLELWRRLVKEAGIPLE*
Ga0137389_1108351613300012096Vadose Zone SoilVLEQLQRYGYAAEGSTPEGLTAINREDLALWRKLVKEAGIPLE*
Ga0137353_107988623300012157SoilRRPDVLEKLQGYGYAAEGSTPERLAEINRDDLALWRRLVRAAGIPLE*
Ga0137355_108553723300012163SoilVLKRPEVLEKLQSYGYAAEGSTPERLLEINRADLALWRKLVKEAGIPLE*
Ga0150985_11123125033300012212Avena Fatua RhizosphereQSYGYAAEGSTPERLFEINRDDLALWKKLVAEAGIALE*
Ga0137397_1136205123300012685Vadose Zone SoilRPEVLEQLQRYGYAAEGSTPEGLTAINREDLALWRRLVREAGIALE*
Ga0137419_1123511723300012925Vadose Zone SoilEQLQRYGYAAEGSTPEGLTAINRADLALWRKLVAEAGIALE*
Ga0137419_1135254313300012925Vadose Zone SoilRADVREKLQSYGYAAEGSTPERLLEINRDDLALWRKLVREANIPLE*
Ga0137416_1157354413300012927Vadose Zone SoilYAAEGSTPEGLTAINREDLALWRKLVREAGIALE*
Ga0137416_1165419613300012927Vadose Zone SoilRMQSYGYTAEGSTPERLLEINRDDLALWRKLVADAGLALD*
Ga0137416_1166137623300012927Vadose Zone SoilLQRYGYAAEGSTPEGLTAINREDLALWRKLVREAGIPLE*
Ga0134077_1007221223300012972Grasslands SoilLKRPDVLEQLQRYGYAAEGSTPEGLTAINRDDLALWRRLVREAGIPLE*
Ga0164304_1051598523300012986SoilVLEKLQSYGYAAEGSTPERLFEINRDDLALWQKLVKQAAIPLE*
Ga0157378_1060354413300013297Miscanthus RhizosphereKEVNAAVRRPDIAGQLLKYGYQPEGSPPDELLAINRDDLALWRKLVADAKIPLE*
Ga0157378_1232424713300013297Miscanthus RhizosphereTEVNGALKRADVLEKLLSNAYVAEGSTPEGLLAINRDDLALWRKLVKEAGIALD*
Ga0120188_105314023300013760TerrestrialDVLEKLQPYGYAAEGSTPERLAEINRTDLELWRRLVKEAGLPLD*
Ga0157377_1093459213300014745Miscanthus RhizosphereRPEVLEKLQSYGYAAEGSTPERLFEINRDDLALWRKLVAQAGIPLE*
Ga0180095_104713023300014871SoilQTYGYSPEGSTPQGLLEINREDLALWRRLIAEAKLPLE*
Ga0137409_1022986823300015245Vadose Zone SoilNAALKRPEVLEQLQRYGYAAEGSTPEGLTAINREDLALWRKLVREAGIALE*
Ga0137409_1067608233300015245Vadose Zone SoilKMQSYGYAAEGSTPGELYEINRADLALWRKLIADAGLELD*
Ga0184628_1009441313300018083Groundwater SedimentGYSAEGSTPERLLEINRDDLALWRKLVKEAGIPLE
Ga0190265_1085581313300018422SoilKLQSYGYAAEGSTPEGLLEINRVDLELWRKLVKEAGIPLE
Ga0190272_1204073923300018429SoilVAEKLQSYGYSPEGSTPERLVEVNRADLELWRKLVKEAGIPLE
Ga0190272_1209129913300018429SoilNAALKRPDVLEKLQGYGYAAEGSTPERLLEINRDDLALWRKLVREAAIPLE
Ga0066667_1087294023300018433Grasslands SoilVNAALKRPDVLEQLQRYGYAAEGSTPEGLTAINRDDLALWRRLVREAGIPLE
Ga0190274_1376400913300018476SoilLQGYGYAAEGSTPEGLLAINRDDLALWRRLVREANIPLE
Ga0137408_115520453300019789Vadose Zone SoilPLDFGFVKKGPTPEGLLAINRDDLALWRRLVNEAGIPLE
Ga0222623_1034578813300022694Groundwater SedimentALRRPEVLEKLQSYGYSAEGSTPERLLEINRDDLALWRKLVGEAGIPLE
Ga0247686_101491813300024177SoilALKRPDVAEKLLGYGYSPEGSTPERLLEINRDDLALWRKLVKEANIPLE
Ga0247664_103673933300024232SoilGYAPEGSTPERLFEINRDDLALWKKLVQQAKLPLE
Ga0207653_1023815123300025885Corn, Switchgrass And Miscanthus RhizosphereVLPDGKRDVIAKLQSYGYSPEGSTPERLLELNRADLDLWRRLVKEAGIPLE
Ga0207653_1026554013300025885Corn, Switchgrass And Miscanthus RhizosphereQVVEKMQSYGYAAESSTAAELYEINRADLELWRKLIADARLELD
Ga0207688_1087067813300025901Corn, Switchgrass And Miscanthus RhizosphereEKLQSYGYAPEGSTPERLFEINRDDLALWKKLVQQAKLPLE
Ga0207684_1095752923300025910Corn, Switchgrass And Miscanthus RhizosphereKPRSYGYATEGSTPERLLEINRDDLALWRRLVKDAGIPLE
Ga0207670_1055888613300025936Switchgrass RhizosphereIEKLRSYGYATEGSTPERLLEINRNDLALWRRLVKDAGIPLE
Ga0207711_1027137713300025941Switchgrass RhizosphereKLQSYGYAAEGSTPERLFEINRDDLALWRKLVAQAGIPLE
Ga0209438_122873113300026285Grasslands SoilDVVAKLQSYGYAAESSTPERMWEINRDDLVLWKKLIAEANLALE
Ga0209470_127311123300026324SoilVLEQLQRYGYAAEGSTPEGLTAINREDLALWRRLVREAGIPLE
Ga0209266_126436023300026327SoilVLEQLQRYGYAAEGSTPEGLTAINRDDLALWRRLVREASIALE
Ga0209267_129192913300026331SoilSYGYAAEGSTPEGLAAINRDDLALWRRLVREAGIPLE
Ga0209286_114059823300027713Freshwater SedimentMDRLLKAALPRSDVLEKRQGYGYAAEGSTPERLAAIIRDDLALWRRLVHEAGIPLD
Ga0209683_1042086723300027840Wetland SedimentFLGFGYAIEGSTPEELAAINRNDLVLWRKLVKEANVPLE
Ga0209486_1066407713300027886Agricultural SoilLQSYGYAAEGSTPERLLEINRADLELWRKLVKEAGIPLE
Ga0209069_1090748013300027915WatershedsPDVLEKLQSYGYAAEGSTPERLLDINREDLALWRRLVREAGIPLE
Ga0137415_1049868943300028536Vadose Zone SoilQRYGYAAEGSTPEGLTAINRADLALWRKLVAEAGIALE
Ga0247819_1013796313300028608SoilDVIAKLQSYGYSPEGSTPERLLELNRADLDLWRRLVKEAGIPLE
Ga0307503_1075480013300028802SoilRPDVAEQMLKYGYQPEGSTPEGLLEINRADLALWRKLVADAKLPLE
Ga0247825_1138021023300028812SoilQLLRYGYSPEASTPERLLEINREDLALWRKLIVEAKLPLE
Ga0307498_1032315223300031170SoilYGYAAEGSTPERLLEINRDDLALWRKLVKEAGIPLE
Ga0310887_1018864013300031547SoilYGYAAEGTTPERLFEINRDDLALWKKLVAQARIPLE
Ga0307468_10123650823300031740Hardwood Forest SoilAKLQSYGYAAESSTPERMWEINRDDLVLWRKLIADANLALE
Ga0307411_1099077833300032005RhizosphereVIEKLQSYGYSPEGSTPERLLEVNRADLELWRKLVKEAGIPLE
Ga0310890_1110340313300032075SoilLLKKPDVIEKLQSYGYSPEGSTPERLLEVNRADLELWRRLVKEAGIPLE
Ga0310895_1035195413300032122SoilDVIEKLQSYGYSPEGSTPERLLEVNRADLELWRRLVKEAGIPLE
Ga0315912_1028296533300032157SoilQSSGYSPEGSTPERLSEINRDDLVLWRRLVKEAGIPLE
Ga0307471_10122704333300032180Hardwood Forest SoilKMQSYGYAAEASSPERLLEINRDDLALWRKLIAEAGIALD
Ga0307472_10161842323300032205Hardwood Forest SoilEVNAALKRPDVVEKLQSYGYAAEGSTSERLLEINREDLALWRRLVREAGIPLE
Ga0335082_1025873923300032782SoilVSSSRSAAYAAEGSTPEALRAVNREDPALWRKLVKDSGIPLE
Ga0335080_1000348073300032828SoilVSSSRSAAYAAEGSTPEALRAGNREDPALWRKLVKDSGIPLE
Ga0335076_1100866723300032955SoilVSSSRPAAYAAEGSTPEALRAVNREDPALWRKLVKDSGIPLE
Ga0364926_126934_413_5383300033812SedimentEKLQGYGYAAEGSTPERLLEINRADLELWRKLVKEAGIPLE
Ga0314784_090965_3_1343300034663SoilVIEKLQTYGYAAEGSTPERLAEINRDDLALWKKLVAEARIPLE

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.