Basic Information | |
---|---|
Family ID | F092041 |
Family Type | Metagenome |
Number of Sequences | 107 |
Average Sequence Length | 39 residues |
Representative Sequence | KVYIDHDVSKEIGHIGTFEFRHEHTWIVKEEMEKEAQ |
Number of Associated Samples | 78 |
Number of Associated Scaffolds | 107 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 98.13 % |
% of genes from short scaffolds (< 2000 bps) | 87.85 % |
Associated GOLD sequencing projects | 75 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.18 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (86.916 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (28.037 % of family members) |
Environment Ontology (ENVO) | Unclassified (57.944 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (65.421 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 21.54% β-sheet: 0.00% Coil/Unstructured: 78.46% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.18 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 107 Family Scaffolds |
---|---|---|
PF07460 | NUMOD3 | 0.93 |
PF01583 | APS_kinase | 0.93 |
PF13392 | HNH_3 | 0.93 |
COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
---|---|---|---|
COG0529 | Adenylylsulfate kinase or related kinase | Inorganic ion transport and metabolism [P] | 0.93 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 98.13 % |
Unclassified | root | N/A | 1.87 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300004126|Ga0066179_10140348 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 648 | Open in IMG/M |
3300005527|Ga0068876_10379656 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 790 | Open in IMG/M |
3300005527|Ga0068876_10773926 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
3300005581|Ga0049081_10204673 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 706 | Open in IMG/M |
3300005581|Ga0049081_10257499 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 611 | Open in IMG/M |
3300005582|Ga0049080_10173872 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 717 | Open in IMG/M |
3300005828|Ga0074475_10086911 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
3300005832|Ga0074469_10492513 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 592 | Open in IMG/M |
3300006484|Ga0070744_10076102 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 974 | Open in IMG/M |
3300006805|Ga0075464_10028457 | All Organisms → cellular organisms → Bacteria | 2959 | Open in IMG/M |
3300006805|Ga0075464_10400440 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 834 | Open in IMG/M |
3300006805|Ga0075464_11023116 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 519 | Open in IMG/M |
3300006917|Ga0075472_10696284 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 511 | Open in IMG/M |
3300007559|Ga0102828_1133763 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 616 | Open in IMG/M |
3300007716|Ga0102867_1097675 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 782 | Open in IMG/M |
3300008107|Ga0114340_1167437 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 787 | Open in IMG/M |
3300008107|Ga0114340_1221023 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 610 | Open in IMG/M |
3300008259|Ga0114841_1281108 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
3300008266|Ga0114363_1032028 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2624 | Open in IMG/M |
3300008266|Ga0114363_1140915 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 811 | Open in IMG/M |
3300008266|Ga0114363_1180010 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 671 | Open in IMG/M |
3300008448|Ga0114876_1192433 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 697 | Open in IMG/M |
3300008450|Ga0114880_1157301 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 811 | Open in IMG/M |
3300008450|Ga0114880_1159526 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 802 | Open in IMG/M |
3300009009|Ga0105105_10344929 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 816 | Open in IMG/M |
3300009068|Ga0114973_10088692 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1768 | Open in IMG/M |
3300009152|Ga0114980_10274399 | Not Available | 982 | Open in IMG/M |
3300009152|Ga0114980_10724485 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
3300009163|Ga0114970_10249499 | All Organisms → Viruses → Predicted Viral | 1026 | Open in IMG/M |
3300009180|Ga0114979_10023411 | All Organisms → Viruses → Predicted Viral | 3937 | Open in IMG/M |
3300009181|Ga0114969_10618401 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 592 | Open in IMG/M |
3300009184|Ga0114976_10399788 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 719 | Open in IMG/M |
3300011011|Ga0139556_1027513 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 831 | Open in IMG/M |
3300011184|Ga0136709_1029755 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 754 | Open in IMG/M |
3300011339|Ga0153700_10114 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 36794 | Open in IMG/M |
3300012012|Ga0153799_1081685 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 580 | Open in IMG/M |
3300012663|Ga0157203_1021674 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
3300012664|Ga0157497_1021539 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 862 | Open in IMG/M |
3300013005|Ga0164292_10521175 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 777 | Open in IMG/M |
3300013372|Ga0177922_10292847 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 755 | Open in IMG/M |
3300013372|Ga0177922_10656851 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1306 | Open in IMG/M |
3300013372|Ga0177922_11124889 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
3300017701|Ga0181364_1019885 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1106 | Open in IMG/M |
3300017701|Ga0181364_1058133 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 600 | Open in IMG/M |
3300017707|Ga0181363_1038713 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 880 | Open in IMG/M |
3300017723|Ga0181362_1071343 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 705 | Open in IMG/M |
3300017736|Ga0181365_1001783 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5165 | Open in IMG/M |
3300017736|Ga0181365_1172314 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
3300017747|Ga0181352_1098613 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 803 | Open in IMG/M |
3300017761|Ga0181356_1101793 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 934 | Open in IMG/M |
3300017766|Ga0181343_1155374 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 637 | Open in IMG/M |
3300017774|Ga0181358_1179023 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 706 | Open in IMG/M |
3300017774|Ga0181358_1183322 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 695 | Open in IMG/M |
3300017774|Ga0181358_1192704 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 671 | Open in IMG/M |
3300017777|Ga0181357_1177448 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 772 | Open in IMG/M |
3300017778|Ga0181349_1179016 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 745 | Open in IMG/M |
3300017778|Ga0181349_1195069 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 703 | Open in IMG/M |
3300017778|Ga0181349_1203205 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 683 | Open in IMG/M |
3300017780|Ga0181346_1224042 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 668 | Open in IMG/M |
3300017780|Ga0181346_1279379 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 573 | Open in IMG/M |
3300019784|Ga0181359_1088323 | All Organisms → cellular organisms → Bacteria | 1153 | Open in IMG/M |
3300019784|Ga0181359_1220625 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 596 | Open in IMG/M |
3300020157|Ga0194049_1163383 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 604 | Open in IMG/M |
3300020176|Ga0181556_1200611 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 762 | Open in IMG/M |
3300020221|Ga0194127_10282007 | All Organisms → cellular organisms → Bacteria | 1130 | Open in IMG/M |
3300021962|Ga0222713_10626029 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 624 | Open in IMG/M |
3300021962|Ga0222713_10652047 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 607 | Open in IMG/M |
3300022179|Ga0181353_1073407 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 871 | Open in IMG/M |
3300022179|Ga0181353_1079946 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 826 | Open in IMG/M |
3300022190|Ga0181354_1028946 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1804 | Open in IMG/M |
3300022190|Ga0181354_1206894 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
3300024298|Ga0255178_1049515 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 818 | Open in IMG/M |
3300024348|Ga0244776_10301849 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1093 | Open in IMG/M |
3300024355|Ga0255157_1079913 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
3300024510|Ga0255187_1027759 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 785 | Open in IMG/M |
3300025630|Ga0208004_1126808 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 577 | Open in IMG/M |
3300025896|Ga0208916_10127705 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1086 | Open in IMG/M |
3300027597|Ga0255088_1023257 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1403 | Open in IMG/M |
3300027608|Ga0208974_1072495 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 953 | Open in IMG/M |
3300027608|Ga0208974_1123034 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 676 | Open in IMG/M |
3300027659|Ga0208975_1004455 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5249 | Open in IMG/M |
3300027659|Ga0208975_1146194 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 661 | Open in IMG/M |
3300027688|Ga0209553_1210298 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 628 | Open in IMG/M |
3300027710|Ga0209599_10009410 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3056 | Open in IMG/M |
3300027759|Ga0209296_1303318 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
3300027785|Ga0209246_10026758 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2180 | Open in IMG/M |
3300027808|Ga0209354_10183992 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 849 | Open in IMG/M |
3300028025|Ga0247723_1000891 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 18831 | Open in IMG/M |
3300031758|Ga0315907_10009423 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9862 | Open in IMG/M |
3300031758|Ga0315907_10613096 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 842 | Open in IMG/M |
3300031784|Ga0315899_10643449 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 994 | Open in IMG/M |
3300031787|Ga0315900_10416401 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1053 | Open in IMG/M |
3300031787|Ga0315900_10806366 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 646 | Open in IMG/M |
3300031857|Ga0315909_10050131 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3872 | Open in IMG/M |
3300031951|Ga0315904_10065634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 3963 | Open in IMG/M |
3300031963|Ga0315901_10438665 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1035 | Open in IMG/M |
3300031963|Ga0315901_10510511 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 934 | Open in IMG/M |
3300031999|Ga0315274_10800894 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 999 | Open in IMG/M |
3300031999|Ga0315274_11483631 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 646 | Open in IMG/M |
3300032046|Ga0315289_10645999 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 973 | Open in IMG/M |
3300034012|Ga0334986_0299571 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 853 | Open in IMG/M |
3300034071|Ga0335028_0699543 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
3300034082|Ga0335020_0105323 | All Organisms → Viruses → Predicted Viral | 1436 | Open in IMG/M |
3300034092|Ga0335010_0465170 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 674 | Open in IMG/M |
3300034102|Ga0335029_0342884 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 925 | Open in IMG/M |
3300034119|Ga0335054_0458101 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 719 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 28.04% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 8.41% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 7.48% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 6.54% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.54% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 5.61% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.61% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.67% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.74% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 3.74% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.74% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.80% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 2.80% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.87% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.87% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.93% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.93% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.93% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.93% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.93% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.93% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.93% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300004126 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (version 2) | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005828 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.182_BBI | Environmental | Open in IMG/M |
3300005832 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.41_BBB | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
3300007716 | Estuarine microbial communities from the Columbia River estuary - metaG 1546B-3 | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300011011 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1m | Environmental | Open in IMG/M |
3300011184 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG | Environmental | Open in IMG/M |
3300011339 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Hannam | Environmental | Open in IMG/M |
3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
3300012664 | Freshwater microbial communities from Zephyr Creek, Ontario, Canada - S17 | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020157 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L224-25m | Environmental | Open in IMG/M |
3300020176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011505AT metaG (spades assembly) | Environmental | Open in IMG/M |
3300020221 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100m | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300024298 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8d | Environmental | Open in IMG/M |
3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
3300024355 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8h | Environmental | Open in IMG/M |
3300024510 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepA_8h | Environmental | Open in IMG/M |
3300025630 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027597 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepB_8d | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027688 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (SPAdes) | Environmental | Open in IMG/M |
3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0066179_101403481 | 3300004126 | Freshwater Lake | KAQELGFKVYIDHDVSKEIGHIGTFEFRHEHTWVMREQLEKEAV* |
Ga0068876_103796562 | 3300005527 | Freshwater Lake | GFKVYIDHDVSKEIGHIGTFEFKHEHTWIVKEEMEKEAT* |
Ga0068876_107739261 | 3300005527 | Freshwater Lake | ELGFKVYIDHDVSKEIGHIGTFEFKHDHTWIVKEEMEKEAS* |
Ga0049081_102046731 | 3300005581 | Freshwater Lentic | GFKIWIDHDVSKEIGHIGTFEFKHDHTWVMKEIEAV* |
Ga0049081_102574992 | 3300005581 | Freshwater Lentic | GLKIWIDHDVSKEIGHIGMFEFRHDHTWAIKDLEKEKVT* |
Ga0049080_101738722 | 3300005582 | Freshwater Lentic | DHDVSQEIGHIGTFEFGHPHTWVVREEMEKERQEAT* |
Ga0074475_100869113 | 3300005828 | Sediment (Intertidal) | KVYIDHDVSHEIGHIGTFEFGHPHTWIVKEEMEKEAKNGT* |
Ga0074469_104925131 | 3300005832 | Sediment (Intertidal) | IDHDVSKEIGHIGMFEFKHDHTWVMREIQETEKVT* |
Ga0070744_100761023 | 3300006484 | Estuarine | VYIDHDVSKEIGHIGTFEFRHEHTWIVKEEMEKEAQ* |
Ga0075464_100284571 | 3300006805 | Aqueous | GFKIHIDHDVSKEIGHIGTFEFKHDHTWVMRELEEKEKAT* |
Ga0075464_104004403 | 3300006805 | Aqueous | YIDHDVSKEIGHIGTFEFRHDHTWIVKEEMEKEAQ* |
Ga0075464_110231162 | 3300006805 | Aqueous | YIDHDVSKEIGHIGTFEFKHEHTWIVKEEMEKEAS* |
Ga0075472_106962841 | 3300006917 | Aqueous | LGYKIYIDHDVSKEIGHIGTFVFRHDHTWIVKEEMDKEAKNGT* |
Ga0102828_11337631 | 3300007559 | Estuarine | ELGYKVYIDHDVSKEIGHIGTFEFRHEHTWIVKEEMEKEAQ* |
Ga0102828_11599892 | 3300007559 | Estuarine | LGFKVYIDHEVSKEIVHIGTLEFKHDHTWVMRDLEKAKEKEET* |
Ga0102867_10976752 | 3300007716 | Estuarine | FKVYIDHDVSHEIGHIGTFEFGHPHTWIVKEEMEKEAQ* |
Ga0114340_11674371 | 3300008107 | Freshwater, Plankton | YIDHDVSKEIGHIGTFEFRHEHTWVMKEQLEKEAV* |
Ga0114340_12210231 | 3300008107 | Freshwater, Plankton | QELGYKVYIDHDVSKEIGHIGTFEFRHEHTWIVKEEMEKEAQ* |
Ga0114841_12811081 | 3300008259 | Freshwater, Plankton | AQELGFKVYIDHDVSKEIGHIGTFEFRHEHTWVMKEQLEKEAV* |
Ga0114363_10320281 | 3300008266 | Freshwater, Plankton | YKVYIDHDVSKEIGHIGTFEFRHEHTWIVKEEMEKEAQ* |
Ga0114363_11409151 | 3300008266 | Freshwater, Plankton | FKVYIDHDVSKEIGHIGTFEFKHEHTWIVKEEMEKEAT* |
Ga0114363_11800102 | 3300008266 | Freshwater, Plankton | YKVYIDHDVSKEIGHIGTFEFRHEHTWIVKEEMEKEAQQWH* |
Ga0114876_11924332 | 3300008448 | Freshwater Lake | IDHDVSKEIGHIGTFEFRHEHTWIVKEEMEKEAQ* |
Ga0114880_11573012 | 3300008450 | Freshwater Lake | LGYKIYIDHDVSHEIGHIGSFEFGHPHTWVVKEEMDKEAKNGT* |
Ga0114880_11595262 | 3300008450 | Freshwater Lake | IDHDVSKEIGHIGTFEFKHEHTWIVKEEMEKEAS* |
Ga0105105_103449291 | 3300009009 | Freshwater Sediment | IDHDVSHEIGHIGSFEFGHPHTWVAKEEMEKEAS* |
Ga0114973_100886924 | 3300009068 | Freshwater Lake | YIDHDVSKEIGHIGTFEFRHEHTWIVKEEMEKEAQ* |
Ga0114980_102743991 | 3300009152 | Freshwater Lake | YIDHDVSKEIGHIGTFEFKHDHTWVMRDLEKAKEKEET* |
Ga0114980_107244851 | 3300009152 | Freshwater Lake | IGYKIYIDHDVSREIGHIGTFEFRHEHTWVVKDLQDKEA* |
Ga0114970_102494991 | 3300009163 | Freshwater Lake | IYIDHDVSKEIGHIGTFEFKHDHTWMMRDIEKEEHGT* |
Ga0114979_100234111 | 3300009180 | Freshwater Lake | KEIGYKIYIDHDVSREIGHIGTFEFRHEHTWVVKDLQDKEA* |
Ga0114969_106184012 | 3300009181 | Freshwater Lake | HDVSKEIGHIGTFEFRHEHTWIVKEEMEKEAKNGT* |
Ga0114976_103997881 | 3300009184 | Freshwater Lake | KAKEIGYKIHIDHDVSREIGHIGTFEFRHEHTWVVKDLQDKET* |
Ga0139556_10275133 | 3300011011 | Freshwater | FKVYIDHDVSKEIGHIGTFEFKHDHTWVMKEELEKEAV* |
Ga0136709_10297552 | 3300011184 | Freshwater | YIDHDVSKEIGHIGTFEFKHDHTWIVKEEMEKEAI* |
Ga0153700_101141 | 3300011339 | Freshwater | KIYIDHDVSKEIGHIGTFEFRHDHTWIVKEEMEKEAQ* |
Ga0153799_10816852 | 3300012012 | Freshwater | IDHDVSKEIGHIGTFEFRHEHTWVMREQLEKEAV* |
Ga0157203_10216743 | 3300012663 | Freshwater | GYKVYIDHDVSKEIGHIGTFEFRHEHTWIVKEEMEKEAQ* |
Ga0157497_10215393 | 3300012664 | Freshwater | YIDHDVSKEIGHIGTFEFKHDHTWVMRDLEKAKEAT* |
Ga0164292_105211752 | 3300013005 | Freshwater | AQELGYKVYIDHDVSKEIGHIGTFEFRHEHTWIVKEEMEKEAQ* |
Ga0177922_102928472 | 3300013372 | Freshwater | GFKIWIDHDVSKEIGHIGMFEFKHDHTWVMREIQETEKVT* |
Ga0177922_106568511 | 3300013372 | Freshwater | DHDVSKEIGHIGMFEFKHDHTWVMREILETEKVT* |
Ga0177922_111248892 | 3300013372 | Freshwater | AAAAGFKIWIDHDVSKEIGHIGTFEFKHDHTWVMKEIEAV* |
Ga0181364_10198851 | 3300017701 | Freshwater Lake | FKIWIDHDVSKEIGHIGTFEFKHDHTWVMKEIKAV |
Ga0181364_10581331 | 3300017701 | Freshwater Lake | KNYKVYIDHDVSKEIGHIGTFEFRHEHTWIVKEEMEKEAQ |
Ga0181363_10387133 | 3300017707 | Freshwater Lake | KVYIDHDVSKEIGHIGTFEFKHEHTWIVKEEMEKEAS |
Ga0181362_10713432 | 3300017723 | Freshwater Lake | LGYKVYIDHDVSKEIGHIGTFEFRHEHTWIVKEEMEKEAQ |
Ga0181365_10017831 | 3300017736 | Freshwater Lake | KKAQELGFKVYIDHDVSKEIGHIGTFEFRHEHTWVMREQLEKEAV |
Ga0181365_11723141 | 3300017736 | Freshwater Lake | AAAAGFKIWIDHDVSKEIGHIGTFEFKHDHTWVMKEIKAV |
Ga0181352_10986132 | 3300017747 | Freshwater Lake | YKIYIDHDVSKEIGHIGTFEFRHDHTWIVKEEMEKEAQ |
Ga0181356_11017931 | 3300017761 | Freshwater Lake | YIDHDVSKEIGHIGTFEFRHEHTWVMREQLEKEAA |
Ga0181343_11553742 | 3300017766 | Freshwater Lake | RIYIDHDVSKEIGHIGTFEFKHDHTWMMRDIEKEKAEHGT |
Ga0181358_11790232 | 3300017774 | Freshwater Lake | GYKIYIDHDVSREIGHIGTFEFRHEHTWVVKDLQDKEA |
Ga0181358_11833222 | 3300017774 | Freshwater Lake | AQELGFKVYIDHDVSKEIGHIGTFEFRHEHTWVMREQLEKDAV |
Ga0181358_11927041 | 3300017774 | Freshwater Lake | KVYIDHDVSKEIGHIGTFEFRHEHTWVMREQLEKEAV |
Ga0181357_11774481 | 3300017777 | Freshwater Lake | KEIGYKIYIDHDVSREIGHIGTFEFRHEHTWVVKDLQDKEA |
Ga0181349_11790161 | 3300017778 | Freshwater Lake | GYKVYIDHDVSKEIGHIGTFEFRHEHTWIVKEEMDKEAQ |
Ga0181349_11950691 | 3300017778 | Freshwater Lake | KAAAAGFKIWIDHDVSKEIGHIGTFEFKHDHTWVMKEIEAV |
Ga0181349_12032052 | 3300017778 | Freshwater Lake | GFKIWIDHDVSKEIGHVGTFEFKHDHTWVIKDLEKEKAP |
Ga0181346_12240421 | 3300017780 | Freshwater Lake | LGFKVYIDHDVSKEIGHIGTFEFRHEHTWVMKEQIEKEAV |
Ga0181346_12793792 | 3300017780 | Freshwater Lake | FKIWIDHDVSKEIGHIGTFEFKHDHTWVMKEIKAI |
Ga0181359_10883233 | 3300019784 | Freshwater Lake | GYKVYIDHDVSKEIGHIGTFEFRHEHTWIVKEEMEKEAQ |
Ga0181359_12206252 | 3300019784 | Freshwater Lake | ELGYKVYIDHDVSKEIGHIGTFEFRHEHTWIVKEEMEKEAQ |
Ga0194049_11633832 | 3300020157 | Anoxic Zone Freshwater | PKEIGYKIHIDHDVSREIGHIGTFEFRHEHTWVVKDLQDKEA |
Ga0181556_12006112 | 3300020176 | Salt Marsh | AQELGYKIYIDHDVSKEIGHIGTFEFRHDHTWIVKEEMEKEAKDGT |
Ga0194127_102820071 | 3300020221 | Freshwater Lake | FFKIWIDHDVSKEIGHIGMFEFKHDHTWAIKDLEKERAG |
Ga0222713_106260291 | 3300021962 | Estuarine Water | KIYIDHDVSKEIGHIGTFEFRHDHTWIVKEEMEKEAKDGT |
Ga0222713_106520471 | 3300021962 | Estuarine Water | AGFKIYIDHDLSKEIGHIGTFEFKHDHTWVMRDLEKAKEAS |
Ga0181353_10734071 | 3300022179 | Freshwater Lake | FKVYIDHDVSKEIGHIGTFEFKHEHTWIVKEEMEKEAS |
Ga0181353_10799463 | 3300022179 | Freshwater Lake | HDVSKEIGHIGTFEFRHEHTWIVKEEMEKEAQQWH |
Ga0181354_10289461 | 3300022190 | Freshwater Lake | KAQELGYKVYIDHDVSKEIGHIGTFEFRHEHTWIVKEEMEKEAQ |
Ga0181354_12068942 | 3300022190 | Freshwater Lake | KVYIDHDVSKEIGHIGTFEFRHEHTWIVKEEMEKEAQ |
Ga0255178_10495152 | 3300024298 | Freshwater | KIWIDHDVSKEIGHIGMFEFKHDHTWIVKDLEKEKAT |
Ga0244776_103018491 | 3300024348 | Estuarine | KIYIDHDVSKEIGHIGTFEFRHDHTWIVKEEMEKEAQ |
Ga0255157_10799132 | 3300024355 | Freshwater | KKAQELGFKVYIDHDVSKEIGHIGTFEFKHEHTWIVKEEMEKEAS |
Ga0255187_10277591 | 3300024510 | Freshwater | LGFKVYIDHDVSKEIGHIGTFEFKHEHTWIVKEEMEKEAS |
Ga0208004_11268081 | 3300025630 | Aqueous | FKVYIDHDVSKEIGHIGTFEFRHEHTWIVKEQMEKEAV |
Ga0208916_101277054 | 3300025896 | Aqueous | QELGFKVYIDHDVSKEIGHIGTFEFKHEHTWIVKEEIEKEAS |
Ga0255088_10232574 | 3300027597 | Freshwater | HGFKVYIDHDVSKEIGHIGTFEFKHEHTWIVKEEMEKEAS |
Ga0208974_10724953 | 3300027608 | Freshwater Lentic | QELGYKVYIDHDVSKEIGHIGTFEFRHEHTWIVKEEMEKEAQ |
Ga0208974_11230342 | 3300027608 | Freshwater Lentic | YIDHDVSKEIGHIGTFEFRHEHTWIVKEEMEKEAQ |
Ga0208975_100445511 | 3300027659 | Freshwater Lentic | YKVYIDHDVSKEIGHIGTFEFRHEHTWIVKEEMEKEAQ |
Ga0208975_11461942 | 3300027659 | Freshwater Lentic | IGYKIHIDHDVSREIGHIGTFEFRHEHTWVVKDLQDKEA |
Ga0209553_12102982 | 3300027688 | Freshwater Lake | VYIDHDVSKEIGHIGTFEFRHEHTWVMREQLEKEAV |
Ga0209599_100094101 | 3300027710 | Deep Subsurface | VYIDHDVSKEIGHIGTFEFRHEHTWIVKEEMEKEAQ |
Ga0209296_13033182 | 3300027759 | Freshwater Lake | AQELGYKVYIDHDVSKEIGHIGTFEFRHEHTWIVKEEMEKEAQ |
Ga0209246_100267585 | 3300027785 | Freshwater Lake | EAGFKIWIDHDVSKEIGHIGMFEFKHDHTWVMREVQEKEAV |
Ga0209354_101839921 | 3300027808 | Freshwater Lake | IWIDHDVSKEIGHIGMFEFKHDHTWVMREVQEKEAV |
Ga0247723_100089126 | 3300028025 | Deep Subsurface Sediment | YIDHDVSKEIGHIGTFEFRHDHTWIVKEEMEKEAKDGT |
Ga0315907_1000942318 | 3300031758 | Freshwater | GFKIWIDHDVSKEIGHVGTFEYKHEHTWIVKDLEKEKAP |
Ga0315907_106130963 | 3300031758 | Freshwater | YIDHDVSKEIGHIGTFEFRHEHTWVMKEQLEKEAV |
Ga0315899_106434491 | 3300031784 | Freshwater | YKVYIDHDVSQEIGHIGTFEFRHEHTWIVKEEMEKEAQ |
Ga0315900_104164011 | 3300031787 | Freshwater | DHDVSKEIGHIGTFEFRHDHTWIVKEELDKEAKNGT |
Ga0315900_108063662 | 3300031787 | Freshwater | IWIDHDVSKEIGHIGMFEFKHDHTWAIKDLEKAKET |
Ga0315909_100501319 | 3300031857 | Freshwater | QELGYKVYIDHDVSKEIGHIGTFEFRHEHTWIVKEEMEKEAQQWH |
Ga0315904_100656341 | 3300031951 | Freshwater | GYKVYIDHDVSKEIGHIGTFEFRHEHTWIVKEEMEKEAQQWH |
Ga0315901_104386651 | 3300031963 | Freshwater | GFKVYIDHDVSKEIGHIGTFEFRHEHTWVMKEQLEKEAV |
Ga0315901_105105113 | 3300031963 | Freshwater | KVYIDHDVSKEIGHIGTFEFRHEHTWIVKEEMEKEAQQWH |
Ga0315274_108008943 | 3300031999 | Sediment | LKAKEIGYKIYIDHDVSREIGHIGTFEFRHEHTWVVKDLQDKEA |
Ga0315274_114836312 | 3300031999 | Sediment | AQELGFKVYIDHDVSKEIGHIGTFEFKHDHTWVMKEELEKEAV |
Ga0315289_106459991 | 3300032046 | Sediment | IGYKIYIDHDVSREIGHIGTFEFRHEHTWVVKDLQDKEA |
Ga0334986_0299571_723_851 | 3300034012 | Freshwater | REAGFKIWIDHDVSKEIGHIGTFEFKHDHTWAIKDLEKAKET |
Ga0335028_0699543_414_530 | 3300034071 | Freshwater | YIDHDVSHEIGHIGTFEFGHPHTWIVKEEMEKEAKNGT |
Ga0335020_0105323_3_128 | 3300034082 | Freshwater | KEIGYKIYIDHDVSREIGHVGTFEFRHEHTWVVKDLQDKEA |
Ga0335010_0465170_9_119 | 3300034092 | Freshwater | VYIDHDVSKEIGHIGTFEFKHEHTWIVKEEMEKEAS |
Ga0335029_0342884_797_925 | 3300034102 | Freshwater | QELGYKVYIDHDVSKEIGHIGTFEFRHEHTWIVKEEMEKEAV |
Ga0335054_0458101_1_126 | 3300034119 | Freshwater | FKVYIDHDVSHEIGHIGTFEFGHPHTWIVKEEMEKEAKNGT |
⦗Top⦘ |