NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F092167

Metagenome Family F092167

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F092167
Family Type Metagenome
Number of Sequences 107
Average Sequence Length 40 residues
Representative Sequence LRINEVMQRFSSLASEMREAENASQAETEETTMPTSRRR
Number of Associated Samples 92
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 98.13 %
% of genes from short scaffolds (< 2000 bps) 91.59 %
Associated GOLD sequencing projects 89
AlphaFold2 3D model prediction Yes
3D model pTM-score0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.065 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(39.252 % of family members)
Environment Ontology (ENVO) Unclassified
(41.121 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(43.925 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 44.78%    β-sheet: 0.00%    Coil/Unstructured: 55.22%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.47
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF00072Response_reg 81.31
PF01584CheW 14.02
PF00672HAMP 3.74
PF02895H-kinase_dim 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 107 Family Scaffolds
COG0643Chemotaxis protein histidine kinase CheASignal transduction mechanisms [T] 1.87


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.07 %
UnclassifiedrootN/A0.93 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001167|JGI12673J13574_1003715All Organisms → cellular organisms → Bacteria874Open in IMG/M
3300002245|JGIcombinedJ26739_101507282All Organisms → cellular organisms → Bacteria → Acidobacteria568Open in IMG/M
3300005175|Ga0066673_10486396All Organisms → cellular organisms → Bacteria → Acidobacteria727Open in IMG/M
3300005179|Ga0066684_10722109All Organisms → cellular organisms → Bacteria → Acidobacteria665Open in IMG/M
3300005439|Ga0070711_101750942All Organisms → cellular organisms → Bacteria → Acidobacteria545Open in IMG/M
3300005542|Ga0070732_10221592All Organisms → cellular organisms → Bacteria1131Open in IMG/M
3300005602|Ga0070762_11002798All Organisms → cellular organisms → Bacteria → Acidobacteria572Open in IMG/M
3300005712|Ga0070764_10682735All Organisms → cellular organisms → Bacteria → Acidobacteria631Open in IMG/M
3300005718|Ga0068866_10036988All Organisms → cellular organisms → Bacteria2395Open in IMG/M
3300005983|Ga0081540_1234274All Organisms → cellular organisms → Bacteria → Acidobacteria647Open in IMG/M
3300006034|Ga0066656_10465617All Organisms → cellular organisms → Bacteria824Open in IMG/M
3300006059|Ga0075017_100783418All Organisms → cellular organisms → Bacteria → Acidobacteria736Open in IMG/M
3300006102|Ga0075015_100551519All Organisms → cellular organisms → Bacteria → Acidobacteria670Open in IMG/M
3300006162|Ga0075030_100366102All Organisms → cellular organisms → Bacteria → Acidobacteria1149Open in IMG/M
3300006354|Ga0075021_10723011All Organisms → cellular organisms → Bacteria → Acidobacteria640Open in IMG/M
3300006796|Ga0066665_10387957All Organisms → cellular organisms → Bacteria → Acidobacteria1149Open in IMG/M
3300007255|Ga0099791_10320176All Organisms → cellular organisms → Bacteria → Acidobacteria741Open in IMG/M
3300009038|Ga0099829_11162506All Organisms → cellular organisms → Bacteria → Acidobacteria639Open in IMG/M
3300009089|Ga0099828_11075724All Organisms → cellular organisms → Bacteria → Acidobacteria715Open in IMG/M
3300009143|Ga0099792_10043255All Organisms → cellular organisms → Bacteria2159Open in IMG/M
3300009143|Ga0099792_10531282All Organisms → cellular organisms → Bacteria → Acidobacteria741Open in IMG/M
3300009698|Ga0116216_10908383All Organisms → cellular organisms → Bacteria → Acidobacteria527Open in IMG/M
3300009700|Ga0116217_10620253All Organisms → cellular organisms → Bacteria → Acidobacteria673Open in IMG/M
3300010320|Ga0134109_10165152All Organisms → cellular organisms → Bacteria → Acidobacteria803Open in IMG/M
3300010322|Ga0134084_10161829All Organisms → cellular organisms → Bacteria → Acidobacteria760Open in IMG/M
3300010359|Ga0126376_10809266All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium916Open in IMG/M
3300010360|Ga0126372_10164318All Organisms → cellular organisms → Bacteria → Acidobacteria1797Open in IMG/M
3300010366|Ga0126379_12998970All Organisms → cellular organisms → Bacteria → Acidobacteria565Open in IMG/M
3300010376|Ga0126381_102336297All Organisms → cellular organisms → Bacteria → Acidobacteria768Open in IMG/M
3300011269|Ga0137392_10279600All Organisms → cellular organisms → Bacteria → Acidobacteria1377Open in IMG/M
3300011269|Ga0137392_11204070All Organisms → cellular organisms → Bacteria → Acidobacteria616Open in IMG/M
3300011271|Ga0137393_10985256All Organisms → cellular organisms → Bacteria → Acidobacteria718Open in IMG/M
3300011271|Ga0137393_11018876All Organisms → cellular organisms → Bacteria → Acidobacteria705Open in IMG/M
3300012096|Ga0137389_10469435All Organisms → cellular organisms → Bacteria1078Open in IMG/M
3300012096|Ga0137389_10505330All Organisms → cellular organisms → Bacteria1037Open in IMG/M
3300012096|Ga0137389_10979187All Organisms → cellular organisms → Bacteria → Acidobacteria725Open in IMG/M
3300012189|Ga0137388_11027893All Organisms → cellular organisms → Bacteria → Acidobacteria760Open in IMG/M
3300012189|Ga0137388_11400738All Organisms → cellular organisms → Bacteria → Acidobacteria638Open in IMG/M
3300012202|Ga0137363_10809126All Organisms → cellular organisms → Bacteria → Acidobacteria795Open in IMG/M
3300012202|Ga0137363_10824779All Organisms → cellular organisms → Bacteria → Acidobacteria787Open in IMG/M
3300012202|Ga0137363_11016082All Organisms → cellular organisms → Bacteria → Acidobacteria704Open in IMG/M
3300012205|Ga0137362_10450692All Organisms → cellular organisms → Bacteria1114Open in IMG/M
3300012205|Ga0137362_11432768All Organisms → cellular organisms → Bacteria → Acidobacteria577Open in IMG/M
3300012209|Ga0137379_10756972All Organisms → cellular organisms → Bacteria876Open in IMG/M
3300012209|Ga0137379_11443397All Organisms → cellular organisms → Bacteria → Acidobacteria590Open in IMG/M
3300012210|Ga0137378_11308077All Organisms → cellular organisms → Bacteria → Acidobacteria641Open in IMG/M
3300012351|Ga0137386_11070239All Organisms → cellular organisms → Bacteria → Acidobacteria571Open in IMG/M
3300012357|Ga0137384_10423386All Organisms → cellular organisms → Bacteria1098Open in IMG/M
3300012357|Ga0137384_11339043All Organisms → cellular organisms → Bacteria → Acidobacteria563Open in IMG/M
3300012359|Ga0137385_10044914All Organisms → cellular organisms → Bacteria3958Open in IMG/M
3300012361|Ga0137360_10454167All Organisms → cellular organisms → Bacteria1086Open in IMG/M
3300012363|Ga0137390_11962047All Organisms → cellular organisms → Bacteria → Acidobacteria512Open in IMG/M
3300012683|Ga0137398_10268550All Organisms → cellular organisms → Bacteria1140Open in IMG/M
3300012917|Ga0137395_10930105All Organisms → cellular organisms → Bacteria → Acidobacteria627Open in IMG/M
3300012923|Ga0137359_10003318All Organisms → cellular organisms → Bacteria13020Open in IMG/M
3300012923|Ga0137359_10569771All Organisms → cellular organisms → Bacteria995Open in IMG/M
3300012923|Ga0137359_10926781All Organisms → cellular organisms → Bacteria → Acidobacteria750Open in IMG/M
3300012924|Ga0137413_10525781All Organisms → cellular organisms → Bacteria → Acidobacteria874Open in IMG/M
3300012929|Ga0137404_11810686All Organisms → cellular organisms → Bacteria → Acidobacteria568Open in IMG/M
3300012930|Ga0137407_11896026All Organisms → cellular organisms → Bacteria → Acidobacteria568Open in IMG/M
3300012964|Ga0153916_10283458All Organisms → cellular organisms → Bacteria1687Open in IMG/M
3300012971|Ga0126369_11041076All Organisms → cellular organisms → Bacteria907Open in IMG/M
3300014154|Ga0134075_10062060All Organisms → cellular organisms → Bacteria → Acidobacteria1554Open in IMG/M
3300015245|Ga0137409_11301749All Organisms → cellular organisms → Bacteria → Acidobacteria569Open in IMG/M
3300017656|Ga0134112_10518634All Organisms → cellular organisms → Bacteria → Acidobacteria507Open in IMG/M
3300017928|Ga0187806_1204443All Organisms → cellular organisms → Bacteria → Acidobacteria670Open in IMG/M
3300018088|Ga0187771_11307932All Organisms → cellular organisms → Bacteria → Acidobacteria615Open in IMG/M
3300020579|Ga0210407_10640831All Organisms → cellular organisms → Bacteria → Acidobacteria826Open in IMG/M
3300020580|Ga0210403_11162929All Organisms → cellular organisms → Bacteria → Acidobacteria596Open in IMG/M
3300020581|Ga0210399_10848149All Organisms → cellular organisms → Bacteria → Acidobacteria744Open in IMG/M
3300020583|Ga0210401_10358265All Organisms → cellular organisms → Bacteria1320Open in IMG/M
3300021088|Ga0210404_10731627All Organisms → cellular organisms → Bacteria → Acidobacteria564Open in IMG/M
3300021170|Ga0210400_10827127All Organisms → cellular organisms → Bacteria → Acidobacteria758Open in IMG/M
3300021403|Ga0210397_10894122All Organisms → cellular organisms → Bacteria → Acidobacteria687Open in IMG/M
3300021407|Ga0210383_11350204All Organisms → cellular organisms → Bacteria → Acidobacteria594Open in IMG/M
3300021420|Ga0210394_11243932All Organisms → cellular organisms → Bacteria → Acidobacteria638Open in IMG/M
3300021420|Ga0210394_11504661All Organisms → cellular organisms → Bacteria → Acidobacteria569Open in IMG/M
3300021559|Ga0210409_10243718All Organisms → cellular organisms → Bacteria1629Open in IMG/M
3300024222|Ga0247691_1069767All Organisms → cellular organisms → Bacteria → Acidobacteria530Open in IMG/M
3300024331|Ga0247668_1044881All Organisms → cellular organisms → Bacteria901Open in IMG/M
3300025922|Ga0207646_11367766All Organisms → cellular organisms → Bacteria → Acidobacteria617Open in IMG/M
3300026041|Ga0207639_12198109All Organisms → cellular organisms → Bacteria → Acidobacteria513Open in IMG/M
3300026317|Ga0209154_1013360All Organisms → cellular organisms → Bacteria3954Open in IMG/M
3300026497|Ga0257164_1028018All Organisms → cellular organisms → Bacteria → Acidobacteria835Open in IMG/M
3300026499|Ga0257181_1067783All Organisms → cellular organisms → Bacteria → Acidobacteria609Open in IMG/M
3300026557|Ga0179587_10324021All Organisms → cellular organisms → Bacteria996Open in IMG/M
3300027562|Ga0209735_1001826All Organisms → cellular organisms → Bacteria3692Open in IMG/M
3300027643|Ga0209076_1221704All Organisms → cellular organisms → Bacteria → Acidobacteria514Open in IMG/M
3300027660|Ga0209736_1147237All Organisms → cellular organisms → Bacteria → Acidobacteria627Open in IMG/M
3300027701|Ga0209447_10014613All Organisms → cellular organisms → Bacteria → Acidobacteria2232Open in IMG/M
3300027855|Ga0209693_10543746All Organisms → cellular organisms → Bacteria → Acidobacteria552Open in IMG/M
3300027862|Ga0209701_10143243All Organisms → cellular organisms → Bacteria → Acidobacteria1464Open in IMG/M
3300027867|Ga0209167_10563105All Organisms → cellular organisms → Bacteria → Acidobacteria624Open in IMG/M
3300027875|Ga0209283_10551820All Organisms → cellular organisms → Bacteria → Acidobacteria736Open in IMG/M
3300028808|Ga0302228_10312517All Organisms → cellular organisms → Bacteria → Acidobacteria703Open in IMG/M
3300028906|Ga0308309_11611966All Organisms → cellular organisms → Bacteria → Acidobacteria552Open in IMG/M
3300031057|Ga0170834_109201154All Organisms → cellular organisms → Bacteria1251Open in IMG/M
3300031128|Ga0170823_17391922All Organisms → cellular organisms → Bacteria → Acidobacteria627Open in IMG/M
3300031718|Ga0307474_10877513All Organisms → cellular organisms → Bacteria → Acidobacteria710Open in IMG/M
3300031820|Ga0307473_10551017All Organisms → cellular organisms → Bacteria → Acidobacteria787Open in IMG/M
3300031962|Ga0307479_10035240All Organisms → cellular organisms → Bacteria4784Open in IMG/M
3300031962|Ga0307479_11199660All Organisms → cellular organisms → Bacteria → Acidobacteria722Open in IMG/M
3300032180|Ga0307471_104222002All Organisms → cellular organisms → Bacteria → Acidobacteria507Open in IMG/M
3300032893|Ga0335069_12012610All Organisms → cellular organisms → Bacteria → Acidobacteria608Open in IMG/M
3300033004|Ga0335084_11715413All Organisms → cellular organisms → Bacteria → Acidobacteria617Open in IMG/M
3300034177|Ga0364932_0380220All Organisms → cellular organisms → Bacteria → Acidobacteria532Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil39.25%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil14.02%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.67%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.67%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.74%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.74%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.74%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.74%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.87%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.87%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.87%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.87%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.87%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.93%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.93%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.93%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.93%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.93%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.93%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.93%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.93%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001167Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012964Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300014154Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300017656Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300024222Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK32EnvironmentalOpen in IMG/M
3300024331Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026317Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes)EnvironmentalOpen in IMG/M
3300026497Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-BEnvironmentalOpen in IMG/M
3300026499Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-BEnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027562Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027643Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes)EnvironmentalOpen in IMG/M
3300027660Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027701Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028808Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300034177Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12673J13574_100371513300001167Forest SoilMALRINEVMQRFSSLASEMREAENASQAETEETTMPTPRRR*
JGIcombinedJ26739_10150728223300002245Forest SoilAMRINEIMVRFSSLASEMREAENASQAETEAADTPQPSRR*
Ga0066673_1048639613300005175SoilLRINEVMQRFSSLASEMREAENASQAETEETTMPTSRRR*
Ga0066684_1072210923300005179SoilLRINEIMQRFSSLSSEMREAENASQAETEQLQETLFTRN*
Ga0070711_10175094213300005439Corn, Switchgrass And Miscanthus RhizosphereSMTLRINEIMQRFSSLSSEMRDAEKASQAETEELPESLPTRN*
Ga0070732_1022159213300005542Surface SoilEIMLRFSSLASEMKDAETASQAETEPEPASPSSRR*
Ga0070762_1100279813300005602SoilSMALRINEIMQRFSSLATEMRDAENASQAETPDTVTSRSRRR*
Ga0070764_1068273523300005712SoilNEIMQRFSSLASEMREAETTSQAETEAEAVSPATRR*
Ga0068866_1003698813300005718Miscanthus RhizosphereEIMQRFSSLAGEMREAENASQAETQDLSPATFHRP*
Ga0081540_123427413300005983Tabebuia Heterophylla RhizosphereHEIMQRFSSLASEMRAAENASQAETEDVPAGLSNRN*
Ga0066656_1046561733300006034SoilRINEIMQRFSSLASEMREAENASQAETDEAPASLSTRN*
Ga0075017_10078341833300006059WatershedsINEIMQRFSHLATEMKSDETASQHETVEADPSPSRRR*
Ga0075015_10055151933300006102WatershedsINEVMQRFSSLASEMQEAENASQAETVEATAPTSRRR*
Ga0075030_10036610233300006162WatershedsMALRINEIMQRFSSLASEMQEAENASQAETQETSSPISQRR*
Ga0075021_1072301113300006354WatershedsIMQRFSSLASEMRSAETASQSETEEASAGANRRT*
Ga0066665_1038795733300006796SoilINEIMQRFSSLASEMREAENASQAETDEARASLSTRN*
Ga0099791_1032017613300007255Vadose Zone SoilRINEVMQRFSSLASEMQEAENASQAETVEATSPTTRRR*
Ga0099829_1116250613300009038Vadose Zone SoilALRINEVMQRFSSLASEMQEAENASQAETVEATSPTSRRR*
Ga0099830_1149601923300009088Vadose Zone SoilRINEVMQRFSSLNSEMREVETASQAETENEATALFRRR*
Ga0099828_1107572433300009089Vadose Zone SoilEVMQRFSSLASEMQEAENASQAETEETAAPTSRRR*
Ga0099792_1004325543300009143Vadose Zone SoilMALRINEIMLRFSSLSNEMQDAENASHAETEEAPQPSSRRR*
Ga0099792_1053128213300009143Vadose Zone SoilIHSMALRINEVMQRFSSLASEMRDAETASQGETVDTAAPVSRRR*
Ga0116216_1090838313300009698Peatlands SoilSMALRINEVMQRFSSLASEMQEAENASQAETVETAAPTSRRR*
Ga0116217_1062025323300009700Peatlands SoilLRINEVMQRFSSLASEMQEAENASQAETVETAAPTSRRR*
Ga0134109_1016515213300010320Grasslands SoilLRINEIMQRFSSLASEMREAENASQAETDEAPASLSTRN*
Ga0134084_1016182933300010322Grasslands SoilMALRINEIMQRFSSLAGEMREAENASQAETEETTMPTSRRR*
Ga0126376_1080926613300010359Tropical Forest SoilNEVMQRFSSLASEMQEAENASQAETEETNTPIPQRR*
Ga0126372_1016431813300010360Tropical Forest SoilEVMQRFSSLATEMREAENASQAETEEAQATLTRRS*
Ga0126379_1299897013300010366Tropical Forest SoilKTIHSMALRINEIMQRFSTLASEMREAENASSQAETEETPAAPLSRR*
Ga0126381_10233629713300010376Tropical Forest SoilSMTLRINEVMQRFSSLASEMREAENASQAETEEGQATLTRRS*
Ga0137392_1027960013300011269Vadose Zone SoilLRINEVMQRFSSLASEMQEAENASQAETVEANSPASRRR*
Ga0137392_1120407023300011269Vadose Zone SoilMNEVMQRFSSLASEMQEAENASQAETEETGSSISPRR*
Ga0137393_1098525613300011271Vadose Zone SoilMALRINEVMQRFSSLASEMQEAENASQAETVEATSPPSRRR*
Ga0137393_1101887633300011271Vadose Zone SoilEIMQRFSSLASEIRAAENASQAETEEAPVSLSTRN*
Ga0137389_1046943513300012096Vadose Zone SoilSMALRINEVMQRFSSLASEMREAENASQAETEETAAPTARRF*
Ga0137389_1050533013300012096Vadose Zone SoilLRINEVMQRFSSLASEMQEAENASQAETVEASSPTSRRR*
Ga0137389_1097918733300012096Vadose Zone SoilMALRINEVMQRFSSLASEMQEAENASQAETEEMTAPTSRRR*
Ga0137388_1102789333300012189Vadose Zone SoilEVMQRFSSLASEMQEAENASQAETVEANSPASRRR*
Ga0137388_1140073813300012189Vadose Zone SoilNEVMQRFSSLASEMQEAENASQAETEETAEPPSRRR*
Ga0137363_1080912633300012202Vadose Zone SoilHSMTLRINEIMQRFSSLSSEMREAENASQAETEDLPESLSTRP*
Ga0137363_1082477913300012202Vadose Zone SoilQIKTMHSMTLRINEVMQRFSSIASEMQEAENASQAETEETPTPVSRRS*
Ga0137363_1101608213300012202Vadose Zone SoilNEIMQRFSSLASEMREAENASQAETDEAPASLSTRN*
Ga0137362_1045069213300012205Vadose Zone SoilMALRINEVMQRFSSLASEMRDAETASQGETSDTAAPVSRRR*
Ga0137362_1143276823300012205Vadose Zone SoilINEVMQRFSSLASEMQEAENASQAETVEATSPTSRRR*
Ga0137379_1075697233300012209Vadose Zone SoilRINEVMQRFSSLASEMQEAENASQAETDERGSAISHRR*
Ga0137379_1144339713300012209Vadose Zone SoilNEIMQRFSSLANEMREAENASQGETEETPSAISRLR*
Ga0137378_1130807713300012210Vadose Zone SoilEIMQRFSSLANEMREAENASQGETEETPSAISRPR*
Ga0137386_1107023923300012351Vadose Zone SoilSMALRINEIMQRFSSLANEMREAENASQGETEETPSAISRLR*
Ga0137384_1042338613300012357Vadose Zone SoilEIMQRFSSLASEMREAEKASQAETEAASADAVSRR*
Ga0137384_1133904313300012357Vadose Zone SoilVMQRFSSLASEMQEAENASQAETEETAASTSRRR*
Ga0137385_1004491463300012359Vadose Zone SoilALRLHEIMQRFSSLASEMREAEKASQAETEAASADALSRR*
Ga0137360_1045416733300012361Vadose Zone SoilMALRINEVMQRFSSLASEMQEAENASQAETEETVVPTSRRR*
Ga0137390_1196204713300012363Vadose Zone SoilRINEVMQRFSSLASEMQEAENASQAETVEATSPTSRRR*
Ga0137398_1026855013300012683Vadose Zone SoilMALRINEVMQRFSSLASEMQEAENASQAETVEATSPTSRRR*
Ga0137395_1093010513300012917Vadose Zone SoilINEIMQRFSSLTSEMRDAENASQAETEEAPAAPTRRR*
Ga0137359_1000331813300012923Vadose Zone SoilMHSMTLRINEIMQRFSSLSSEMREAENASQAETEELPESLSTRT*
Ga0137359_1056977133300012923Vadose Zone SoilNEIMQRFSSLSSEMREAENASQAETEELPESLSTRT*
Ga0137359_1092678113300012923Vadose Zone SoilSMALRINEIMQRFSSLASEMREAENASQAETEEAPAAPVRRR*
Ga0137413_1052578113300012924Vadose Zone SoilMALRINEVMQRFSSLASEMQEAENASQGETEETVAPNSRRR*
Ga0137404_1181068613300012929Vadose Zone SoilMRIHEIMQRFSSLAGEMRHAEKASQAETDESAVAELRRR*
Ga0137407_1189602623300012930Vadose Zone SoilEIMQRFSSLTSEMRDAENASQAETEEAPTAPTRRR*
Ga0153916_1028345813300012964Freshwater WetlandsSMALRINEIMQRFSSLASEIREAEKVSQGETEASPAGSPGRN*
Ga0126369_1104107633300012971Tropical Forest SoilEVMQRFSSLASEMQEAENASQAETEETGSPLSSRR*
Ga0134075_1006206013300014154Grasslands SoilRINDVTQRFSSLASEMQEAENVSQAETEETSWPAPERR*
Ga0137409_1130174923300015245Vadose Zone SoilLRINEVMQRFSSLASEMQEAENASQAETVEATSPTTRRR*
Ga0134112_1051863423300017656Grasslands SoilALRINEVMQRFSSLASEMQEAENASQAETEEAAGSTTRRR
Ga0187806_120444313300017928Freshwater SedimentIHEIMQRFSSLASEMREVENASQAETEETPTPTTQRR
Ga0187771_1130793213300018088Tropical PeatlandINEIMQRFSSLASEMREVETPSQAETEEAATPLTPRP
Ga0210407_1064083133300020579SoilNMALRINEIMQRFSSLANEMKEPENASQAETEDSSAATFPRR
Ga0210403_1116292923300020580SoilMALRINEIMQRFSLLATEMKADETASQHETVEAESSPSRRR
Ga0210399_1084814913300020581SoilNEIMQRFSSLASEMREAENASQAETEEAPVAPARRR
Ga0210401_1035826513300020583SoilSMALRINEIMQRFSSLATEMRDAENASQAETPDVVTSRSRRS
Ga0210404_1073162713300021088SoilSMALRINEIMQRFSSLASEMREAENASQAETEDAPASTSRHR
Ga0210400_1082712733300021170SoilRINEIMQRFSSLASEMREAENASQAETEDAPASTSRHR
Ga0210397_1089412213300021403SoilALRINEVMQRFSSLASELREGETQSQVETEELNSAPTRRR
Ga0210383_1135020413300021407SoilALRINEIMQRFSLLATEMKTDETASQHETVEAETSPSRRR
Ga0210394_1124393213300021420SoilTIHTMALRINEIMQRFSLLATEMKADETASQHETVEAESSPSRRR
Ga0210394_1150466113300021420SoilALRINEIMQRFSSLASEMRESENASQVETEEAPAAPSRRR
Ga0210409_1024371813300021559SoilNEIMQRFSSLATEMRDAENASQAETPDVVTSRSRRS
Ga0247691_106976713300024222SoilSMALRINEVMQRFSSLACEMREAENASQAETQDLSPSEFQRR
Ga0247668_104488113300024331SoilTLRINEVMQRFSSLASEMREAENDSQAETEDAPAPVSRRS
Ga0207646_1136776623300025922Corn, Switchgrass And Miscanthus RhizosphereMHSMTLRINEVMQRFSSLASEMREAENDSHAETEETPTPVSRRS
Ga0207639_1219810923300026041Corn RhizosphereNEIMQRFSSLAGEMREAENASQAETQDLSPATFHRP
Ga0209154_101336013300026317SoilSMALRINEVMQRFSSLASEMQEGENASQAETEETSSPISPRR
Ga0257164_102801813300026497SoilSMALRINEVMQRFSSLASEMRDAETASQGETSDTAAPVSRRR
Ga0257181_106778323300026499SoilEIMQRFSSLATEMKAAENASQAETEAAPAAPSRRR
Ga0179587_1032402133300026557Vadose Zone SoilMTLRINEIMQRFSSLSSEMRDAEKASQAETEQLPESLPTRN
Ga0209735_100182653300027562Forest SoilRMNEIMMRFSSLASEMREAENASQAETEAADASAPSRR
Ga0209076_122170413300027643Vadose Zone SoilHSMALRINEVMQRFSSLASEMREAENASQGETLETPAPASRRR
Ga0209736_114723723300027660Forest SoilMALRINEVMQRFSSLASELREGETHSQVETEEVNSTPTRRR
Ga0209447_1001461343300027701Bog Forest SoilTIHNMALRINEIMQRFSSLSTEMKEAETTSQAENPEPAFTSGSRR
Ga0209693_1054374623300027855SoilSMALRINEIMQRFSSLASEMREAENASQAETEAESASPGSHR
Ga0209701_1014324313300027862Vadose Zone SoilSMALRINEIMQRFSSLASEMRDAENASQAETEEAPATPSRRR
Ga0209167_1056310513300027867Surface SoilRINEIMQRFSLLATEMKADETASQHETVEAETSPSRRR
Ga0209283_1055182033300027875Vadose Zone SoilINEIMQRFSSLANEMREAENASQGETEETPSAISRPR
Ga0302228_1031251713300028808PalsaRINEIMQRFSSLSSEMREVETASHAENQEEPAATGTRR
Ga0308309_1161196613300028906SoilRINEIMQRFSLLATEMKADETASQHETVEAESSPSRRR
Ga0170834_10920115433300031057Forest SoilLRINEIMQRFSSLASEMREAENASQAETEELPESISTRR
Ga0170823_1739192213300031128Forest SoilIHTMALRINEVMQRFSSLASELREGETQSQVETEEVNSTPNSRR
Ga0307474_1087751323300031718Hardwood Forest SoilIHTMALRINEVMQRFSSLASELREGETQSQIETEEVNSTPNSRR
Ga0307473_1055101713300031820Hardwood Forest SoilEIMQRFSSLASEMKDAENASQAETEEASAAPSRRR
Ga0307479_1003524013300031962Hardwood Forest SoilRMNEIMQRFSSLASEMKDAENASQAETEEGPAAPSRRH
Ga0307479_1119966033300031962Hardwood Forest SoilHSMALRINEVMQRFSSLASEMQEAENASQAETEETVTSPSRRR
Ga0307471_10422200223300032180Hardwood Forest SoilHSMTLRINEIMQRFSSLSSEMREAENASQAETEDLPESLSTRP
Ga0335069_1201261023300032893SoilLYQIKTMHHMTLRIHEIMQRFSSLASEMRDAENASHAETQNVPAGASRRR
Ga0335084_1171541323300033004SoilMHEIMQRFSSLDAEMRFVERASQSETKDRAAGFGTST
Ga0364932_0380220_44_1693300034177SedimentMALRLSEIMQRFSSLASEMRELEKASQAETEEVSTGSVRRE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.