Basic Information | |
---|---|
Family ID | F092276 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 107 |
Average Sequence Length | 42 residues |
Representative Sequence | MSGYAVAQIDEIDEISDGRCPWRPVRFHFGITSFGVNAFT |
Number of Associated Samples | 95 |
Number of Associated Scaffolds | 107 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 90.57 % |
% of genes near scaffold ends (potentially truncated) | 96.26 % |
% of genes from short scaffolds (< 2000 bps) | 89.72 % |
Associated GOLD sequencing projects | 95 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.44 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (95.327 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (17.757 % of family members) |
Environment Ontology (ENVO) | Unclassified (25.234 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.336 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 14.71% β-sheet: 0.00% Coil/Unstructured: 85.29% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 107 Family Scaffolds |
---|---|---|
PF06224 | HTH_42 | 6.54 |
PF07883 | Cupin_2 | 5.61 |
PF10094 | DUF2332 | 4.67 |
PF14079 | DUF4260 | 2.80 |
PF04828 | GFA | 2.80 |
PF12697 | Abhydrolase_6 | 1.87 |
PF14041 | Lipoprotein_21 | 1.87 |
PF00753 | Lactamase_B | 1.87 |
PF00296 | Bac_luciferase | 1.87 |
PF00005 | ABC_tran | 1.87 |
PF08327 | AHSA1 | 1.87 |
PF13302 | Acetyltransf_3 | 1.87 |
PF12229 | PG_binding_4 | 1.87 |
PF07332 | Phage_holin_3_6 | 0.93 |
PF05988 | DUF899 | 0.93 |
PF06475 | Glycolipid_bind | 0.93 |
PF13181 | TPR_8 | 0.93 |
PF07676 | PD40 | 0.93 |
PF11139 | SfLAP | 0.93 |
PF13649 | Methyltransf_25 | 0.93 |
PF12840 | HTH_20 | 0.93 |
PF13340 | DUF4096 | 0.93 |
PF04545 | Sigma70_r4 | 0.93 |
PF00089 | Trypsin | 0.93 |
PF00300 | His_Phos_1 | 0.93 |
PF07885 | Ion_trans_2 | 0.93 |
PF08808 | RES | 0.93 |
PF13517 | FG-GAP_3 | 0.93 |
PF00355 | Rieske | 0.93 |
PF13360 | PQQ_2 | 0.93 |
PF13396 | PLDc_N | 0.93 |
PF00908 | dTDP_sugar_isom | 0.93 |
PF13369 | Transglut_core2 | 0.93 |
PF02621 | VitK2_biosynth | 0.93 |
PF00155 | Aminotran_1_2 | 0.93 |
PF00282 | Pyridoxal_deC | 0.93 |
PF12680 | SnoaL_2 | 0.93 |
PF13412 | HTH_24 | 0.93 |
PF13376 | OmdA | 0.93 |
PF00583 | Acetyltransf_1 | 0.93 |
PF00775 | Dioxygenase_C | 0.93 |
PF00293 | NUDIX | 0.93 |
COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
---|---|---|---|
COG3214 | DNA glycosylase YcaQ, repair of DNA interstrand crosslinks | Replication, recombination and repair [L] | 6.54 |
COG3791 | Uncharacterized conserved protein | Function unknown [S] | 2.80 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 1.87 |
COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.93 |
COG1427 | Chorismate dehydratase (menaquinone biosynthesis, futalosine pathway) | Coenzyme transport and metabolism [H] | 0.93 |
COG1898 | dTDP-4-dehydrorhamnose 3,5-epimerase or related enzyme | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
COG3485 | Protocatechuate 3,4-dioxygenase beta subunit | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.93 |
COG3554 | Uncharacterized conserved protein | Function unknown [S] | 0.93 |
COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.93 |
COG5654 | Predicted toxin component of a toxin-antitoxin system, contains RES domain | Defense mechanisms [V] | 0.93 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 96.26 % |
Unclassified | root | N/A | 3.74 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459007|GJ61VE201BPBSD | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
2189573000|GPBTN7E01C5MS1 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 503 | Open in IMG/M |
3300000837|AP72_2010_repI_A100DRAFT_1067773 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300000858|JGI10213J12805_10691842 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300000890|JGI11643J12802_11571827 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
3300003659|JGI25404J52841_10070800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 728 | Open in IMG/M |
3300004081|Ga0063454_100160643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1208 | Open in IMG/M |
3300005162|Ga0066814_10094792 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300005179|Ga0066684_10914320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 572 | Open in IMG/M |
3300005435|Ga0070714_100527845 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
3300005466|Ga0070685_10839183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 680 | Open in IMG/M |
3300005526|Ga0073909_10249078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 789 | Open in IMG/M |
3300005764|Ga0066903_101190800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1414 | Open in IMG/M |
3300005764|Ga0066903_103665803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 827 | Open in IMG/M |
3300005764|Ga0066903_107621625 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300005842|Ga0068858_102495385 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 511 | Open in IMG/M |
3300005937|Ga0081455_10363001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1018 | Open in IMG/M |
3300006237|Ga0097621_100083869 | All Organisms → cellular organisms → Bacteria | 2656 | Open in IMG/M |
3300006575|Ga0074053_11695984 | Not Available | 597 | Open in IMG/M |
3300006604|Ga0074060_11481444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 631 | Open in IMG/M |
3300006846|Ga0075430_100041116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3912 | Open in IMG/M |
3300006954|Ga0079219_12118561 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300009148|Ga0105243_12075006 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300009148|Ga0105243_12790130 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300009156|Ga0111538_10738511 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1247 | Open in IMG/M |
3300009156|Ga0111538_14014315 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300009521|Ga0116222_1450991 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300009524|Ga0116225_1274168 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
3300009553|Ga0105249_11726623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → unclassified Conexibacter → Conexibacter sp. S30A1 | 698 | Open in IMG/M |
3300010037|Ga0126304_10000926 | All Organisms → cellular organisms → Bacteria | 13030 | Open in IMG/M |
3300010037|Ga0126304_10539913 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
3300010037|Ga0126304_11018665 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300010040|Ga0126308_10267428 | All Organisms → Viruses → Predicted Viral | 1116 | Open in IMG/M |
3300010041|Ga0126312_10009693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6460 | Open in IMG/M |
3300010045|Ga0126311_10319072 | All Organisms → cellular organisms → Bacteria | 1175 | Open in IMG/M |
3300010166|Ga0126306_10572650 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
3300010362|Ga0126377_11026278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 892 | Open in IMG/M |
3300010366|Ga0126379_13233045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 545 | Open in IMG/M |
3300010371|Ga0134125_11754408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → unclassified Conexibacter → Conexibacter sp. S30A1 | 675 | Open in IMG/M |
3300011998|Ga0120114_1020083 | All Organisms → cellular organisms → Bacteria | 1406 | Open in IMG/M |
3300012232|Ga0137435_1100192 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
3300012285|Ga0137370_10818746 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300012353|Ga0137367_10043180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3422 | Open in IMG/M |
3300012355|Ga0137369_10569575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 791 | Open in IMG/M |
3300012404|Ga0134024_1276641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 693 | Open in IMG/M |
3300012532|Ga0137373_10059059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3522 | Open in IMG/M |
3300012910|Ga0157308_10104485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 841 | Open in IMG/M |
3300012960|Ga0164301_10589161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 819 | Open in IMG/M |
3300012961|Ga0164302_10008783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3851 | Open in IMG/M |
3300012961|Ga0164302_10840305 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
3300012977|Ga0134087_10715739 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300012985|Ga0164308_10013986 | All Organisms → cellular organisms → Bacteria | 4481 | Open in IMG/M |
3300012988|Ga0164306_11656885 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300012989|Ga0164305_10629539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 866 | Open in IMG/M |
3300012989|Ga0164305_11255323 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
3300013102|Ga0157371_11327455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → environmental samples → uncultured Corynebacteriales bacterium | 557 | Open in IMG/M |
3300013296|Ga0157374_10365678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → environmental samples → uncultured Corynebacteriales bacterium | 1435 | Open in IMG/M |
3300013772|Ga0120158_10469649 | Not Available | 562 | Open in IMG/M |
3300014056|Ga0120125_1067226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 805 | Open in IMG/M |
3300014272|Ga0075327_1091248 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
3300015077|Ga0173483_10360417 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
3300015371|Ga0132258_13771946 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1033 | Open in IMG/M |
3300015372|Ga0132256_100785056 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
3300015372|Ga0132256_101897909 | Not Available | 703 | Open in IMG/M |
3300015373|Ga0132257_103770699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 551 | Open in IMG/M |
3300016270|Ga0182036_11461854 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300016357|Ga0182032_10324561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1224 | Open in IMG/M |
3300017787|Ga0183260_10237062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1264 | Open in IMG/M |
3300017944|Ga0187786_10452071 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300017966|Ga0187776_10243203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1148 | Open in IMG/M |
3300017999|Ga0187767_10189021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 643 | Open in IMG/M |
3300018052|Ga0184638_1083517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1171 | Open in IMG/M |
3300018072|Ga0184635_10117588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1056 | Open in IMG/M |
3300018422|Ga0190265_10376651 | All Organisms → cellular organisms → Bacteria | 1512 | Open in IMG/M |
3300018422|Ga0190265_13806203 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300018469|Ga0190270_11207035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 795 | Open in IMG/M |
3300018469|Ga0190270_12751849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei → Conexibacter woesei DSM 14684 | 555 | Open in IMG/M |
3300018476|Ga0190274_13830205 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300018481|Ga0190271_13622574 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300019884|Ga0193741_1006019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3230 | Open in IMG/M |
3300021403|Ga0210397_11085794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 622 | Open in IMG/M |
3300021445|Ga0182009_10700982 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300021510|Ga0222621_1134755 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 526 | Open in IMG/M |
3300022898|Ga0247745_1092151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 517 | Open in IMG/M |
3300025556|Ga0210120_1109369 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300025796|Ga0210113_1051395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 829 | Open in IMG/M |
3300025914|Ga0207671_10246933 | All Organisms → cellular organisms → Bacteria | 1403 | Open in IMG/M |
3300025917|Ga0207660_10232100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1451 | Open in IMG/M |
3300025927|Ga0207687_10025610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3947 | Open in IMG/M |
3300025931|Ga0207644_11053324 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
3300025937|Ga0207669_11082798 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300025972|Ga0207668_12001590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 522 | Open in IMG/M |
3300025981|Ga0207640_10107321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1971 | Open in IMG/M |
3300026121|Ga0207683_11602241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 600 | Open in IMG/M |
3300026550|Ga0209474_10743836 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300027662|Ga0208565_1107264 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
3300028379|Ga0268266_11727404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → environmental samples → uncultured Corynebacteriales bacterium | 601 | Open in IMG/M |
3300028589|Ga0247818_11425239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 500 | Open in IMG/M |
3300028744|Ga0307318_10043357 | All Organisms → cellular organisms → Bacteria | 1482 | Open in IMG/M |
3300030006|Ga0299907_10385803 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
3300030006|Ga0299907_10460331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer | 1012 | Open in IMG/M |
3300031720|Ga0307469_10858301 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
3300031846|Ga0318512_10077895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1527 | Open in IMG/M |
3300031908|Ga0310900_10508579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 937 | Open in IMG/M |
3300031938|Ga0308175_100800661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1031 | Open in IMG/M |
3300032039|Ga0318559_10273683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 782 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 17.76% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 7.48% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.74% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.74% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.74% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.80% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.80% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.80% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.80% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.80% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.80% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.80% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.80% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.80% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.87% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.87% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.87% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.87% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 1.87% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.87% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.87% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.87% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.87% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.93% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.93% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.93% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.93% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.93% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.93% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.93% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.93% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.93% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.93% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.93% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.93% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.93% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.93% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.93% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.93% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.93% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.93% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459007 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 10-21cm | Environmental | Open in IMG/M |
2189573000 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms) | Environmental | Open in IMG/M |
3300000837 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100 | Environmental | Open in IMG/M |
3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300005162 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006604 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300011998 | Permafrost microbial communities from Nunavut, Canada - A30_35cm_6M | Environmental | Open in IMG/M |
3300012232 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2 | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012404 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
3300014056 | Permafrost microbial communities from Nunavut, Canada - A20_5cm_0M | Environmental | Open in IMG/M |
3300014272 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1 | Environmental | Open in IMG/M |
3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300017787 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2) | Environmental | Open in IMG/M |
3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300019884 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2 | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300021510 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex | Environmental | Open in IMG/M |
3300022898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5 | Environmental | Open in IMG/M |
3300025556 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025796 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
L02_01726440 | 2170459007 | Grass Soil | MAGYQVARLDEIEEVSDGRCPLRPVRHRFGITSFGVN |
N55_08385940 | 2189573000 | Grass Soil | MSGYAVARIDEIDEIDDGRVLSRPVRFHFGITSFGVNA |
AP72_2010_repI_A100DRAFT_10677731 | 3300000837 | Forest Soil | MSGYAVARIDEIDEIDDGRVPARPVRFHFGITSFGVNAFTAHQVGDRLIN |
JGI10213J12805_106918421 | 3300000858 | Soil | MSGYAVAQIDEIDEIDDGRVPSRPIRFHFGITSFGVNAFTAHQV |
JGI11643J12802_115718271 | 3300000890 | Soil | MSGYAVAQIDGIDEINDGRCPWRPVRFHFGITSFG |
JGI25404J52841_100708002 | 3300003659 | Tabebuia Heterophylla Rhizosphere | MSGYAVARIDAIDEIDDGRVLSRPVRFHFGITSFGVNAFTAHQVGD |
Ga0063454_1001606432 | 3300004081 | Soil | MTRYAAERLDEIDEVSDGRCPFRPVRQHFGITSFGVNAWTAR |
Ga0066814_100947921 | 3300005162 | Soil | MSGYAVAQVDEIDEISDGRCPWRPVRFHFGITSFGVNAFTAH |
Ga0066684_109143201 | 3300005179 | Soil | MSGYAVAHLDDIDEVSDGRCPWRPVRHRFGITSFGVNAWTARDVGDRIINEH |
Ga0070714_1005278451 | 3300005435 | Agricultural Soil | MTTFRAAHLDDIDEINDGRCPARAVRHHFGITSFGINVWTGA |
Ga0070685_108391831 | 3300005466 | Switchgrass Rhizosphere | MTRYAVARLEEIDELTDGREPFRPVRYHFGITSFGVNTWTGR |
Ga0073909_102490782 | 3300005526 | Surface Soil | MSGYAVAQIDEIDEISDGRCPWRPVGFHFGLTAFGVNAFTGHE |
Ga0066903_1011908001 | 3300005764 | Tropical Forest Soil | MADYEVTALDEIDEISDGRCPVRPVRAHFGITAFG |
Ga0066903_1036658031 | 3300005764 | Tropical Forest Soil | VNRRLRRVDGYRVASLDEIEELNDGRQPWQPVRHHFGITSFG |
Ga0066903_1076216251 | 3300005764 | Tropical Forest Soil | MSEYSVTHVDAIDEVNDGRVPWRPVRAHFGIQSFGINAWTA |
Ga0068858_1024953851 | 3300005842 | Switchgrass Rhizosphere | MTDYSVSKLSEIEIISDGRCPWRPVRHHFGITSFGVNAFTGT |
Ga0081455_103630013 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MSGYAVARIDEIDEIDDGRVLSRPVRFHFGITSFGVNAFTAHQVG |
Ga0097621_1000838691 | 3300006237 | Miscanthus Rhizosphere | MSNYAVAKLDDIAEQSDGRCPWRPVRRHFGITSFGANAWTG |
Ga0074053_116959841 | 3300006575 | Soil | MSGYAVAQVDGIDEISDGRCPWRPVGFHFGITSFGVNAFTGREVVPGE |
Ga0074060_114814442 | 3300006604 | Soil | MSDYAVVQIDGIDEITDGRCPWRPVGFHFGLTAFGVNAFTGHE |
Ga0075430_1000411161 | 3300006846 | Populus Rhizosphere | MSGYAVTQIDEIDEINDGRVPSRPIRFHFGITSFGVNA |
Ga0079219_121185612 | 3300006954 | Agricultural Soil | MSSYAVATLDQIEEIDDGRSPWRPVRMHFGIQSFGINAFTGKDA |
Ga0105243_120750062 | 3300009148 | Miscanthus Rhizosphere | MTRYAVARLEEIDELTDGREPFRPVRYHFGITSFGVNAWTGRDVGD |
Ga0105243_127901302 | 3300009148 | Miscanthus Rhizosphere | MAGFATAHLDDIDEITDGRCPWRPVRQHFGIQSFGVNAWTG |
Ga0111538_107385113 | 3300009156 | Populus Rhizosphere | MSGYAVAQIGEIDEISDGRCPRRPVRFHFGITSFGVNAFTAHQVGDRLINEH |
Ga0111538_140143151 | 3300009156 | Populus Rhizosphere | MSGYAVAQIDEIDELDDGRVPSRPIRFHFGITSFGVNAFTAREVGDR |
Ga0116222_14509912 | 3300009521 | Peatlands Soil | MSRYAVAYLDEIDEVSDGHYPSRPVRYHFGITSFGVNAWT |
Ga0116225_12741683 | 3300009524 | Peatlands Soil | MAHLHEIDEISDGRCPSRPIRYRFGITSFGINAWTGREVGDR* |
Ga0105249_117266233 | 3300009553 | Switchgrass Rhizosphere | MSGYAVARIHEIDEISDGRCPWRPVRFHFGITSFG |
Ga0126307_102468923 | 3300009789 | Serpentine Soil | MSGYAITHRDDIEVIDDGRCPWRPVRHHFGITSFGVGEW |
Ga0126304_1000092616 | 3300010037 | Serpentine Soil | MNGYAVAEIDEIDEIDDGRVLSRPVRFHFGITSFGVNAFTAHQVGDRL |
Ga0126304_105399131 | 3300010037 | Serpentine Soil | MNGYAVAQIEEIDEIDDGRVLSRPVRFHFGITSFGVNAFTAHQV |
Ga0126304_110186651 | 3300010037 | Serpentine Soil | MNGYAVAQIDEIDEIDDGRVLSRPVRFHFGITSFGVNAFTAH |
Ga0126308_102674281 | 3300010040 | Serpentine Soil | MNGYAVAEIDEIDEIDDGRVLSRPVRFHFGITSFGVNAFTA |
Ga0126312_100096931 | 3300010041 | Serpentine Soil | MNGYAVAQIDEIDEIDDGRVLSRPVRFHFGITSFGVNAFTAHQVG |
Ga0126311_103190721 | 3300010045 | Serpentine Soil | VSGYAVTHLDEINELDDGRSPMRPIRHHFGITSFGVNA |
Ga0126306_105726501 | 3300010166 | Serpentine Soil | MSGYAVARIDEIDEIDDGRVPSRPVRFHFGITSFGVNAFTAHQVGDRLINEH |
Ga0126377_110262783 | 3300010362 | Tropical Forest Soil | LSDYSVANIDDIDEAGEGRCPWRPVRHRFGITSFSVATWTGRAVGDRIIDEDDE |
Ga0126379_132330452 | 3300010366 | Tropical Forest Soil | MSTYAVSRLEEIDEITDGRCPWRPVRLHFDIRSFGANA |
Ga0134125_117544082 | 3300010371 | Terrestrial Soil | MSTYKVAQLEEIEEITDGRCPWRPVRKHFGIMSFGINAWTAPNAGD |
Ga0120114_10200833 | 3300011998 | Permafrost | MSRYAVTQLTEIDEINDGRCPLRPVRHHFGIMSFGVN |
Ga0137435_11001921 | 3300012232 | Soil | VSYEIARLDEFEEITDGRCPWRPVRNHFGISSFGVNVWTGQ |
Ga0137370_108187462 | 3300012285 | Vadose Zone Soil | MSGYSVAQLDQIDEVSDGRCPWRPIRQHFGILSFGANAFTAREAGERLI |
Ga0137367_100431805 | 3300012353 | Vadose Zone Soil | MSGYAAARIDEIDEIDDGRVLSRPVRFHFGITSFGVNAFTAHQVGDRLIN |
Ga0137369_105695751 | 3300012355 | Vadose Zone Soil | MSGYAAARIDEIDEIDDGRVLSRPVRFHFGITSFGVNAFTAHQVGDR |
Ga0134024_12766411 | 3300012404 | Grasslands Soil | VSNYAVARLDEIEVVDDGREPMRPVRHHFGIQAFGVNT |
Ga0137373_100590596 | 3300012532 | Vadose Zone Soil | MSGYAAARIDEIDEIDDGRVLSRPVRFHFGITSFGVNAFTAH |
Ga0157308_101044851 | 3300012910 | Soil | VTDYSVAQLHEIEVLDDGRCPWRPVRHHFGITSFGVNAFTGQNV |
Ga0164301_105891613 | 3300012960 | Soil | MSDYAVATLDQIDEMEDGRCPWRPVRAHFGITSFGINAFTG |
Ga0164302_100087831 | 3300012961 | Soil | MSDYAAVQIDEIDEIHDGRCPYRPVRFHFGVTSFGINAFTG |
Ga0164302_108403052 | 3300012961 | Soil | MSNYAVAKLDDIAEQSDGRCPWRPVRGHFGITSFGANAWTGKS |
Ga0134087_107157391 | 3300012977 | Grasslands Soil | MDGYAVAHVDEIGELDDGRAPMRAVRHHFGITSFGVNA* |
Ga0164308_100139867 | 3300012985 | Soil | MSGYEVARLDDIAEENDGRCPWRSVRRHFDITSFGANAWT |
Ga0164306_116568851 | 3300012988 | Soil | MSAHSFARLDDIDETTDGRQPWRPLRQHFGITSFGVNAWTAAAAGDRVLNE |
Ga0164305_106295392 | 3300012989 | Soil | MSNYTAATLDDIDEMDDGRCPWRPVRAHFGITSFGINAFTGK |
Ga0164305_112553231 | 3300012989 | Soil | MSNYAVAKLDDIAEQSDGRCPWRPVRRHFGITSFGAN |
Ga0157371_113274552 | 3300013102 | Corn Rhizosphere | VTDYTVARLDEIDEISDGRVPWRPLRHHFGITSFGVN |
Ga0157374_103656784 | 3300013296 | Miscanthus Rhizosphere | MTDYSVSKLSEIEIISDGRCPWRPVRHHFGITSFGVN |
Ga0120158_104696491 | 3300013772 | Permafrost | MSGYRVARLDEVEEVSDGRRPWRALRKHFGITSFGVN |
Ga0120125_10672261 | 3300014056 | Permafrost | MDRYAVAHVDEIGELDDGRAPMRAVRHHFGITSFGVNAWIA |
Ga0075327_10912482 | 3300014272 | Natural And Restored Wetlands | MSGYAVAQIDGIDEIDDGRVLSRPVRFHFGITSFGVN |
Ga0173483_103604172 | 3300015077 | Soil | MPAYTVAHLTEIDEIDDGRCRFRPIRHSLGIASFGVNAWTAREAGDRII |
Ga0132258_137719462 | 3300015371 | Arabidopsis Rhizosphere | MSAYAVAQIHEIDEISDGRCPWRPVRFHFGITSFGV |
Ga0132256_1007850561 | 3300015372 | Arabidopsis Rhizosphere | MNGYAVAQIDEIDEINDGRVPSRPIRFHFGITSFGVN |
Ga0132256_1018979091 | 3300015372 | Arabidopsis Rhizosphere | MSGYAVARIEEIDEIHDGRVPSRPIRFHFGIASFGVNAFTAH |
Ga0132257_1037706991 | 3300015373 | Arabidopsis Rhizosphere | MSGYAVARIEEIDEIHDGRVPSRPIRFHFGIASFGVNAFTAHRV |
Ga0182036_114618541 | 3300016270 | Soil | MSGYAAARIDEIDEIDDGRVLSRPVRFHFGITSFGVNAFTGH |
Ga0182032_103245613 | 3300016357 | Soil | MSYSVKRFDEIEEIDDGRAPFRPVRHHFGITSFGV |
Ga0183260_102370623 | 3300017787 | Polar Desert Sand | MNGYAVAQIDEIDEITDGRCPWRPVRFHFGITSFGVNAFTAHRVGDRLIN |
Ga0187786_104520712 | 3300017944 | Tropical Peatland | MSGYAVAQIDEIDEISDGRCPWRPVRFHFGITSFGVNAFT |
Ga0187776_102432032 | 3300017966 | Tropical Peatland | MDGYAVAHVDEIGELDDGRAPMRAVRHHFGITSFGVNAWI |
Ga0187767_101890212 | 3300017999 | Tropical Peatland | MSYAVAHLDDIDEISDGRCPSRPIRYHFGITSFGVNAWTGREVGDRIINE |
Ga0184638_10835172 | 3300018052 | Groundwater Sediment | MSGYALAQIDEIDEIDDGRVLSRPVRFHFGITSFG |
Ga0184635_101175882 | 3300018072 | Groundwater Sediment | MSGYAVAQIDEIDEIDDGRVLSRPVRFHFGITSFGVNAFTAHQVGDRLIN |
Ga0190265_103766512 | 3300018422 | Soil | VATYATARLEEIDALPDGRYRYRPVRHHFGITSFGVTA |
Ga0190265_138062031 | 3300018422 | Soil | MSGYAVAQIDEINDGRVPSRPIRFHFGITSFGVNAFTAHQV |
Ga0190270_112070351 | 3300018469 | Soil | LSGYAVAQIDGIDEISDGRCPWRPVRFHFGITSFGVNAFTAHQVGDRLIN |
Ga0190270_127518492 | 3300018469 | Soil | MSGYAVAQIDGIDEISDGRCPWRPVRFHFGITSFGVN |
Ga0190274_138302051 | 3300018476 | Soil | MSGYAVAQIDGIDEISDGRCPWRPVRFHFGITSFGVNA |
Ga0190271_136225741 | 3300018481 | Soil | MSGYAVARIDEIDEIDDGRVLARPVRFHFGITSFGVNAFTAHQVG |
Ga0193741_10060191 | 3300019884 | Soil | MSGYAVARIDEIDEIDDGRVLSRPVRFHFGITSFGVNAFTAHQVGD |
Ga0210397_110857942 | 3300021403 | Soil | MSRYAVAHLEEIDEITDGRCPSRPIRMHFGITSFGANAWTGREAG |
Ga0182009_107009821 | 3300021445 | Soil | VTDYEVRHLDDIEEITDGRCPWRPVRHEFGITSFGVNAWIAREAGDRLINEH |
Ga0222621_11347551 | 3300021510 | Groundwater Sediment | MSNYAVAKIDAIDEVSDGRCPWRPVRHHFGITSFGVNA |
Ga0247745_10921511 | 3300022898 | Soil | VTDYSVAQLHEIEVLDDGRCPWRPVRHHFGITSFGV |
Ga0210120_11093692 | 3300025556 | Natural And Restored Wetlands | MGGYAVAKIDEIDEISDGRCPWRPVRFHFGITSFGVNAFTAHQVGDRLI |
Ga0210113_10513951 | 3300025796 | Natural And Restored Wetlands | MSGYAVAQIDEIDEISDGRCPWRPVRFHFGITSFGVNAFTAH |
Ga0207671_102469331 | 3300025914 | Corn Rhizosphere | VVAAYSVTRFDAIDEIDDGRAPYRPVRHHFGITSFGA |
Ga0207660_102321001 | 3300025917 | Corn Rhizosphere | MSEYAVARIDEIDEISDGRCPYRPVRFHFGITSFG |
Ga0207687_100256106 | 3300025927 | Miscanthus Rhizosphere | MSGYAVARIDEIDEIDDGRVLSRPVRFHFGITSFGVNAFTAHQMGDRLINEH |
Ga0207644_110533241 | 3300025931 | Switchgrass Rhizosphere | MSDYAAAQIDEIDEINDGRCPYRPVRFHFGVTSFGINAFTG |
Ga0207669_110827982 | 3300025937 | Miscanthus Rhizosphere | MTRYAVARLEEIDELTDGREPFRPVRYHFGITSFGVNTWT |
Ga0207668_120015902 | 3300025972 | Switchgrass Rhizosphere | VTTTGRGLVNGYAVAQLDEIDEQDDGRCPWRSVGHHFGIAGFGVNAWT |
Ga0207640_101073213 | 3300025981 | Corn Rhizosphere | MTRYAVARLEEIDELTDGREPFRPVRYHFGITSFGVNTWTGRDV |
Ga0207683_116022412 | 3300026121 | Miscanthus Rhizosphere | MSEYTVARIDEIDELSDGRCPFRPVRKHFGIMSFGVNT |
Ga0209474_107438361 | 3300026550 | Soil | MSGYAVAHLDDIDEVSDGRCPWRPVRHRFGITSFGVNAWTARDVGDRIINEHVEV |
Ga0208565_11072641 | 3300027662 | Peatlands Soil | MAGFAVARLDEIDEIDDGRRPFRPVRLHFGIMTFGVTAVTAHS |
Ga0268266_117274042 | 3300028379 | Switchgrass Rhizosphere | MTDYSVSKLSEIEIISDGRCPWRPVRHHFGITSFGVNAFTG |
Ga0247818_114252392 | 3300028589 | Soil | MTRYAVARLEEIDELTDGREPFRPVRYHFGITSFGVN |
Ga0307318_100433573 | 3300028744 | Soil | MSGYAVAQIDEIDEIDDGRVLSRPVRFHFGITSFGVNAFTAHQVGDRL |
Ga0299907_103858032 | 3300030006 | Soil | MSGYAVAQIDEIDEISDGRCPWRPVRFHFGITSFGVNAFTAHQK |
Ga0299907_104603311 | 3300030006 | Soil | MNGYAVAQIDEIDEIDDGRVLSRPVRFHFGITSFGVNAFTAHQVGDRLI |
Ga0307469_108583011 | 3300031720 | Hardwood Forest Soil | MSGYAVAQIDEIDEIDDGRVLSRPVRFHFGITSFGVNAFTA |
Ga0318512_100778953 | 3300031846 | Soil | MSYSVKRFDEIEEIDDGRAPFRPVRHHFGITSFGVNSF |
Ga0310900_105085791 | 3300031908 | Soil | MSGYAVAQIDEIDEISDGRCPWRPVRFHFGITSFGVNAFTAHQVGDRLINE |
Ga0308175_1008006611 | 3300031938 | Soil | MSGYAVAQIDEIDEIDDGRVLSRPVRFHFRITSFGVNAF |
Ga0318559_102736832 | 3300032039 | Soil | VSYRAARLEEIEVIDDGRCPFRPVRYHFGIAAFGVNSW |
⦗Top⦘ |