Basic Information | |
---|---|
Family ID | F091754 |
Family Type | Metagenome |
Number of Sequences | 107 |
Average Sequence Length | 40 residues |
Representative Sequence | MRIGLAYNEKPDATPASDAYAEWDDPSTIDAVEQAL |
Number of Associated Samples | 93 |
Number of Associated Scaffolds | 107 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 69.16 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 92.52 % |
Associated GOLD sequencing projects | 87 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.18 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (99.065 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (23.364 % of family members) |
Environment Ontology (ENVO) | Unclassified (37.383 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.598 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 15.62% β-sheet: 0.00% Coil/Unstructured: 84.38% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.18 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 107 Family Scaffolds |
---|---|---|
PF02511 | Thy1 | 87.85 |
PF02913 | FAD-oxidase_C | 11.21 |
PF01976 | DUF116 | 0.93 |
COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
---|---|---|---|
COG1351 | Thymidylate synthase ThyX, FAD-dependent family | Nucleotide transport and metabolism [F] | 87.85 |
COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 11.21 |
COG1852 | Predicted redox protein with CxxCxxC motif, DUF116 family | General function prediction only [R] | 0.93 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 99.07 % |
Unclassified | root | N/A | 0.93 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001228|SwM_110045 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300002914|JGI25617J43924_10294904 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300002916|JGI25389J43894_1031967 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
3300005180|Ga0066685_10376948 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
3300005181|Ga0066678_11023097 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300005186|Ga0066676_10626220 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
3300005341|Ga0070691_10077044 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1627 | Open in IMG/M |
3300005445|Ga0070708_101363548 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
3300005555|Ga0066692_10173569 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1336 | Open in IMG/M |
3300005586|Ga0066691_10344133 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
3300005764|Ga0066903_100372402 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2327 | Open in IMG/M |
3300005886|Ga0075286_1015755 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
3300006791|Ga0066653_10780539 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300006797|Ga0066659_11829045 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300006844|Ga0075428_102631824 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300006854|Ga0075425_102030065 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
3300006904|Ga0075424_101981663 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300006954|Ga0079219_10044988 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1861 | Open in IMG/M |
3300006954|Ga0079219_10141790 | All Organisms → cellular organisms → Bacteria | 1266 | Open in IMG/M |
3300007004|Ga0079218_10370385 | All Organisms → cellular organisms → Bacteria | 1204 | Open in IMG/M |
3300007004|Ga0079218_11664009 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
3300009012|Ga0066710_100124195 | All Organisms → cellular organisms → Bacteria | 3526 | Open in IMG/M |
3300009089|Ga0099828_10637870 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
3300009090|Ga0099827_10280747 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1405 | Open in IMG/M |
3300009137|Ga0066709_100873541 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 1308 | Open in IMG/M |
3300009795|Ga0105059_1026156 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
3300009803|Ga0105065_1014814 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
3300009806|Ga0105081_1065463 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300010047|Ga0126382_11569257 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
3300010159|Ga0099796_10202305 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
3300010304|Ga0134088_10270721 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
3300010320|Ga0134109_10060510 | All Organisms → cellular organisms → Bacteria | 1268 | Open in IMG/M |
3300010323|Ga0134086_10092067 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
3300010323|Ga0134086_10238457 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
3300010326|Ga0134065_10271361 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
3300010335|Ga0134063_10372270 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
3300010403|Ga0134123_11280026 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
3300011269|Ga0137392_11559549 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300011417|Ga0137326_1011370 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1970 | Open in IMG/M |
3300011421|Ga0137462_1005248 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 2242 | Open in IMG/M |
3300011441|Ga0137452_1167705 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
3300011443|Ga0137457_1174878 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
3300012038|Ga0137431_1173896 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300012096|Ga0137389_10431115 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
3300012199|Ga0137383_10667091 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
3300012203|Ga0137399_10015734 | All Organisms → cellular organisms → Bacteria | 4771 | Open in IMG/M |
3300012203|Ga0137399_11013118 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
3300012208|Ga0137376_11289254 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
3300012209|Ga0137379_10259779 | All Organisms → cellular organisms → Bacteria | 1648 | Open in IMG/M |
3300012210|Ga0137378_10553251 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
3300012357|Ga0137384_10601842 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
3300012359|Ga0137385_11378869 | Not Available | 568 | Open in IMG/M |
3300012361|Ga0137360_10249348 | All Organisms → cellular organisms → Bacteria | 1457 | Open in IMG/M |
3300012917|Ga0137395_10618825 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
3300012925|Ga0137419_10750731 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
3300012927|Ga0137416_10203175 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1591 | Open in IMG/M |
3300012927|Ga0137416_11365700 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 21-71-4 | 641 | Open in IMG/M |
3300012927|Ga0137416_11494111 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300012944|Ga0137410_10663104 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
3300012944|Ga0137410_11899031 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300012944|Ga0137410_12037185 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300012972|Ga0134077_10452572 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300012975|Ga0134110_10156155 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
3300012977|Ga0134087_10262592 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
3300014154|Ga0134075_10430294 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
3300014318|Ga0075351_1172485 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300015054|Ga0137420_1106900 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
3300015054|Ga0137420_1327361 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300017659|Ga0134083_10208976 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
3300017659|Ga0134083_10417065 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
3300018063|Ga0184637_10221364 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
3300018063|Ga0184637_10588230 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
3300018084|Ga0184629_10372996 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
3300018084|Ga0184629_10689945 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300018431|Ga0066655_11190209 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300019362|Ga0173479_10302332 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
3300019866|Ga0193756_1042660 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca | 631 | Open in IMG/M |
3300019882|Ga0193713_1203867 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300021073|Ga0210378_10026390 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 2329 | Open in IMG/M |
3300026014|Ga0208776_1019034 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300026296|Ga0209235_1036911 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 2469 | Open in IMG/M |
3300026297|Ga0209237_1012616 | All Organisms → cellular organisms → Bacteria | 4995 | Open in IMG/M |
3300026297|Ga0209237_1248186 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300026298|Ga0209236_1143968 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
3300026298|Ga0209236_1264670 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300026300|Ga0209027_1092526 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
3300026301|Ga0209238_1118702 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
3300026307|Ga0209469_1077887 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
3300026315|Ga0209686_1070365 | All Organisms → cellular organisms → Bacteria | 1246 | Open in IMG/M |
3300026328|Ga0209802_1296198 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300026331|Ga0209267_1189480 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
3300026342|Ga0209057_1184242 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300026527|Ga0209059_1260931 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300026537|Ga0209157_1194107 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
3300026540|Ga0209376_1057408 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 2194 | Open in IMG/M |
3300026542|Ga0209805_1089549 | All Organisms → cellular organisms → Bacteria | 1478 | Open in IMG/M |
3300026548|Ga0209161_10555544 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300027384|Ga0209854_1089510 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300027669|Ga0208981_1096023 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
3300027882|Ga0209590_10228994 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
3300027886|Ga0209486_10260879 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
3300028807|Ga0307305_10377220 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300032180|Ga0307471_101163149 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
3300032205|Ga0307472_101655193 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300032954|Ga0335083_10415259 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
3300033805|Ga0314864_0183667 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300034114|Ga0364938_094012 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 23.36% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 14.95% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 11.21% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 11.21% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 4.67% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.67% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.74% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.74% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 3.74% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.80% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.87% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.87% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.87% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.93% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.93% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.93% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.93% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.93% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.93% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.93% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.93% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.93% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.93% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001228 | Switchgrass rhizosphere microbial communities from Knoxville, Tennessee, USA - 12_joined | Host-Associated | Open in IMG/M |
3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
3300002916 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005886 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205 | Environmental | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009795 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_40_50 | Environmental | Open in IMG/M |
3300009803 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_40_50 | Environmental | Open in IMG/M |
3300009806 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_50_60 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011417 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT500_2 | Environmental | Open in IMG/M |
3300011421 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT769_2 | Environmental | Open in IMG/M |
3300011441 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2 | Environmental | Open in IMG/M |
3300011443 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2 | Environmental | Open in IMG/M |
3300012038 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2 | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300014318 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D1_rd | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
3300019866 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m1 | Environmental | Open in IMG/M |
3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
3300026014 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205 (SPAdes) | Environmental | Open in IMG/M |
3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300027384 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300027669 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300033805 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10 | Environmental | Open in IMG/M |
3300034114 | Sediment microbial communities from East River floodplain, Colorado, United States - 9_s17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
SwM_1100452 | 3300001228 | Switchgrass Rhizosphere | MRIGLAYNQKPDTDPTPDRASKTADVYAEWDEPSTIDAVEQALG |
JGI25617J43924_102949042 | 3300002914 | Grasslands Soil | MRIGLAYNEKPAPASAGETASTNDAFAEWDDPSTIVAVEQALRLFGTVIR |
JGI25389J43894_10319671 | 3300002916 | Grasslands Soil | MRIGLAYNQKPDTANSAAEPSSTNDAFAEWDDPSTIAAVEQALG |
Ga0066685_103769482 | 3300005180 | Soil | MRIGLAYNEKPDRSTTDEPPGTSDAFAEWDDPSTIAAVEE |
Ga0066678_110230972 | 3300005181 | Soil | MRIGLAYNEKPEPASTEDPDSTNDAFAEWDDPSTIAAVEQALG |
Ga0066676_106262201 | 3300005186 | Soil | MRIGLAYNQKPESASSSDAASSSSDVYAEWDEPTTIDAVEQALGLFGSV |
Ga0070691_100770441 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MRIGLAYNEKPDGTPASDAYAEWDDPSTIDAVDQALSLFG |
Ga0070708_1013635481 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MRIGLAYNEKPDASAASDAYAEWDDPSTIDAVEQALSLFGN |
Ga0066692_101735693 | 3300005555 | Soil | MRIGLAYNEKPDCSTTDEPPGTSDAFAEWDDPSTIAAVE |
Ga0066691_103441332 | 3300005586 | Soil | MRIGLAYNEKPEPTSNLDDAFVEWDDRSTIEAVEQALSLFGDV |
Ga0066903_1003724023 | 3300005764 | Tropical Forest Soil | MRIGLAYNQKPDTDPTPDAASKTADVYAEWDEPSTIDAVEQALGLFGSV |
Ga0075286_10157552 | 3300005886 | Rice Paddy Soil | MRIGLAYNEKPDPASAKAHDSTNDAFAEWDDPSTIAAVEQ |
Ga0066653_107805392 | 3300006791 | Soil | MRIGLAYNEKPDPAPDADSDSSSDAFAEWDDPSTI |
Ga0066659_118290451 | 3300006797 | Soil | MRIGLAYNEKPDSAADAESDGTGDAFAEWDDASTITAVEQALGLFGSVI |
Ga0075428_1026318242 | 3300006844 | Populus Rhizosphere | MRIGLAYNEKPDAASASDAYAEWDDPSTIDAVDQALSLFGSVVRLE |
Ga0075425_1020300652 | 3300006854 | Populus Rhizosphere | MRIGLAYNEKPDATPASDAYAEWDDPSTIDAVEQAL |
Ga0075424_1019816632 | 3300006904 | Populus Rhizosphere | MRIGLAYNEKPAPRPVASDEPPSSSDAYAEWDEPSTIT |
Ga0079219_100449881 | 3300006954 | Agricultural Soil | MRIGLAYNEKPDALVASDAYAEWDDPSTIDAVEQALSLFGTVVRPEAD |
Ga0079219_101417901 | 3300006954 | Agricultural Soil | MRIGLAYNEKPDPRAVASDEPPSSSDAYAEWDEPSTITAVEQALSLFG |
Ga0079218_103703851 | 3300007004 | Agricultural Soil | MRIGLAYNEKPDAPTASDAYAEWDDPSTIDAVDQA |
Ga0079218_116640091 | 3300007004 | Agricultural Soil | MRIGLAYNEKPDPSSSAEEPPSTNDAFAEWDEPSTIAAV |
Ga0066710_1001241951 | 3300009012 | Grasslands Soil | MRIGLAYNEKPDVPPSSDAYAEWDDPSTIDAVDQALSL |
Ga0099828_106378702 | 3300009089 | Vadose Zone Soil | MRIGLAYNEKPDSAPGAESDGTGDAFAEWDDPSTIT |
Ga0099827_102807471 | 3300009090 | Vadose Zone Soil | MRIGLAYNEKPDHDRSLDDPSSTSSDAFVEWDDRSTI |
Ga0066709_1008735411 | 3300009137 | Grasslands Soil | MRIGLAYNEKPDPALASDEYAEWDDPSTIDAVEQA |
Ga0105059_10261561 | 3300009795 | Groundwater Sand | MRIGLAYNEKPDATPASDAFAEWDDPSTIDAVDQA |
Ga0105065_10148142 | 3300009803 | Groundwater Sand | MRLGLAYNQKPDPAPAEEPPSTNDAFAEWDDASTIAAV |
Ga0105081_10654632 | 3300009806 | Groundwater Sand | MRIGLAYNEKPESSPPLASDAYAEWDDPSTITAVDQ |
Ga0126382_115692571 | 3300010047 | Tropical Forest Soil | MRIGLAYNQKPDTDPAPDAASKNADVYAEWDEPSTI |
Ga0099796_102023052 | 3300010159 | Vadose Zone Soil | MFSYSVFRMRIGLAYNEKPDASAASDAYAEWDDPSTI |
Ga0134088_102707212 | 3300010304 | Grasslands Soil | MRLGLAYNEKSDAASSSEEPPSTNDAFAEWDDPSTIAAV |
Ga0134109_100605103 | 3300010320 | Grasslands Soil | MLFFRMRIGLAYNEKPDANSASDAYAEWDDPSTIDAV |
Ga0134086_100920671 | 3300010323 | Grasslands Soil | MLFFRMRIGLAYNEKPDANSASDDYAEWDDPSTIDAVEEA |
Ga0134086_102384572 | 3300010323 | Grasslands Soil | MRIGLAYNEKPDTSAASDAYAEWDDPSTIDAVDQALSLFGT |
Ga0134065_102713611 | 3300010326 | Grasslands Soil | MRIGLAYNEKPDPAPDADSDSSSDAFAEWDDPSTIAAVAQALSRFGSVI |
Ga0134063_103722702 | 3300010335 | Grasslands Soil | MRIGLAYNEKPDPANSAAEPPSTNDAFAEWDDPSTI |
Ga0134123_112800261 | 3300010403 | Terrestrial Soil | MRIGLAYNEKPAQPGAANEPPQTTDAYVEWDEPSTIDAVA |
Ga0137392_115595492 | 3300011269 | Vadose Zone Soil | MRIGLAYNEKPDPAPDAASDSASDAFAEWDDPSTIAAV |
Ga0137326_10113701 | 3300011417 | Soil | MRIGLAYNEKPDAASASDAYAEWDDPSTIDAVDQALS |
Ga0137462_10052481 | 3300011421 | Soil | MRIGLAYNQKPDPSAPDEPPSTTDAFAEWDEPLTIDAVVQAL |
Ga0137452_11677052 | 3300011441 | Soil | MRIGLAYNEKPDAIAASDAYAEWDDPSTIDAVDQA |
Ga0137457_11748781 | 3300011443 | Soil | MRIGLAYNEKPDAIAASDAYAEWDDPSTIDAVDQALSL |
Ga0137431_11738961 | 3300012038 | Soil | MRIGLAYNEKPDAIAASDAYAEWDDPSTIDAVDQALS |
Ga0137389_104311153 | 3300012096 | Vadose Zone Soil | MRIGLAYNEKPDASDASDAYAEWDDPSTIDAVDQALSLFGTVVRL |
Ga0137383_106670912 | 3300012199 | Vadose Zone Soil | MFSYSVLRMRIGLAYNEKPDAPAASDAYAEWDDPSTIDAVEQALSLFG |
Ga0137399_100157345 | 3300012203 | Vadose Zone Soil | MRIGLAYNEKPDASAASDAYAEWDDPSTIDAVDQALSLFGNVIRLE |
Ga0137399_110131181 | 3300012203 | Vadose Zone Soil | MRIGLAYNEKPDVTPSSDAYAEWDDPSTIDAVDQALSLFGT |
Ga0137376_112892542 | 3300012208 | Vadose Zone Soil | MRIGLAYNEKPDSAPTSDEYAEWDDASTITAVEQALGFFGSVV |
Ga0137379_102597791 | 3300012209 | Vadose Zone Soil | MRIGLAYNQKPDPSSVEQSSSTSDAFAEWDEPATID |
Ga0137378_105532511 | 3300012210 | Vadose Zone Soil | MRIGLAYNEKPDPAPTEGPDSTNDAFAEWDDPSTIAA |
Ga0137384_106018421 | 3300012357 | Vadose Zone Soil | MRLGLAYNEKSEATSSPEEPPSTNDAFAEWDDPSTI |
Ga0137385_113788691 | 3300012359 | Vadose Zone Soil | MRIGLAYNQKPDPSNADEPPSPSDAFAEWDEPATIDTVA |
Ga0137360_102493483 | 3300012361 | Vadose Zone Soil | MRIGLAYNEKPDASAASDAYAEWDDPSTIDAVDQALSLF |
Ga0137395_106188251 | 3300012917 | Vadose Zone Soil | MRIGLAYNEKPDPAPDAESDSASDAFAEWDDPSTIAA |
Ga0137419_107507312 | 3300012925 | Vadose Zone Soil | MRIGLAYNEKPDVTPSSDAYAEWDDPSTIDAVDQAL |
Ga0137416_102031753 | 3300012927 | Vadose Zone Soil | MRIGLAYNEKPDASPASDAYAEWDDPSTIDAVDQAL |
Ga0137416_113657001 | 3300012927 | Vadose Zone Soil | MRIGLAYNEKPDVTPSSDAYAEWDDPSTIDAVDQA |
Ga0137416_114941112 | 3300012927 | Vadose Zone Soil | MRIGLAYNEKPDPDSSLDDPARTSDAFVEWDDPSTI |
Ga0137410_106631042 | 3300012944 | Vadose Zone Soil | MRIGLAYNEKPDSAPDAESDGTGDAFAEWDDPSTITAVEQALGLFGSVI |
Ga0137410_118990311 | 3300012944 | Vadose Zone Soil | MRIGLAYNQKPDPSAPDEPPSTTDAFAEWDEPSTIDA |
Ga0137410_120371851 | 3300012944 | Vadose Zone Soil | MRIGLAYNQKPDPNTAKDRSRKDSDVYAEWDEPSTIDAVEQ |
Ga0134077_104525722 | 3300012972 | Grasslands Soil | MRIGLAYNEKPDASAASDAYAEWDDASTIDAVDQALSFFGNV |
Ga0134110_101561551 | 3300012975 | Grasslands Soil | MRIGLAYNEKPELASTEDPDSSNDAYAEWDDPTTITAV |
Ga0134087_102625921 | 3300012977 | Grasslands Soil | MWEVTRDHMRLGLAYNEKSDATSSSEEPPSTNDAFAEWDDPSTIAAVEQ |
Ga0134075_104302942 | 3300014154 | Grasslands Soil | MRIGLAYNEKPDASDASDAYAEWDDPSTIDAVDQALSLFG |
Ga0075351_11724851 | 3300014318 | Natural And Restored Wetlands | MRIGLAYNEKPDAARTSDAYAEWDDPSTIDAVDQALGLFGSVVRLEAD |
Ga0137420_11069001 | 3300015054 | Vadose Zone Soil | MRIGLAYNEKPDSAPTSDEYAEWDDASTITAVEQALGLFGAASSGSKPTR |
Ga0137420_13273611 | 3300015054 | Vadose Zone Soil | MRIGLAYNEKPDSAPTSDEYAEWDDASTITARGGAGS |
Ga0134083_102089761 | 3300017659 | Grasslands Soil | MRIGLAYNEKPDPALASDEYAEWDDPSTIDAVEQAL |
Ga0134083_104170651 | 3300017659 | Grasslands Soil | MRIGLAYNEKPDPAPDAASDSASDAFAEWDDPSTIAAVEQ |
Ga0184637_102213643 | 3300018063 | Groundwater Sediment | MRIGLAYNEKPESSPSGPPTPFSTSDVYAEWDDPSTITAVEQALGLYG |
Ga0184637_105882301 | 3300018063 | Groundwater Sediment | MRIGLAYNEKPNRALGSLDDPPGINDAYVEWDDPSTIT |
Ga0184629_103729961 | 3300018084 | Groundwater Sediment | MRIGLAYNEKPDSAPAPASDQYAEWDDASTINAVEQALGLFGSV |
Ga0184629_106899452 | 3300018084 | Groundwater Sediment | MRIGLAYNEKPESAPASDQYAEWDDASTINAVEQALGLF |
Ga0066655_111902092 | 3300018431 | Grasslands Soil | MRIGLAYNEKPDATPASDAYAEWDDPSTIDAVDQALGLFGTVV |
Ga0173479_103023322 | 3300019362 | Soil | MRIGLAYNEKPDAPSASDAYAEWDDPSTIDAVDQALSLFGN |
Ga0193756_10426601 | 3300019866 | Soil | MRIGLAYNEKPDATSASDAYAEWDDPSTIDAVEQA |
Ga0193713_12038671 | 3300019882 | Soil | MRIGLAYNQKPDPSAPDEPPSTTDAFAEWDEPLTIDA |
Ga0210378_100263901 | 3300021073 | Groundwater Sediment | MRIGLAYNEKPDSAPAPASDQYAEWDDASTIAAVEQAL |
Ga0208776_10190342 | 3300026014 | Rice Paddy Soil | MRIGLAYNEKPDPASAKAHDSTNDAFAEWDDPSTITAV |
Ga0209235_10369111 | 3300026296 | Grasslands Soil | MRIGLTYNEKPESASAAEPPSTNDAFAEWDDPSTIAAVE |
Ga0209237_10126166 | 3300026297 | Grasslands Soil | MRIGLAYNEKPESAPAAESDGTGDAFAEWDDPSTITA |
Ga0209237_12481861 | 3300026297 | Grasslands Soil | MRIGLAYNQKPDPANSAAEPSSTNDAFAEWDDPSTIAA |
Ga0209236_11439682 | 3300026298 | Grasslands Soil | MRIGLAYNEKPDRNTTDEPPGTSDAFAEWDDPSTIAAVEEAL |
Ga0209236_12646702 | 3300026298 | Grasslands Soil | MRIGLAYNEKPDSAPVAESDGTGDAFAEWDDPSTITAVEQALGLFGHVI |
Ga0209027_10925262 | 3300026300 | Grasslands Soil | MRIGLAYNQKPDPANSAEPSSTNDAFAEWDDPSTI |
Ga0209238_11187021 | 3300026301 | Grasslands Soil | MRIGLAYNEKPDAPAASDAYAEWDDPSTIDAVEQALGLFGPVVRLE |
Ga0209469_10778872 | 3300026307 | Soil | MRLGLAYNEKSEATSSPEEPPSTNDAFAEWDDPSTIAAVEQALGL |
Ga0209686_10703651 | 3300026315 | Soil | MRIGLAYNEKPEPASTEDPDSTNDAFAEWDDPSTIAAVEQALGPFG |
Ga0209802_12961982 | 3300026328 | Soil | MRIGLAYNEKPDASPASDAYAEWDDPSTIDAVDLALSLFGNVVRLE |
Ga0209267_11894802 | 3300026331 | Soil | MRIGLAYNQKPDPANSAAEPSSTNDAFAEWDDPSTIA |
Ga0209057_11842422 | 3300026342 | Soil | MRIGLAYNEKPDAHDASDAYAEWDDPSTIDAVDQALSLFGTV |
Ga0209059_12609312 | 3300026527 | Soil | MRIGLAYNEKPEPASTEDPDSSNDAYAEWDDPATIAAVEQA |
Ga0209157_11941072 | 3300026537 | Soil | MRIGLAYNQKPDPANSAAEPSSTNDAFAEWDDPSTIAAV |
Ga0209376_10574081 | 3300026540 | Soil | MRIGLAYNEKPDPDSSLDDPSSSGSDAFVEWDDRSTIEAV |
Ga0209805_10895491 | 3300026542 | Soil | MRIGLAYNEKPDPTPDVESDGTGDAFAEWDEPSTIA |
Ga0209161_105555441 | 3300026548 | Soil | MRIGLAYNQKPDPSNADEPPSTSDAFAEWDEPATIDAVA |
Ga0209854_10895101 | 3300027384 | Groundwater Sand | MRIGLAYNEKPDSERSLDEPSRMSDAYAEWDDPSTIAAVEQALG |
Ga0208981_10960231 | 3300027669 | Forest Soil | MRIGLAYNEKPDPAPDAASDATGDDAFAEWDDPSTIAAVAQALGLFGDVI |
Ga0209590_102289943 | 3300027882 | Vadose Zone Soil | MRIGLAYNEKPDVTPSSDAYAEWDDPSTIDAVDQALSLF |
Ga0209486_102608791 | 3300027886 | Agricultural Soil | MRIGLAYNEKPDAPTASDAYAEWDDPSTIDAVDQALS |
Ga0307305_103772202 | 3300028807 | Soil | MRIGLAYNQKPDPSAPDEPPSTTDAFAEWDEPATIDAVGQALSPF |
Ga0307471_1011631492 | 3300032180 | Hardwood Forest Soil | MRIGLAYNQKPDTDPTPDAASKTADVYAEWDEPSTIDAVEQALGLFGSVIR |
Ga0307472_1016551931 | 3300032205 | Hardwood Forest Soil | MRIGLAYNQKPDTDPTPDAASKTADDYAEWDEPST |
Ga0335083_104152591 | 3300032954 | Soil | MLIGLAYNQKPDPSAADDPPNTSDAFAEWDDPATIDA |
Ga0314864_0183667_437_541 | 3300033805 | Peatland | MRIGLAYNQKPASNAADPSSTSDLFAEWDEPATID |
Ga0364938_094012_2_115 | 3300034114 | Sediment | MRIGLAYNEKPNRALGSLDDSPSISDAYVEWDDPSTIE |
⦗Top⦘ |