NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F092248

Metagenome / Metatranscriptome Family F092248

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F092248
Family Type Metagenome / Metatranscriptome
Number of Sequences 107
Average Sequence Length 57 residues
Representative Sequence LLRLLLPLSDMVYLIFRIRHETSRSPKGSPDHSKSVGATGGVYKGQGLNQRKLMTCAY
Number of Associated Samples 103
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 92.45 %
% of genes near scaffold ends (potentially truncated) 18.69 %
% of genes from short scaffolds (< 2000 bps) 73.83 %
Associated GOLD sequencing projects 101
AlphaFold2 3D model prediction Yes
3D model pTM-score0.30

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (91.589 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(14.953 % of family members)
Environment Ontology (ENVO) Unclassified
(24.299 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(28.037 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 25.58%    β-sheet: 0.00%    Coil/Unstructured: 74.42%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.30
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms91.59 %
UnclassifiedrootN/A8.41 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2077657000|ZODLETONE_B1_GLDH0LQ01AKFDCAll Organisms → cellular organisms → Eukaryota507Open in IMG/M
2209111012|le_contig00389.2750All Organisms → cellular organisms → Eukaryota577Open in IMG/M
3300004567|Ga0066495_147461All Organisms → cellular organisms → Eukaryota505Open in IMG/M
3300004763|Ga0007746_1044540All Organisms → cellular organisms → Eukaryota836Open in IMG/M
3300006037|Ga0075465_10118074All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella594Open in IMG/M
3300006237|Ga0097621_101197041All Organisms → cellular organisms → Eukaryota715Open in IMG/M
3300006355|Ga0075501_1054221All Organisms → cellular organisms → Eukaryota1686Open in IMG/M
3300006355|Ga0075501_1057403All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida703Open in IMG/M
3300006355|Ga0075501_1083556All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1024Open in IMG/M
3300006357|Ga0075502_1088473All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella802Open in IMG/M
3300006372|Ga0075489_1046515All Organisms → cellular organisms → Eukaryota668Open in IMG/M
3300006374|Ga0075512_1071117Not Available1104Open in IMG/M
3300006379|Ga0075513_1059062All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1009Open in IMG/M
3300006383|Ga0075504_1041633All Organisms → cellular organisms → Eukaryota1023Open in IMG/M
3300006384|Ga0075516_1063612Not Available833Open in IMG/M
3300006390|Ga0075509_1028722All Organisms → cellular organisms → Eukaryota1128Open in IMG/M
3300006401|Ga0075506_1069919All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta771Open in IMG/M
3300006419|Ga0075496_1056615All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1366Open in IMG/M
3300006687|Ga0031697_1017139All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida543Open in IMG/M
3300006691|Ga0031679_1011457All Organisms → cellular organisms → Eukaryota2904Open in IMG/M
3300006728|Ga0031676_1021920All Organisms → cellular organisms → Eukaryota787Open in IMG/M
3300006803|Ga0075467_10401519All Organisms → cellular organisms → Eukaryota713Open in IMG/M
3300006804|Ga0079221_11718973All Organisms → cellular organisms → Eukaryota → Sar512Open in IMG/M
3300006931|Ga0097620_102948112All Organisms → cellular organisms → Eukaryota521Open in IMG/M
3300006954|Ga0079219_11802323All Organisms → cellular organisms → Eukaryota573Open in IMG/M
3300007181|Ga0099781_1023748All Organisms → cellular organisms → Eukaryota842Open in IMG/M
3300007233|Ga0075178_1053998All Organisms → cellular organisms → Eukaryota722Open in IMG/M
3300007516|Ga0105050_10043870All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida3347Open in IMG/M
3300009009|Ga0105105_10079430All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1544Open in IMG/M
3300009144|Ga0058702_10381509All Organisms → cellular organisms → Eukaryota576Open in IMG/M
3300009183|Ga0114974_10509665Not Available674Open in IMG/M
3300009502|Ga0114951_10026799All Organisms → cellular organisms → Eukaryota3762Open in IMG/M
3300009502|Ga0114951_10061390All Organisms → cellular organisms → Eukaryota2230Open in IMG/M
3300009684|Ga0114958_10118355All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1357Open in IMG/M
3300009695|Ga0123337_10016256All Organisms → cellular organisms → Eukaryota6079Open in IMG/M
3300009697|Ga0116231_10110265All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ichthyostraca → Branchiura → Arguloida → Argulidae → Argulus → Argulus foliaceus1676Open in IMG/M
3300009787|Ga0116226_10466642All Organisms → cellular organisms → Eukaryota1281Open in IMG/M
3300010029|Ga0105074_1090739All Organisms → cellular organisms → Eukaryota571Open in IMG/M
3300010157|Ga0114964_10446767All Organisms → cellular organisms → Eukaryota609Open in IMG/M
3300010374|Ga0114986_1095195All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella539Open in IMG/M
3300010388|Ga0136551_1002439All Organisms → cellular organisms → Eukaryota4533Open in IMG/M
3300011000|Ga0138513_100071003All Organisms → cellular organisms → Eukaryota537Open in IMG/M
3300011340|Ga0151652_11511904All Organisms → cellular organisms → Eukaryota662Open in IMG/M
3300012469|Ga0150984_103199666All Organisms → cellular organisms → Eukaryota596Open in IMG/M
3300012955|Ga0164298_10004240All Organisms → cellular organisms → Eukaryota4977Open in IMG/M
3300012987|Ga0164307_10006328All Organisms → cellular organisms → Eukaryota5568Open in IMG/M
3300013087|Ga0163212_1067962All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1172Open in IMG/M
(restricted) 3300013132|Ga0172372_10037618All Organisms → cellular organisms → Eukaryota4973Open in IMG/M
3300014493|Ga0182016_10315393All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida951Open in IMG/M
3300014499|Ga0182012_10091019All Organisms → cellular organisms → Eukaryota2316Open in IMG/M
3300016796|Ga0186337_105748All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella589Open in IMG/M
3300017754|Ga0181344_1154504All Organisms → cellular organisms → Eukaryota654Open in IMG/M
3300017958|Ga0181582_10855969Not Available537Open in IMG/M
3300017967|Ga0181590_10178388Not Available1609Open in IMG/M
3300017970|Ga0187783_11135217All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi563Open in IMG/M
3300018001|Ga0187815_10356610All Organisms → cellular organisms → Eukaryota621Open in IMG/M
3300018038|Ga0187855_10093937All Organisms → cellular organisms → Eukaryota1817Open in IMG/M
3300018042|Ga0187871_10738027All Organisms → cellular organisms → Eukaryota548Open in IMG/M
3300018422|Ga0190265_11043355All Organisms → cellular organisms → Eukaryota939Open in IMG/M
3300018565|Ga0188826_103399All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1254Open in IMG/M
3300018565|Ga0188826_104147All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1169Open in IMG/M
3300018891|Ga0193610_1014846All Organisms → cellular organisms → Eukaryota2136Open in IMG/M
3300020190|Ga0194118_10071989All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida2189Open in IMG/M
3300020204|Ga0194116_10149006All Organisms → cellular organisms → Eukaryota1407Open in IMG/M
3300020221|Ga0194127_10018366All Organisms → cellular organisms → Eukaryota6505Open in IMG/M
3300020372|Ga0211683_10035946All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1658Open in IMG/M
3300021389|Ga0213868_10153596All Organisms → cellular organisms → Eukaryota1421Open in IMG/M
3300021560|Ga0126371_11510986All Organisms → cellular organisms → Eukaryota800Open in IMG/M
3300022742|Ga0206117_101787All Organisms → cellular organisms → Eukaryota9879Open in IMG/M
3300022745|Ga0228698_1005141All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida4688Open in IMG/M
3300022751|Ga0247817_10032795All Organisms → cellular organisms → Eukaryota2090Open in IMG/M
3300023048|Ga0233341_1009964All Organisms → cellular organisms → Eukaryota1683Open in IMG/M
3300023063|Ga0233335_1000652All Organisms → cellular organisms → Eukaryota6435Open in IMG/M
3300023272|Ga0247760_1199622All Organisms → cellular organisms → Eukaryota516Open in IMG/M
(restricted) 3300023276|Ga0233410_10072520All Organisms → cellular organisms → Eukaryota → Sar1047Open in IMG/M
3300024044|Ga0222419_102405Not Available5103Open in IMG/M
3300025316|Ga0209697_10018637All Organisms → cellular organisms → Eukaryota6685Open in IMG/M
3300025451|Ga0208426_1030611All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella818Open in IMG/M
3300025483|Ga0209557_1075666All Organisms → cellular organisms → Eukaryota757Open in IMG/M
3300025680|Ga0209306_1064516All Organisms → cellular organisms → Eukaryota1143Open in IMG/M
3300025925|Ga0207650_11793178All Organisms → cellular organisms → Eukaryota519Open in IMG/M
3300025944|Ga0207661_10148194All Organisms → cellular organisms → Eukaryota2026Open in IMG/M
3300026118|Ga0207675_101914124All Organisms → cellular organisms → Eukaryota611Open in IMG/M
3300027236|Ga0208026_1044932All Organisms → cellular organisms → Eukaryota613Open in IMG/M
3300027724|Ga0209582_1108276All Organisms → cellular organisms → Eukaryota958Open in IMG/M
(restricted) 3300027728|Ga0247836_1092576All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1489Open in IMG/M
3300027769|Ga0209770_10081919All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1343Open in IMG/M
3300027832|Ga0209491_10018294All Organisms → cellular organisms → Eukaryota7600Open in IMG/M
3300028572|Ga0302152_10045617All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1366Open in IMG/M
3300028585|Ga0265797_10036095All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa4886Open in IMG/M
3300028766|Ga0302269_1048142All Organisms → cellular organisms → Eukaryota1330Open in IMG/M
3300028776|Ga0302303_10262384Not Available587Open in IMG/M
3300029883|Ga0311327_10133322All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1780Open in IMG/M
3300029914|Ga0311359_10160725All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella2043Open in IMG/M
3300029918|Ga0302143_1033439All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1177Open in IMG/M
3300030020|Ga0311344_10631664All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida910Open in IMG/M
3300030047|Ga0302286_10037135All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida2683Open in IMG/M
3300030803|Ga0074037_1017171All Organisms → cellular organisms → Eukaryota557Open in IMG/M
3300030932|Ga0074001_11282746Not Available603Open in IMG/M
3300030946|Ga0075379_10017439All Organisms → cellular organisms → Eukaryota564Open in IMG/M
3300030971|Ga0075375_12160430All Organisms → cellular organisms → Eukaryota571Open in IMG/M
3300031523|Ga0307492_10013201All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida2982Open in IMG/M
3300031784|Ga0315899_10894194All Organisms → cellular organisms → Eukaryota801Open in IMG/M
3300032092|Ga0315905_10095068All Organisms → cellular organisms → Eukaryota3009Open in IMG/M
3300032360|Ga0315334_11264841All Organisms → cellular organisms → Eukaryota636Open in IMG/M
3300033463|Ga0310690_10092172All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida3476Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous14.95%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog5.61%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake4.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.74%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.80%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.80%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.80%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean2.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.80%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter2.80%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.87%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.87%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater1.87%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater1.87%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.87%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.87%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog1.87%
Leaf LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Leaf Litter1.87%
Ant DumpHost-Associated → Arthropoda → Ant Dump → Unclassified → Unclassified → Ant Dump1.87%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.87%
Host-AssociatedHost-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated1.87%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge1.87%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.93%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.93%
LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic0.93%
Freshwater Lake HypolimnionEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion0.93%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.93%
WetlandEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland0.93%
Glacier ValleyEnvironmental → Aquatic → Freshwater → Ice → Glacier → Glacier Valley0.93%
Pond Fresh WaterEnvironmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water0.93%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater0.93%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.93%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater0.93%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine0.93%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.93%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.93%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.93%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.93%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine0.93%
Sulfur Spring Sediment And CrustEnvironmental → Aquatic → Thermal Springs → Warm (34-42C) → Sediment → Sulfur Spring Sediment And Crust0.93%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.93%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.93%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.93%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.93%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil0.93%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface0.93%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.93%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.93%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.93%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.93%
RumenHost-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen0.93%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.93%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.93%
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave0.93%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent0.93%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2077657000Sulfur spring sediment and crust microbial communities from Zodletone, Oklahoma, USA - B1EnvironmentalOpen in IMG/M
22091110122000 evening metatranscriptomeEnvironmentalOpen in IMG/M
3300004567Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metatranscriptome 9_HOW4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004763Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006037Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNAEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006355Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006357Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006372Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006374Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006379Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006383Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006384Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006390Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006400Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006401Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006419Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006687Metatranscriptome of deep ocean microbial communities from Pacific Ocean - MP2254 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006691Metatranscriptome of deep ocean microbial communities from Atlantic Ocean - MP138 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006728Metatranscriptome of deep ocean microbial communities from Atlantic Ocean - MP2967 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2)Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007181Active sludge microbial communities from Klosterneuburg, Austria - Klosterneuburg WWTP active sludge MT KNB_B5L_H (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300007233Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 B RNA (Eukaryote Community Metatranscriptome)EngineeredOpen in IMG/M
3300007516Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01EnvironmentalOpen in IMG/M
3300009009Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009144Agave microbial communities from Guanajuato, Mexico - Or.Sf.eHost-AssociatedOpen in IMG/M
3300009183Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaGEnvironmentalOpen in IMG/M
3300009502Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaGEnvironmentalOpen in IMG/M
3300009684Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaGEnvironmentalOpen in IMG/M
3300009695Glacier valley bacterial and archeal communities from Borup Fiord, Nunavut, Canada, to study Microbial Dark Matter (Phase II) - frozenSSSS metaGEnvironmentalOpen in IMG/M
3300009697Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum magellanicum MGHost-AssociatedOpen in IMG/M
3300009787Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fa - Sphagnum fallax MGHost-AssociatedOpen in IMG/M
3300010029Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_10_20EnvironmentalOpen in IMG/M
3300010157Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaGEnvironmentalOpen in IMG/M
3300010374Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S-1-Day17EnvironmentalOpen in IMG/M
3300010388Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015EnvironmentalOpen in IMG/M
3300011000Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015EnvironmentalOpen in IMG/M
3300011340Combined Assembly of Wetland MetatranscriptomesEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013087Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30LEnvironmentalOpen in IMG/M
3300013132 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5mEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300014499Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaGEnvironmentalOpen in IMG/M
3300016796Metatranscriptome of marine eukaryotic communities from Pacific Ocean grown at 7 C, 34.25 psu salinity and 124 ?mol photons light - unclassified eukaryote Undescribed (MMETSP1317)Host-AssociatedOpen in IMG/M
3300017754Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.DEnvironmentalOpen in IMG/M
3300017958Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017967Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018001Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018565Metatranscriptome of marine microbial communities from Baltic Sea - GS669_3p0_dTEnvironmentalOpen in IMG/M
3300018891Soil crust microbial communities from Colorado Plateau, Utah, USA - early stage, 18 hrs after wetting v1EnvironmentalOpen in IMG/M
3300020190Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surfaceEnvironmentalOpen in IMG/M
3300020204Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015008 Mahale S9 surfaceEnvironmentalOpen in IMG/M
3300020221Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100mEnvironmentalOpen in IMG/M
3300020372Marine microbial communities from Tara Oceans - TARA_B100000787 (ERX556133-ERR599090)EnvironmentalOpen in IMG/M
3300021389Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022742Enriched microbial communities from leaf-cutter ant dump, University of Wisconsin, Madison, United States - 3A5AHost-AssociatedOpen in IMG/M
3300022745Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 1-17_Aug_MGEnvironmentalOpen in IMG/M
3300022751Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L212-509R-1EnvironmentalOpen in IMG/M
3300023048Leaf litter microbial communities from Shasta-Trinity National Forest, California, United States - GEON-DECOMP-247EnvironmentalOpen in IMG/M
3300023063Leaf litter microbial communities from Shasta-Trinity National Forest, California, United States - GEON-DECOMP-222EnvironmentalOpen in IMG/M
3300023272Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L171-409R-4EnvironmentalOpen in IMG/M
3300023276 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_1_MGEnvironmentalOpen in IMG/M
3300024044Enriched microbial communities from leaf-cutter ant dump, University of Wisconsin, Madison, United States - 1B20AHost-AssociatedOpen in IMG/M
3300025316Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025451Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025483Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025680Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 (SPAdes)EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027236Estuarine microbial communities from the Columbia River estuary - metaG 1554A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027724Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB5-Kit (SPAdes)EngineeredOpen in IMG/M
3300027728 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14mEnvironmentalOpen in IMG/M
3300027769Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027832Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-02 (SPAdes)EnvironmentalOpen in IMG/M
3300028572Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_1EnvironmentalOpen in IMG/M
3300028585Plant litter microbial communities from East Loma Ridge, Irvine, California - P2 T30EnvironmentalOpen in IMG/M
3300028766Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_2EnvironmentalOpen in IMG/M
3300028776Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1EnvironmentalOpen in IMG/M
3300029883I_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029914III_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029918Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_1EnvironmentalOpen in IMG/M
3300030020II_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300030047Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_3EnvironmentalOpen in IMG/M
3300030803Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Mineral C3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030932Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Litter GP-1B (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030946Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA7 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030971Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031523Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SI3LEnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300032092Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121EnvironmentalOpen in IMG/M
3300032360Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 34915EnvironmentalOpen in IMG/M
3300033463Bovine rumen microbial communities from tropical cattle in Woodstock, Queensland, Australia - Gonzalo_04 (v2)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
ZODLETONE_005282402077657000Sulfur Spring Sediment And CrustTPRLLLRLLLPLSDKVYFYFHDRVEPGHGPLGSPDHSKSVGATGGVYKGQGRNQHKLMTYAY
le_001644602209111012LenticLRLLLPLSDKVYLTFHASLEDMRSPEGSPDHSKSVGATGGVYKGQGRNQHKLMTYAY
Ga0066495_14746113300004567Freshwater SedimentLKLK*IDGGPHKRLSDKVYLTSHSWIKSSHSPEGSPDHSKSVGATGGVYKGQGRNQRSLMTNAY*
Ga0007746_104454023300004763Freshwater LakeETLLRLLLPLSDKIYLTFRARHETTCSPKDSPDHSKSVGATGGVYKGQGLNQRRLMTCAY
Ga0075465_1011807423300006037AqueousLLRLLLPLSDMVYLIFRKRHEDARSPKGSPDHSKSVGATGGVYKGQGLNRRKVMTCAY*
Ga0097621_10119704123300006237Miscanthus RhizosphereLLRLLLPLSDKVYLTSHNWIESSHSPEDSPDHSKSVGATGGVYKGQGRNQHKLMTYAY*
Ga0075501_105422123300006355AqueousLLRLLLPLSDKVYLTFRSRHEAASSPKDSPDHSKSVGATGGVYKGQGLNQRRLLTYAY*
Ga0075501_105740323300006355AqueousLLRLFLPLSDVVYSTFQKRTGALGPKDSPDHSKSVGATGGVYKGQG
Ga0075501_108355623300006355AqueousLLRLLLPLSDMVYLIFRSRHEAARSPKGSPDHSKSVGATGGVYKGQGLNRRKVMTCAY*
Ga0075502_108847323300006357AqueousLLRLLLPLSDKIYLTFREQLKEVHSPKDSPDHSKSVVATGGVYKGQGLNHRRL
Ga0075489_104651523300006372AqueousLLRLLLPLSDKVYETSRKWFKPIRSPDSSPHHSKSVGATGGVYKGQGRIQHRLMTCAYKEFLVQDL*
Ga0075512_107111723300006374AqueousLLRLLLPLSDMVYLTSHTELKDLYGPEGSPNHSKSVGATGGVYKGQGRNQHKLMTCAY*
Ga0075513_105906223300006379AqueousLLRLLLPLSDKIYLTFREQLKEVHSPKDSPDHSKSVVATGGVY
Ga0075504_104163323300006383AqueousLLRLLLPLSDKVYLTSHIHLEGGHGPEGSPDHSKSVGATGGVYKGQGRNQHKMMTYAY*
Ga0075516_106361223300006384AqueousLLRLLLPLSSKICLTFRVGVEHRHSPKGSPDHSKSVGATGGVYKGQGLNQRRLMTCAY*
Ga0075509_102872223300006390AqueousLLRLLLPLSDKVYLTFHIRLKDGRGPGGSPDHSKSVGATGGVYKGQGRNQHKMMTCAY*
Ga0075503_109772723300006400AqueousLLRLLLPLSDKIYLTFREQLKEVHSPKDSPDHSKSVVATGGV
Ga0075506_106991923300006401AqueousLLRLLLPLGDVVYTTSRLRHKAASGPKGSPDHPKSVGATGGVYKGQG
Ga0075496_105661523300006419AqueousLLRLLLPLSDKIYLTFREQLKEVHSPKDSPDHSKSVVATGGVYKGQGLNHRRLMTCDY*
Ga0031697_101713923300006687Deep OceanLLRLLLPLSDKVYLTFRDTAEAARSPKDSPDHSKSVGATGGVYKGQGLNQRRLMTCAY*
Ga0031679_101145723300006691Deep OceanLLRLLLPLSDKVYLTSLIAKQFSPESLPDHSKSVGATGGVYKGQGRNRHQIMTDAY*
Ga0031676_102192013300006728Deep OceanLLRLLLPLSSMVYLTFQDAQGRLGPKNSPDHSKSVGATGGVYKGQGLNQRRLMTY
Ga0075467_1040151923300006803AqueousLLRLLLPLSDMVYLTSHMCLVDTHGPEGSPNHSKSVGATGGVYKGQGRNQHKLMTCAY*
Ga0079221_1171897323300006804Agricultural SoilLLRLLLPLSDKVYLTSHNQVKPGHSPEGSPDHSKSVGATGGVYKGQGRNQHKLMTYAY*
Ga0097620_10294811223300006931Switchgrass RhizosphereLLRLLLPLSDKVYLTSHNWVKPSHSPEDSPDHSKSVGATGGVYKGQGRNQHKMMTYAY*
Ga0079219_1180232323300006954Agricultural SoilLLRLLLPLSDKVYNFPLLARNYNSPEGSPDHSKSVGATGGVYKGQGRNQHKLMTYAY*
Ga0099781_102374823300007181Activated SludgeLLRLLLPLSDKVYLTFHASLKDMRSPEGSPDHSKSVGATGGVYKGQGRNQHKLMTYAY*
Ga0075178_105399823300007233Wastewater EffluentLLRLLLPLSVKVCITSCTQDKLTRSPECSPQHSKSVGATGGVYKGQGRIQHRLMTCAYKEFLVQDL*
Ga0105050_1004387023300007516FreshwaterLLRLLLPLSDMVYLIFRTRHETSRSPKGSPDHSKSVGATGGVYKGQGLNRRKVMTCAY*
Ga0105105_1007943023300009009Freshwater SedimentLLRLLLPLSDMVYLIFRPRHEAARSPKGSPDHSKSVGATGGVYKGQGLNRRKVMTCAY*
Ga0058702_1038150923300009144AgaveLLRLLLPLSDKVYLTSHNQVKPVHSPEGSPDHSKSVGATGGVYKGQGRNQHKLMTYAY*
Ga0114974_1050966513300009183Freshwater LakeLLRLLLPLSDMVYLTSHLRLKDLGSPEGSPNHSKSVGATGGVYKGQGLNQRR
Ga0114951_1002679923300009502FreshwaterLLRLLLPLSDLVHLISPLVAGPKGSPNRSESVGATGGVYKGQGLNQRKLMTYAY*
Ga0114951_1006139023300009502FreshwaterLLRLLLPLSDMVYLISRVNGPKGSPNHSKSVGATGGVYKGQGLSQRKLMTYAY*
Ga0114958_1011835523300009684Freshwater LakeLLRLLLPLSDMVYLIFRSRHEAPRSPKGSPDHSKSVGATGGVYKGQGLN
Ga0123337_1001625633300009695Glacier ValleyLLRLLLPLSDMVYLIFRTEHGAPRSPKGSPDHSKSVGATGGVYKGQGLNQRKVMTCAY*
Ga0116231_1011026523300009697Host-AssociatedLLRLLLPLSDKVYLTSHTRIESGCGPEGSPDHSKSVGATGGVYKGQGRNQHKMMTYAY*
Ga0116226_1046664223300009787Host-AssociatedLLRLLLPLSDKVYFYFHDRIKSDYGPLGSPDHSKSVGATGGVYKGQGRNQHKLMT
Ga0105074_109073923300010029Groundwater SandLLRLLLPLSDMVYLIFHTEHETPRSPKGSPDHSKSVGATGGVYKGQGRNQREMMTRAY*
Ga0114964_1044676723300010157Freshwater LakeLLRLLLPLSDKVYLTFHASLKDMRSPEGSPDHSKSVGATGGVYKGQGRNQHMLMTCAY*
Ga0114986_109519523300010374Deep SubsurfaceLLRLLLPLSDMVYLIFRKRHEDARSPKGSPDHSKSVGATGGVYKGQGLN
Ga0136551_100243923300010388Pond Fresh WaterLLRLLLPLSDKIYLTFRAWHETTCSPKDSPDHSKSVGATGGVYKGQGLNRRKVMTCAY*
Ga0138513_10007100323300011000SoilLLRLLLPLSDMVYLIFRTRLGASRSPKGSPDHSKSVGATGRVYKGQGLNQRKLMTCAY*
Ga0151652_1151190423300011340WetlandLLRLLLPLSDLVHLISPLVAGPKGSPDHSESVGATGGVYKGQGLNQRKLMTYAY*
Ga0150984_10319966623300012469Avena Fatua RhizosphereLLRLLLPLSDKVYLTSHVQVEPGHSPEGSPDHSKSVGATGGVYKGQGRNQHKLMTYAY*
Ga0164298_1000424043300012955SoilLLRLLLPLSDMVYLIFRTKHGAPRSPKGSPDHSKSVGATGGVYKGQGLNQRKVMTCAY*
Ga0164307_1000632823300012987SoilLLRLLLPLSDKVYLTSHDQVKPAHSPEGSPDHSKSVGATGGVYKGQGRNQHKLMTYAY*
Ga0163212_106796223300013087FreshwaterLLRLLLPLSDMVYLIFHTRHETQRSPKGSPDHSKSVGATGGVYKGQGLNRRKVMTCAY*
(restricted) Ga0172372_1003761823300013132FreshwaterLLRLLLPLSDMVYLIFRTRHETPRSPKGSPDHSKSVGATGGVYKGQGLNRRKVMTCAY*
Ga0182016_1031539323300014493BogLLRLLLPLSDMVYLIFRIRHETSRSPKGSPDHSKSVGATGGVYKGQGLNQRKLMTCAY*
Ga0182012_1009101923300014499BogLLRLLLPLSDKVYLTFHASLEDMRSPEGSPDHSKSVGATGGVYKGQGRNQHKLMTYAY*
Ga0186337_10574813300016796Host-AssociatedLLRLLLPLSDKVYLISRLGSRSSPKGSPDHSKSVGATGGVYKGQGL
Ga0181344_115450423300017754Freshwater LakeLLRLLLPLSDKVYFYSHNRVKPDYGPLGSPDHSKSVGATGGVYKGQGRNQRELMTRIY
Ga0181582_1085596923300017958Salt MarshLLRLLLPLSSKICLTFRVGVEHRHSPKGSPDHSKSVGATGGVYKGQGLNQRRLMTCAY
Ga0181590_1017838823300017967Salt MarshLLRLILPLSDVVYWTSHGLHEGAHGPNGSPDHSKSVGATGGVYKGQGLNQRKLMTCAY
Ga0187783_1113521723300017970Tropical PeatlandLLRLLLPLSDKVYLTSHSRVEPGYGPEGSPDHSKSVGATGGVYKGQGRNQHKLMTYAY
Ga0187815_1035661013300018001Freshwater SedimentRLLLPLSDMVYLTFRTGHEAPRSPKGSPDHSKSVGATGGVYKGQGRNHRGLMTRAY
Ga0187855_1009393723300018038PeatlandLLRLLLPLSDKVYLTFHARLEDMRSPEGSPDHSKSVGATGGVYKGQGRNQHKLMTYAY
Ga0187871_1073802723300018042PeatlandLLRLLLPLSDMVYLIFRTEHGAPRSPKGSPDHSKSVGATGGVYKGQGLNQRKVMTCAY
Ga0190265_1104335523300018422SoilLLRLLLPLSDMVYLISHTKHEAQYGPKGSPDHSKSVGATGGVYKGQGLNQRRLLTCAY
Ga0188826_10339923300018565Freshwater LakeLLRLLLPLSDMVYLIFRKRHEDARSPKGSPDHSKSVGATGGVYKGQGLNQRKVMTCAY
Ga0188826_10414723300018565Freshwater LakeLLRLLLPLSDMVYLIFRKRHEDARSPKGSPDHSKSVGATGGVYKGQGLNQRRLMTCAY
Ga0193610_101484623300018891SoilLLRLLLPLSDMVYLIFRTEHETPRSPKGSPDHSKSVGATGGVYKGQGLNQRKVMTCAY
Ga0194118_1007198923300020190Freshwater LakeLLRLLLPLSDMVYLIFHTRHETQRSPKGSPDHSKSVGATGGVYKGQGLNRRKVMTCAY
Ga0194116_1014900623300020204Freshwater LakeLLRLLLPLSDKVYLTSLSILKEQSGQEGSPDHSKSVGATGGVYKGQGRNQYELMTRTY
Ga0194127_1001836643300020221Freshwater LakeLLRLLLPLGDLVHLISLLGASPKGSPNHPESVGATGGVYKGQGLNQRKLMTYAY
Ga0211683_1003594623300020372MarineLLRLLLPLSDKIYLTFREKLEAFHSPKDSPDHSKSVVATGGVYKGQGLNHRRLMTCDY
Ga0213868_1015359623300021389SeawaterLLRLLLPLSDKVYLTFHIRLKDGRSPEGSPDHSKSVGATGGVYKGQGRNQHKMMTCAY
Ga0126371_1151098623300021560Tropical Forest SoilLLRLLLPLSDKVYLTSHIQIESGCGPEGSPDHSKSVGATGGVYKGQGRNQHKMMTYAY
Ga0206117_10178773300022742Ant DumpLLRLLLPLSDKVYLTSHNQVKPDYSPEGSPDHSKSVGATGGVYKGQGRNQHKLMTYAY
Ga0228698_100514133300022745FreshwaterLLRLLLPLSDMVYLIFRTWHEASRSPKGSPDHSKSVGATGGVYKGQGLNRRKVMTCAY
Ga0247817_1003279523300022751Plant LitterLLRLLLPLSDKVYLTSHDQVKPAHSPEGSPDHSKSVGATGGVYKGQGRNQHKLMTYAY
Ga0233341_100996423300023048Leaf LitterLLRLLLPLSDKVYLTSHIRVEPERSPEGSPDHSKSVGATGGVYKGQGRNQHKMMTYAY
Ga0233335_100065233300023063Leaf LitterLLRLLLPLSDMVYLIFRTEHEAPRSPKGSPDHSKSVGATGGVYKGQGLNQRKVMTCAY
Ga0247760_119962223300023272Plant LitterLLRLLLPLSDKVYLTSHDQVEPGHSPEGSPDHSKSVGATGGVYKGQGRNQHKLMTYAY
(restricted) Ga0233410_1007252023300023276SeawaterLLRLLLPLSVTIYLTSSSTLKVRYSPKDSPDHSKSVGATGGVYKGQGLNQR
Ga0222419_10240533300024044Ant DumpLLRLLLPLSDKVYLTSHNQVKPGHSPEGSPDHSKSVGATGGVYKGQGRNQHKLMTYAY
Ga0209697_1001863763300025316Freshwater Lake HypolimnionLLRLLLPLSDMVYLISRVNGPKGSPNHSKSVGATGGVYKGQGLSQRKLMTYAY
Ga0208426_103061123300025451AqueousLLRLLLPLSDMVYLIFRKRHEDARSPKGSPDHSKSVGATGGVYKGQGLNRRKVMTCAY
Ga0209557_107566623300025483MarineLLRLLLPLSDVVYLTFQAQDEPAPGPKGSPDHSKSVGATGGVYKGQGLNQRKLMTCAY
Ga0209306_106451623300025680Pelagic MarineLLRLLLPLSDKIYLTFREQLKEVHSPKDSPDHSKSVVATGGVYKGQGLNHRRLMTCDY
Ga0207650_1179317823300025925Switchgrass RhizosphereLLRLLLPLSDKVYLTSHNWVKPSYSPEDSPDHSKSVGATGGVYKGQGRNQHKLMTYAY
Ga0207661_1014819423300025944Corn RhizosphereLLRLLLPLSDMVYLTFHARHEARRGPKGSPDHSKSVGATGGVYKGQGLNQRKVMTCAY
Ga0207675_10191412423300026118Switchgrass RhizosphereLLRLLLPLSDKVYLTSHDWVKPNHSPEGSPDHSKSVGATGGVYKGQGRNQHKLMTYAY
Ga0208026_104493223300027236EstuarineLLRLLLPLSDMVYLTSHQCLGDTSSPEGSPNHSKSVGATGGVYKGQGRNQHMLMTCAY
Ga0209582_110827623300027724Activated SludgeLLRLLLPLSDKVYLTFHASLKDMRSPEGSPDHSKSVGATGGVYKGQGRNQHKLMTYAY
(restricted) Ga0247836_109257623300027728FreshwaterLLRLLLPLSDMVYLIFRSRHEAPRSPKGSPDHSKSVGATGGVYKGQGLNRRKVMTCAY
Ga0209770_1008191923300027769Freshwater LakeLLRLLLPLSDMVYLIFRTGHEAPRSPKGSPDHSKSVGATGGVYKGQGLNRRKVMTCAY
Ga0209491_1001829443300027832FreshwaterLLRLLLPLSDMVYLIFRTRHETSRSPKGSPDHSKSVGATGGVYKGQGLNRRKVMTCAY
Ga0302152_1004561723300028572BogLLRLLLPLSDMVYLIFRAWHEATRSPKGSPDHSKSVGATGGVYKGQGLNRRKVMTCAY
Ga0265797_1003609533300028585Plant LitterLLRLLLPLSDKVYFYFHDRVEPGHGPLGSPDHSKSVGATGGVYKGQGRNQHKLMTYAY
Ga0302269_104814223300028766BogLLRLLLPLSDKVYLTFHASLEDMRSPEGSPDHSKSVGATGGVYKGQGRNQHKLMTYAY
Ga0302303_1026238423300028776PalsaLLRLLLPLSDKVYLTSHTRVEPEYSPEGSPDHSKSVGATGGVYKGQGRNQHKMMTYAY
Ga0311327_1013332223300029883BogLLRLLLPLSDMVYLIFRAWHEATRSPKGSPDHSKSVGATGGVYKGQGLNQRKVMTCAY
Ga0311359_1016072523300029914BogLLRLLLPLSDMVYLIFRAWHEATRSPKGSPDHSKSVGATGGVYKGQGLNRRK
Ga0302143_103343923300029918BogLLRLLLPLSDMVYLIFRAWHEATRSPKGSPDHSKSVGATGGVYKGQGLNQRRLLTCAY
Ga0311344_1063166423300030020BogLLRLLLPLSDMVYLIFRTRHETSRSPKGSPDHSKSVGATGGVYKGQGLNQRKLMTC
Ga0302286_1003713523300030047FenLLRLLLPLSDKVYLTSHTWIESSCGPEGSPDHSKSVGATGGVYKGQGRNQHKMMTYAY
Ga0074037_101717123300030803SoilLLRLLLPLSDKVYLTSRARLKDGRSPEGSPDHSKSVGATGGVYKGQGRNQYRLMTCTY
Ga0074001_1128274623300030932SoilLLRLLLPLSDKVYFYFHNQVEPNHGPLGSPDHSKSVGATGGVYKGQG
Ga0075379_1001743923300030946SoilLLRLLLPLSDKVYLTSHTRIESGCGPEGSPDHSKSVGATGGVYKGQGRNQHKMMTYAY
Ga0075375_1216043023300030971SoilLLRLLLPLSDKVYLTSRGCLKDSLSPEGSPDHSKSVGATGGVYKGQGRNQYKLMTCTY
Ga0307492_1001320123300031523Sea-Ice BrineLLRLLLPLSDKIYLTSSNKHETHRCPKGSPDHSKSVGATGGVYKGQGLNQRRLMTCAY
Ga0315899_1089419423300031784FreshwaterLLRLLLPLSDMVYLTSRAGLKGLYSPEDSPNHSKSVGATGGVYKGQGRNQHKLMTCAY
Ga0315905_1009506823300032092FreshwaterLLRLLLPLSDMVYLTSHIDLEDLHGPEGSPNHSKSVGATGGVYKGQGRNQHKLMTCAY
Ga0315334_1126484113300032360SeawaterLLRLLLPLSDKVYLTFRARHEAPHSPKDSPDHSKSVGATGGVYKGQGLNQ
Ga0310690_1009217223300033463RumenLLRLLLPLGDMVYLFFHLRSPKGSPNHPVSVGATGGVYKGQGHNQCKMMTCTY


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.