Basic Information | |
---|---|
Family ID | F091889 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 107 |
Average Sequence Length | 43 residues |
Representative Sequence | MRERAIKTILDLTDKYSRQELESIKDTQELVALSYDVKKILL |
Number of Associated Samples | 93 |
Number of Associated Scaffolds | 107 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 8.41 % |
% of genes near scaffold ends (potentially truncated) | 15.89 % |
% of genes from short scaffolds (< 2000 bps) | 68.22 % |
Associated GOLD sequencing projects | 84 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.59 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (46.729 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (19.626 % of family members) |
Environment Ontology (ENVO) | Unclassified (58.879 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (85.981 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.29% β-sheet: 0.00% Coil/Unstructured: 55.71% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 107 Family Scaffolds |
---|---|---|
PF00166 | Cpn10 | 2.80 |
PF00847 | AP2 | 1.87 |
PF00118 | Cpn60_TCP1 | 0.93 |
PF00145 | DNA_methylase | 0.93 |
PF06094 | GGACT | 0.93 |
PF14743 | DNA_ligase_OB_2 | 0.93 |
PF08800 | VirE_N | 0.93 |
PF04404 | ERF | 0.93 |
PF00777 | Glyco_transf_29 | 0.93 |
PF01510 | Amidase_2 | 0.93 |
PF06378 | DUF1071 | 0.93 |
PF04466 | Terminase_3 | 0.93 |
PF08299 | Bac_DnaA_C | 0.93 |
COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
---|---|---|---|
COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 2.80 |
COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.93 |
COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.93 |
COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 0.93 |
COG1783 | Phage terminase large subunit | Mobilome: prophages, transposons [X] | 0.93 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 53.27 % |
Unclassified | root | N/A | 46.73 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000115|DelMOSum2011_c10151514 | Not Available | 688 | Open in IMG/M |
3300001965|GOS2243_1041646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1745 | Open in IMG/M |
3300001965|GOS2243_1049090 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1805 | Open in IMG/M |
3300003264|JGI26119J46589_1032323 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 622 | Open in IMG/M |
3300004369|Ga0065726_10522 | Not Available | 57069 | Open in IMG/M |
3300004457|Ga0066224_1170494 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 621 | Open in IMG/M |
3300004460|Ga0066222_1176595 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 963 | Open in IMG/M |
3300005404|Ga0066856_10221750 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 820 | Open in IMG/M |
3300005523|Ga0066865_10008864 | All Organisms → Viruses → Predicted Viral | 3100 | Open in IMG/M |
3300005523|Ga0066865_10019002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 2228 | Open in IMG/M |
3300005941|Ga0070743_10003836 | Not Available | 5492 | Open in IMG/M |
3300006029|Ga0075466_1046822 | Not Available | 1289 | Open in IMG/M |
3300006735|Ga0098038_1001158 | Not Available | 11557 | Open in IMG/M |
3300006735|Ga0098038_1010520 | All Organisms → cellular organisms → Archaea | 3629 | Open in IMG/M |
3300006749|Ga0098042_1129991 | All Organisms → cellular organisms → Archaea | 625 | Open in IMG/M |
3300006802|Ga0070749_10042520 | All Organisms → cellular organisms → Bacteria | 2791 | Open in IMG/M |
3300006802|Ga0070749_10115783 | Not Available | 1576 | Open in IMG/M |
3300006916|Ga0070750_10004035 | All Organisms → Viruses | 8059 | Open in IMG/M |
3300006916|Ga0070750_10422396 | Not Available | 554 | Open in IMG/M |
3300006920|Ga0070748_1268903 | Not Available | 610 | Open in IMG/M |
3300007346|Ga0070753_1368619 | Not Available | 503 | Open in IMG/M |
3300007539|Ga0099849_1017083 | All Organisms → cellular organisms → Bacteria | 3179 | Open in IMG/M |
3300007539|Ga0099849_1166928 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 843 | Open in IMG/M |
3300007539|Ga0099849_1228341 | Not Available | 691 | Open in IMG/M |
3300007539|Ga0099849_1289614 | Not Available | 593 | Open in IMG/M |
3300007540|Ga0099847_1130799 | Not Available | 753 | Open in IMG/M |
3300007553|Ga0102819_1039994 | Not Available | 794 | Open in IMG/M |
3300007609|Ga0102945_1022304 | Not Available | 1384 | Open in IMG/M |
3300007692|Ga0102823_1008597 | All Organisms → Viruses → Predicted Viral | 3012 | Open in IMG/M |
3300008417|Ga0115363_10465437 | Not Available | 848 | Open in IMG/M |
3300009000|Ga0102960_1179724 | Not Available | 758 | Open in IMG/M |
3300009002|Ga0102810_1120325 | Not Available | 813 | Open in IMG/M |
3300009003|Ga0102813_1117446 | Not Available | 842 | Open in IMG/M |
3300009059|Ga0102830_1143135 | Not Available | 703 | Open in IMG/M |
3300009141|Ga0102884_1129535 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 637 | Open in IMG/M |
3300009428|Ga0114915_1117930 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 775 | Open in IMG/M |
3300009507|Ga0115572_10694108 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 555 | Open in IMG/M |
3300009606|Ga0115102_10285677 | Not Available | 693 | Open in IMG/M |
3300010148|Ga0098043_1045347 | All Organisms → cellular organisms → Archaea | 1355 | Open in IMG/M |
3300010150|Ga0098056_1016170 | All Organisms → Viruses → Predicted Viral | 2687 | Open in IMG/M |
3300010296|Ga0129348_1273451 | Not Available | 566 | Open in IMG/M |
3300010299|Ga0129342_1293075 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 560 | Open in IMG/M |
3300010300|Ga0129351_1053283 | Not Available | 1652 | Open in IMG/M |
3300012920|Ga0160423_10776708 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 645 | Open in IMG/M |
3300013101|Ga0164313_10690944 | Not Available | 841 | Open in IMG/M |
3300013195|Ga0116815_1004601 | Not Available | 1580 | Open in IMG/M |
3300017714|Ga0181412_1087296 | Not Available | 744 | Open in IMG/M |
3300017751|Ga0187219_1223089 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300017752|Ga0181400_1174783 | Not Available | 601 | Open in IMG/M |
3300017764|Ga0181385_1000331 | Not Available | 18132 | Open in IMG/M |
3300017772|Ga0181430_1008034 | Not Available | 3728 | Open in IMG/M |
3300017786|Ga0181424_10122227 | Not Available | 1122 | Open in IMG/M |
3300017818|Ga0181565_10059366 | All Organisms → Viruses → Predicted Viral | 2751 | Open in IMG/M |
3300017818|Ga0181565_10271255 | All Organisms → Viruses → Predicted Viral | 1146 | Open in IMG/M |
3300017951|Ga0181577_10070538 | All Organisms → Viruses → Predicted Viral | 2455 | Open in IMG/M |
3300018080|Ga0180433_10822442 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 684 | Open in IMG/M |
3300018416|Ga0181553_10029833 | All Organisms → cellular organisms → Bacteria | 3874 | Open in IMG/M |
3300018416|Ga0181553_10175039 | Not Available | 1258 | Open in IMG/M |
3300018416|Ga0181553_10495237 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
3300018420|Ga0181563_10309690 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
3300018428|Ga0181568_10871702 | Not Available | 692 | Open in IMG/M |
3300019096|Ga0188835_1002295 | All Organisms → Viruses → Predicted Viral | 2143 | Open in IMG/M |
3300020184|Ga0181573_10209043 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
3300020404|Ga0211659_10013230 | All Organisms → cellular organisms → Archaea | 4112 | Open in IMG/M |
3300020438|Ga0211576_10049384 | All Organisms → Viruses → Predicted Viral | 2409 | Open in IMG/M |
3300020445|Ga0211564_10322212 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 761 | Open in IMG/M |
3300021347|Ga0213862_10245643 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300021364|Ga0213859_10179138 | Not Available | 989 | Open in IMG/M |
3300021368|Ga0213860_10009662 | All Organisms → cellular organisms → Bacteria | 3947 | Open in IMG/M |
3300021371|Ga0213863_10030509 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 2977 | Open in IMG/M |
3300021373|Ga0213865_10014952 | Not Available | 4420 | Open in IMG/M |
3300021373|Ga0213865_10069686 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1915 | Open in IMG/M |
3300021375|Ga0213869_10069620 | Not Available | 1775 | Open in IMG/M |
3300021957|Ga0222717_10508711 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 647 | Open in IMG/M |
3300021958|Ga0222718_10562955 | Not Available | 541 | Open in IMG/M |
3300021961|Ga0222714_10105314 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1774 | Open in IMG/M |
3300022072|Ga0196889_1014215 | All Organisms → Viruses → Predicted Viral | 1710 | Open in IMG/M |
3300022164|Ga0212022_1002664 | All Organisms → Viruses → Predicted Viral | 2084 | Open in IMG/M |
3300022200|Ga0196901_1003029 | Not Available | 7905 | Open in IMG/M |
3300022929|Ga0255752_10440924 | Not Available | 501 | Open in IMG/M |
(restricted) 3300023109|Ga0233432_10032077 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 4572_77 | 3575 | Open in IMG/M |
(restricted) 3300023109|Ga0233432_10198743 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
(restricted) 3300023210|Ga0233412_10001489 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 12119 | Open in IMG/M |
(restricted) 3300024062|Ga0255039_10000317 | All Organisms → Viruses | 16072 | Open in IMG/M |
3300024180|Ga0228668_1000885 | Not Available | 10919 | Open in IMG/M |
3300024343|Ga0244777_10028702 | All Organisms → Viruses → Predicted Viral | 3526 | Open in IMG/M |
(restricted) 3300024517|Ga0255049_10613095 | Not Available | 508 | Open in IMG/M |
(restricted) 3300024519|Ga0255046_10259174 | Not Available | 804 | Open in IMG/M |
3300025070|Ga0208667_1007797 | All Organisms → Viruses → Predicted Viral | 2643 | Open in IMG/M |
3300025086|Ga0208157_1000202 | Not Available | 37728 | Open in IMG/M |
3300025101|Ga0208159_1050358 | Not Available | 865 | Open in IMG/M |
3300025101|Ga0208159_1100663 | All Organisms → cellular organisms → Archaea | 515 | Open in IMG/M |
3300025120|Ga0209535_1002227 | Not Available | 12683 | Open in IMG/M |
3300025543|Ga0208303_1126357 | Not Available | 509 | Open in IMG/M |
3300025645|Ga0208643_1184470 | Not Available | 504 | Open in IMG/M |
3300025652|Ga0208134_1037985 | All Organisms → Viruses → Predicted Viral | 1628 | Open in IMG/M |
3300025674|Ga0208162_1163473 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 598 | Open in IMG/M |
3300025759|Ga0208899_1073064 | Not Available | 1366 | Open in IMG/M |
3300025889|Ga0208644_1001508 | Not Available | 19365 | Open in IMG/M |
3300026187|Ga0209929_1058764 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1070 | Open in IMG/M |
3300027251|Ga0208809_1028036 | Not Available | 1029 | Open in IMG/M |
3300027858|Ga0209013_10167678 | All Organisms → Viruses → Predicted Viral | 1360 | Open in IMG/M |
3300027917|Ga0209536_100665055 | All Organisms → Viruses → Predicted Viral | 1294 | Open in IMG/M |
3300029309|Ga0183683_1008199 | All Organisms → cellular organisms → Archaea | 2847 | Open in IMG/M |
3300029448|Ga0183755_1080089 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 700 | Open in IMG/M |
3300031519|Ga0307488_10407072 | Not Available | 839 | Open in IMG/M |
3300031539|Ga0307380_10892503 | Not Available | 722 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 19.63% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 13.08% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 9.35% |
Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 7.48% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 7.48% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 7.48% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 5.61% |
Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 3.74% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.80% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 2.80% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.80% |
Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 2.80% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.87% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.93% |
Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 0.93% |
Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.93% |
Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.93% |
Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.93% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.93% |
Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.93% |
Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.93% |
Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.93% |
Marine | Environmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine | 0.93% |
Saline | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline | 0.93% |
Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.93% |
Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.93% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.93% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
3300001965 | Marine microbial communities from Coastal Floreana, Equador - GS028 | Environmental | Open in IMG/M |
3300003264 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_54_BLW_10 | Environmental | Open in IMG/M |
3300004369 | Saline microbial communities from the South Caspian sea - cas-15 | Environmental | Open in IMG/M |
3300004457 | Marine viral communities from Newfoundland, Canada MC-1 | Environmental | Open in IMG/M |
3300004460 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
3300005404 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV205 | Environmental | Open in IMG/M |
3300005523 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265 | Environmental | Open in IMG/M |
3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
3300007553 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.689 | Environmental | Open in IMG/M |
3300007609 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_H2O_MG | Environmental | Open in IMG/M |
3300007692 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743 | Environmental | Open in IMG/M |
3300008417 | Sea floor sediment microbial communities from Gulf of Mexico Methane Seep - MPC12T | Environmental | Open in IMG/M |
3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
3300009002 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573 | Environmental | Open in IMG/M |
3300009003 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725 | Environmental | Open in IMG/M |
3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
3300009141 | Estuarine microbial communities from the Columbia River estuary - metaG 1550A-3 | Environmental | Open in IMG/M |
3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
3300009606 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
3300013101 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay4, Core 4569-4, 0-3 cm | Environmental | Open in IMG/M |
3300013195 | Marine hypoxic microbial communities from the Gulf of Mexico, USA - 10m_Station7_GOM_Metagenome | Environmental | Open in IMG/M |
3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
3300017818 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018080 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_1 metaG | Environmental | Open in IMG/M |
3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018428 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300019096 | Metatranscriptome of marine microbial communities from Baltic Sea - GS676_0p1 | Environmental | Open in IMG/M |
3300020184 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101409BT metaG (spades assembly) | Environmental | Open in IMG/M |
3300020404 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978) | Environmental | Open in IMG/M |
3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
3300020445 | Marine microbial communities from Tara Oceans - TARA_B100001996 (ERX555961-ERR599087) | Environmental | Open in IMG/M |
3300021347 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266 | Environmental | Open in IMG/M |
3300021364 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304 | Environmental | Open in IMG/M |
3300021368 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550 | Environmental | Open in IMG/M |
3300021371 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497 | Environmental | Open in IMG/M |
3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300022072 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3) | Environmental | Open in IMG/M |
3300022164 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2) | Environmental | Open in IMG/M |
3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022929 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG | Environmental | Open in IMG/M |
3300023109 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MG | Environmental | Open in IMG/M |
3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
3300024062 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1 | Environmental | Open in IMG/M |
3300024180 | Seawater microbial communities from Monterey Bay, California, United States - 82D | Environmental | Open in IMG/M |
3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
3300024517 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_3 | Environmental | Open in IMG/M |
3300024519 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27 | Environmental | Open in IMG/M |
3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025101 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
3300026187 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
3300027251 | Estuarine microbial communities from the Columbia River estuary - metaG 1556B-02 (SPAdes) | Environmental | Open in IMG/M |
3300027858 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 2 (SPAdes) | Environmental | Open in IMG/M |
3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
3300029309 | Marine viral communities collected during Tara Oceans survey from station TARA_100 - TARA_R100001440 | Environmental | Open in IMG/M |
3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
DelMOSum2011_101515141 | 3300000115 | Marine | MRERAIKRILNITNKYTRKELEGIKNTIELVSLSYDIERIFK* |
GOS2243_10416468 | 3300001965 | Marine | MRERAIKRILDITDKYSRQELELIKDTQELVALSYDVKKIIL* |
GOS2243_10490902 | 3300001965 | Marine | MRERAIKRILDITDKYSRQELELIKDTQELVALSYDVKKILL* |
JGI26119J46589_10323232 | 3300003264 | Marine | MRERAINRILDLTDAYSRKELESIKDTQELVALSYDIKKNRL* |
Ga0065726_1052247 | 3300004369 | Saline | MRDRAINRILNLTDVYTREELESIKDTQELVALSYDVVELLTKKK* |
Ga0066224_11704942 | 3300004457 | Marine | MRKRAIKRILDLTDKYSRQELELIKDTQELVALSYDVKKILL* |
Ga0066222_11765952 | 3300004460 | Marine | MRERAIKKILSLTDKYTRKELEAIENTQELVVLSYDIERVLS* |
Ga0066856_102217502 | 3300005404 | Marine | MRERAIKEILDLTNKYTRKELESIKDTQDLLALSCDIKKILK* |
Ga0066865_100088646 | 3300005523 | Marine | MRERAIKRILDLTNKYTKKELESIKDTQDLLALSYDVKRVLT* |
Ga0066865_100190022 | 3300005523 | Marine | MRERAIKRILNLTNKYTRKELELIKDTQDLLALSYDVKKILN* |
Ga0070743_1000383611 | 3300005941 | Estuarine | LDLTDAYSRKELESIKDTQELVALSYDVKKVLIN* |
Ga0075466_10468222 | 3300006029 | Aqueous | MRERAINRILNLTDKYSKNQLESIKDTQELVALSYDVQKILT* |
Ga0098038_100115819 | 3300006735 | Marine | MRERAINRILNLTDKYSKNELESIKDTQELVALSYDVQKILT* |
Ga0098038_101052012 | 3300006735 | Marine | MRERAIKRILDITDKYSRQELELIKDTQELVALSYDVKKIIR* |
Ga0098042_11299912 | 3300006749 | Marine | MRERAIKRILDITNKYSKQELELIKDTQELVALSYDVKKILL* |
Ga0070749_1004252011 | 3300006802 | Aqueous | MRERAIKTILDLTDKYSRQELESIKDTLELVALSYDVKKILL* |
Ga0070749_101157832 | 3300006802 | Aqueous | MRERAINRILSLTGAYSREELEGIKDTLELVALSYDVKKIL* |
Ga0070750_100040359 | 3300006916 | Aqueous | MKERAIKRILDLTDGWTKEELENIEDTLELVALSYDVEQAIKFRKI* |
Ga0070750_104223961 | 3300006916 | Aqueous | TSKDMRERAINRILSLTGAYSREELEGIKDTLELVALSYDVKKIL* |
Ga0070748_12689031 | 3300006920 | Aqueous | MRKRAINRILNLTDKYTRTELESIEDTLELVVLSYDIEKVLT* |
Ga0070753_13686192 | 3300007346 | Aqueous | MRERAIKEILSLTDAYSREELESIKETLELVALSWDVKKIVKS* |
Ga0099849_10170836 | 3300007539 | Aqueous | METIRARAINRILDLTTGWTRSELENIEDTLELAALSYDVERAIKYIKL* |
Ga0099849_11669282 | 3300007539 | Aqueous | MRERAINTILSLTDAYSRKELESIEDTLELVALSYDVKKIVKL* |
Ga0099849_12283412 | 3300007539 | Aqueous | MRERAIKEILSLTDAYSREELESIKETLELVALSWDVKKIVKL* |
Ga0099849_12896141 | 3300007539 | Aqueous | MRERAIKRILDLTEKYSREELELIKDTQELVALSYEVKKILL* |
Ga0099847_11307991 | 3300007540 | Aqueous | MRERAIRRILNLTDKYSREELENINNTLDLVALSYEVEKVLTN* |
Ga0102819_10399943 | 3300007553 | Estuarine | MRERAINRILDLTDAYSRKELESIKDTQELVALSYDVKKVLIN* |
Ga0102945_10223044 | 3300007609 | Pond Water | MRERAIQLILSLTDKYTRAELEAIEDTLDLVALSLDIKKVLT* |
Ga0102823_100859712 | 3300007692 | Estuarine | MRERAINRILDLTDAYSRKELESIKDTQELVALSYDVKKVL |
Ga0115363_104654372 | 3300008417 | Sediment | MRERAIKTILDLTDKYSRQELESIKDTLELVALSYDVKKILS* |
Ga0102960_11797241 | 3300009000 | Pond Water | MRERAINTILSLTDAYSREELEVIENTLELVALSYDVKKIVKI* |
Ga0102810_11203254 | 3300009002 | Estuarine | MRERAIKRILNLTDKYSRKELENIKDTLDLVELSYDVEKILT* |
Ga0102813_11174462 | 3300009003 | Estuarine | MRERAIKRILNLTDKYSRKELENIKDTLDLVALSYDMKKILA* |
Ga0102830_11431351 | 3300009059 | Estuarine | MRERAINRILDLTDAYSRKELESIKDTQELVALSYDVKKVLI |
Ga0102884_11295352 | 3300009141 | Estuarine | MRERAINRILDLTDAYSRKELESIKDTQELVALRYDVKKVLIN* |
Ga0114915_11179304 | 3300009428 | Deep Ocean | MRERAIKTILNLTDKYTKKELESIDDTLELVALSFTVKRILTNNN* |
Ga0115572_106941082 | 3300009507 | Pelagic Marine | MRERAINRILNLTNAYSREELETIKDTQELVALSYDVKKITNYANN* |
Ga0115102_102856772 | 3300009606 | Marine | MRERAIKRILNLTDKYSRKELENIKDTLDLVELSYDVEKILA* |
Ga0098043_10453474 | 3300010148 | Marine | MRERAIKRILDITDKYSRQELELIKDTQELVALSYDVKKITR* |
Ga0098056_10161707 | 3300010150 | Marine | MRERAINRILNLTDKYSKNELESIKDTQELVALSYDVQKIL |
Ga0129348_12734513 | 3300010296 | Freshwater To Marine Saline Gradient | METIRARAINRILDLTTGWTRSELENIEDTLELAALSYDVERAIKYI |
Ga0129342_12930752 | 3300010299 | Freshwater To Marine Saline Gradient | MRERAISRILNLTNAYSRKELESIKDTLELVALSYDVKKITNKIQR* |
Ga0129351_10532832 | 3300010300 | Freshwater To Marine Saline Gradient | MRERAINTILSLTDAYSREELESIKDTLELVALSLDVKKIKS* |
Ga0160423_107767082 | 3300012920 | Surface Seawater | MRERAIKKILELTNKYTRKELESIKDTLELVALSYDVKKILSK* |
Ga0164313_106909444 | 3300013101 | Marine Sediment | MRERAINRILNLTNAYSREELESIEDTQELVALSYDVKKITNK* |
Ga0116815_10046012 | 3300013195 | Marine | MRERAINRILNLTKAYSREELESIKDTQELVALSYDVKKITNK* |
Ga0181412_10872963 | 3300017714 | Seawater | MRERAIKRILNLTDKYSRKELENIKDTLDLVELSYDVEKILA |
Ga0187219_12230892 | 3300017751 | Seawater | MRERAIKRILDLTDKYSRQELELIKDTQELVALSYDVK |
Ga0181400_11747832 | 3300017752 | Seawater | MKERAIKRILELTNRYTRKELESIEDTQELVALSYDVQRILK |
Ga0181385_100033131 | 3300017764 | Seawater | MRERAIKIILSLTDKYTREELESIEDTVELVALSYDIKKVLNK |
Ga0181430_10080342 | 3300017772 | Seawater | MRERAINRILDLTDAYSRKELESIKDTQELVALSYDVKKNRL |
Ga0181424_101222272 | 3300017786 | Seawater | MKERAIKRILELTNRYTRKELELIEDTQELVALSYDVQRILK |
Ga0181565_100593665 | 3300017818 | Salt Marsh | MRERAIKEILNLTDVYSREELESIKDTLELVALSWDVKKITN |
Ga0181565_102712554 | 3300017818 | Salt Marsh | MRERAINRILNLTNAYSREELESIEDTLELVALSYDVKKITNK |
Ga0181577_100705388 | 3300017951 | Salt Marsh | MRERAIKEILNLTDAYSREELESIKDTLELVALSWDVKKITN |
Ga0180433_108224422 | 3300018080 | Hypersaline Lake Sediment | MRERAINRILNLTNAYSRKELESIKDTLELVALSYDVKKITNKIQR |
Ga0181553_100298335 | 3300018416 | Salt Marsh | METIRARAINRILDLTTGWTRSELENIEDTLELAALSYDVERAIKYIKL |
Ga0181553_101750395 | 3300018416 | Salt Marsh | RERAIKTILDLTDKYSRQELESIKDTLELVALSYDVKKILL |
Ga0181553_104952371 | 3300018416 | Salt Marsh | MRERAIKTILDLTDKYSRQELESIKDTLELVALSYDVKKI |
Ga0181563_103096903 | 3300018420 | Salt Marsh | MRERAIKTILNLTDKYSRQELESIKDTLELVALSYDVKKILL |
Ga0181568_108717023 | 3300018428 | Salt Marsh | MRDRAINRILNVTDVYTREELESIKDTQELVALSYDVMKLLTTKK |
Ga0188835_10022954 | 3300019096 | Freshwater Lake | MRERAIKEILSLTNAYSREELESIEETLELVSLMWDVKKILNDVKNN |
Ga0181573_102090431 | 3300020184 | Salt Marsh | IKEILNLTDAYSREELESIKDTLELVALSWDVKKITN |
Ga0211659_1001323012 | 3300020404 | Marine | MRERAIKRILDITNKYSRQELELIKDTQELVALSYDVKKILL |
Ga0211576_100493841 | 3300020438 | Marine | MRERAINKILSLTNAYSREELESIKDTQELVSLSYDVKKIVKI |
Ga0211564_103222124 | 3300020445 | Marine | MRERAIKEILDLTNKYTRKELESIKDTQDLLALSCDIKKILK |
Ga0213862_102456431 | 3300021347 | Seawater | MRERAIKTILDLTDKYSRQELESIKDTLELVALSYDVKKILL |
Ga0213859_101791382 | 3300021364 | Seawater | MRERAINRILNLTKAYSREELESIKDTQELVALSYDVKKITNK |
Ga0213860_100096623 | 3300021368 | Seawater | MRERAIKRILDLTEKYSREELELIKDTQELVALSYEVKKILL |
Ga0213863_100305099 | 3300021371 | Seawater | MRERAIKRIQNLTDKYSRQELEAIEDTLELVALSYDLEKVLT |
Ga0213865_100149526 | 3300021373 | Seawater | MRERAIKTILDLTNKYSRQELESIKDTLELVALSYDVKKILL |
Ga0213865_100696864 | 3300021373 | Seawater | MRERAIKRILDLTNKYTRKELESIKDTQDLLALSYDVKKILK |
Ga0213869_100696206 | 3300021375 | Seawater | MRERAINRILNLTDKYSKNQLESIKDTQELVALSYDVQKILT |
Ga0222717_105087112 | 3300021957 | Estuarine Water | MRERAINRILDLTDAYSRKELESIKDTQELVALSYDIKKNRL |
Ga0222718_105629552 | 3300021958 | Estuarine Water | MRERAIKEILSLTDAYSREELESIKETLELVALSWDVKKILKV |
Ga0222714_101053147 | 3300021961 | Estuarine Water | MRERAIKEILSLTNAYSREELESIKETLELVALSWDVKKILKV |
Ga0196889_10142151 | 3300022072 | Aqueous | MRERAINRILNLTDKYSKNQLESIKDTQELVALSYDVQKILK |
Ga0212022_10026641 | 3300022164 | Aqueous | NRILNLTDKYSKNQLESIKDTQELVALSYDVQKILT |
Ga0196901_100302913 | 3300022200 | Aqueous | MRERAIKTILDLTDKYSRQELESIKDTLELVALSYDVKKIL |
Ga0255752_104409241 | 3300022929 | Salt Marsh | MRERAIKTILDLTDKYSRQELESIKDTLELVALSYDVKKILLXEILDYDXTK |
(restricted) Ga0233432_100320774 | 3300023109 | Seawater | MRERAIKRILNLTDKYSRKELENIKDTLDLVALSYDMKKILA |
(restricted) Ga0233432_101987431 | 3300023109 | Seawater | MRERAINTILSLTDAYSREELDSIKDTLDLVALSYDVKKILKV |
(restricted) Ga0233412_1000148919 | 3300023210 | Seawater | MRERAINKILRLTNAYSREELESIKDTQELVALSYDVKKIVKI |
(restricted) Ga0255039_100003177 | 3300024062 | Seawater | MRERAINKILRLTNAYSREELESIKDTQELVSLSYDVKKIVKI |
Ga0228668_100088529 | 3300024180 | Seawater | MRERAIKRIQNLTNKYSRQELEAIKDTLELVALSYDIEKVLE |
Ga0244777_100287029 | 3300024343 | Estuarine | MRERAINRILDLTDAYSRKELESIKDTQELVALSYDVKKVLIN |
(restricted) Ga0255049_106130953 | 3300024517 | Seawater | MRERAINRILDLTDAYSRKELESIKDTQELVALSYDVKKVLNN |
(restricted) Ga0255046_102591743 | 3300024519 | Seawater | MRERAINTILSLTDAYSREELDSIEDTLDLVALSYDVKKILKV |
Ga0208667_10077975 | 3300025070 | Marine | MRERAINRILNLTDKYSKNELESIKDTQELVALSYDVQKILT |
Ga0208157_10002023 | 3300025086 | Marine | MRERAIKRILDITDKYSRQELELIKDTQELVALSYDVKKIIR |
Ga0208159_10503584 | 3300025101 | Marine | KTMRERAIKRILDITDKYSRQELELIKDTQELVALSYDVKKIIR |
Ga0208159_11006631 | 3300025101 | Marine | MRERAIKRILDITNKYSKQELELIKDTQELVALSYDVKKILL |
Ga0209535_10022276 | 3300025120 | Marine | MRERAIKRILDLTDKYSRQELELIKDTQELVALSYDVKKILCRII |
Ga0208303_11263572 | 3300025543 | Aqueous | MRERAIRRILNLTDKYSREELENINNTLDLVALSYEVEKVLTN |
Ga0208643_11844701 | 3300025645 | Aqueous | MRKRAINRILNLTDKYTRTELESIEDTLELVVLSYDI |
Ga0208134_10379853 | 3300025652 | Aqueous | MRKRAINRILNLTDKYTRTELESIEDTLELVVLSYDIEKVLT |
Ga0208162_11634732 | 3300025674 | Aqueous | MRERAINTILSLTDAYSRKELESIEDTLELVALSYDVKKIVKL |
Ga0208899_10730643 | 3300025759 | Aqueous | MKERAIKRILDLTDGWTKEELENIEDTLELVALSYDVEQAIKFRKI |
Ga0208644_10015088 | 3300025889 | Aqueous | MRERAINRILSLTGAYSREELEGIKDTLELVALSYDVKKIL |
Ga0209929_10587642 | 3300026187 | Pond Water | MRERAINTILSLTDAYSREELEVIENTLELVALSYDVKKIVKI |
Ga0208809_10280361 | 3300027251 | Estuarine | MRERAINRILDLTDAYSRKELESIKDTQELVALSYDVKKV |
Ga0209013_101676781 | 3300027858 | Marine | INKILSLTNAYSREELESIKDTQELVSLSYDVKKIVKI |
Ga0209536_1006650555 | 3300027917 | Marine Sediment | MRERAIKTILDLTDKYSRQELESIKDTQELVALSYDVKKILL |
Ga0183683_10081998 | 3300029309 | Marine | MRERAIKRILDITDKYSRQELELIKDTQELVALSYDVKKILL |
Ga0183755_10800892 | 3300029448 | Marine | MRERAINRILNLTNAYSREELESIENTQELVALSYDVKKITNKIRRSLDNIYEYK |
Ga0307488_104070722 | 3300031519 | Sackhole Brine | MRDRAIKRILNLTDKYSIKELEEIKDTLELVALSYDVQKILL |
Ga0307380_108925034 | 3300031539 | Soil | MRERAIKEILSLTNAYSREELESIKETLELVALKWDVKKILNDGKNR |
⦗Top⦘ |