Basic Information | |
---|---|
Family ID | F091744 |
Family Type | Metagenome |
Number of Sequences | 107 |
Average Sequence Length | 45 residues |
Representative Sequence | MAEMTIRRFGVLSVAKMYGLLMFIFGLIIGVIYGLFFILFGAAMS |
Number of Associated Samples | 95 |
Number of Associated Scaffolds | 107 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 100.00 % |
% of genes near scaffold ends (potentially truncated) | 98.13 % |
% of genes from short scaffolds (< 2000 bps) | 86.92 % |
Associated GOLD sequencing projects | 92 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.52 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (91.589 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere (14.953 % of family members) |
Environment Ontology (ENVO) | Unclassified (37.383 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (57.944 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 58.90% β-sheet: 0.00% Coil/Unstructured: 41.10% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 107 Family Scaffolds |
---|---|---|
PF03309 | Pan_kinase | 11.21 |
PF00201 | UDPGT | 5.61 |
PF08811 | DUF1800 | 0.93 |
PF04101 | Glyco_tran_28_C | 0.93 |
PF09413 | DUF2007 | 0.93 |
COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
---|---|---|---|
COG1521 | Pantothenate kinase type III | Coenzyme transport and metabolism [H] | 11.21 |
COG1819 | UDP:flavonoid glycosyltransferase YjiC, YdhE family | Carbohydrate transport and metabolism [G] | 11.21 |
COG5267 | Uncharacterized conserved protein, DUF1800 family | Function unknown [S] | 0.93 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 91.59 % |
Unclassified | root | N/A | 8.41 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2199352025|deepsgr__Contig_49540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 930 | Open in IMG/M |
3300000955|JGI1027J12803_104771320 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 724 | Open in IMG/M |
3300000955|JGI1027J12803_107177378 | Not Available | 528 | Open in IMG/M |
3300002120|C687J26616_10005707 | All Organisms → cellular organisms → Bacteria | 5096 | Open in IMG/M |
3300002886|JGI25612J43240_1039125 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
3300004114|Ga0062593_100570631 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
3300004114|Ga0062593_101006209 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
3300004463|Ga0063356_103454901 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
3300005093|Ga0062594_100953948 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
3300005176|Ga0066679_11061682 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300005290|Ga0065712_10777902 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
3300005334|Ga0068869_100061667 | All Organisms → cellular organisms → Bacteria | 2751 | Open in IMG/M |
3300005340|Ga0070689_101681358 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300005406|Ga0070703_10136692 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
3300005440|Ga0070705_100190573 | All Organisms → cellular organisms → Bacteria | 1397 | Open in IMG/M |
3300005440|Ga0070705_100584401 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 862 | Open in IMG/M |
3300005444|Ga0070694_100114802 | All Organisms → cellular organisms → Bacteria | 1923 | Open in IMG/M |
3300005444|Ga0070694_100818949 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 764 | Open in IMG/M |
3300005444|Ga0070694_101571480 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300005445|Ga0070708_100698142 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
3300005445|Ga0070708_101438524 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
3300005458|Ga0070681_10160421 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2172 | Open in IMG/M |
3300005467|Ga0070706_100640385 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
3300005468|Ga0070707_100849887 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
3300005518|Ga0070699_100011157 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7766 | Open in IMG/M |
3300005536|Ga0070697_101197966 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
3300005545|Ga0070695_100367091 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
3300005545|Ga0070695_100741288 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
3300005546|Ga0070696_100129015 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1838 | Open in IMG/M |
3300005548|Ga0070665_100420341 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1345 | Open in IMG/M |
3300005549|Ga0070704_101313726 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
3300005564|Ga0070664_101885907 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300005568|Ga0066703_10634590 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
3300005574|Ga0066694_10312007 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 749 | Open in IMG/M |
3300005575|Ga0066702_10509160 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 732 | Open in IMG/M |
3300005577|Ga0068857_101271301 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
3300005578|Ga0068854_101866574 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300005616|Ga0068852_102238936 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300005617|Ga0068859_101193681 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 838 | Open in IMG/M |
3300005719|Ga0068861_101323626 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
3300006794|Ga0066658_10103517 | All Organisms → cellular organisms → Bacteria | 1353 | Open in IMG/M |
3300006806|Ga0079220_10341758 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
3300006904|Ga0075424_102546258 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300006914|Ga0075436_101008667 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 625 | Open in IMG/M |
3300007004|Ga0079218_11967123 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 665 | Open in IMG/M |
3300007255|Ga0099791_10667509 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
3300009036|Ga0105244_10386875 | Not Available | 644 | Open in IMG/M |
3300009036|Ga0105244_10487029 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
3300009098|Ga0105245_10393018 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1384 | Open in IMG/M |
3300009148|Ga0105243_12424131 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
3300009156|Ga0111538_12271062 | Not Available | 681 | Open in IMG/M |
3300009156|Ga0111538_12797111 | Not Available | 611 | Open in IMG/M |
3300009174|Ga0105241_12432335 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
3300009176|Ga0105242_10335754 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1391 | Open in IMG/M |
3300009789|Ga0126307_10659082 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 845 | Open in IMG/M |
3300010159|Ga0099796_10502153 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
3300010396|Ga0134126_12890741 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
3300010397|Ga0134124_10141413 | All Organisms → cellular organisms → Bacteria | 2137 | Open in IMG/M |
3300010401|Ga0134121_12224003 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
3300010403|Ga0134123_13463562 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
3300011417|Ga0137326_1123363 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
3300011444|Ga0137463_1251849 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 659 | Open in IMG/M |
3300011993|Ga0120182_1013022 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 655 | Open in IMG/M |
3300012203|Ga0137399_10186562 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1677 | Open in IMG/M |
3300012353|Ga0137367_11168494 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
3300012354|Ga0137366_10523572 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 855 | Open in IMG/M |
3300012357|Ga0137384_10112371 | All Organisms → cellular organisms → Bacteria | 2275 | Open in IMG/M |
3300012363|Ga0137390_10122305 | All Organisms → cellular organisms → Bacteria | 2577 | Open in IMG/M |
3300012685|Ga0137397_11043488 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 599 | Open in IMG/M |
3300012922|Ga0137394_11591968 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
3300012923|Ga0137359_10531607 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1035 | Open in IMG/M |
3300012961|Ga0164302_11292137 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
3300012986|Ga0164304_10410277 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 965 | Open in IMG/M |
3300012986|Ga0164304_11533377 | Not Available | 552 | Open in IMG/M |
3300015372|Ga0132256_100990624 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 956 | Open in IMG/M |
3300015374|Ga0132255_100987573 | All Organisms → cellular organisms → Bacteria | 1262 | Open in IMG/M |
3300018056|Ga0184623_10449427 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
3300018059|Ga0184615_10212595 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1087 | Open in IMG/M |
3300018422|Ga0190265_13450220 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
3300018432|Ga0190275_10975277 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 918 | Open in IMG/M |
3300018476|Ga0190274_10845734 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 977 | Open in IMG/M |
3300020006|Ga0193735_1019432 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2109 | Open in IMG/M |
3300025315|Ga0207697_10176726 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 935 | Open in IMG/M |
3300025913|Ga0207695_11419569 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
3300025917|Ga0207660_11374863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
3300025934|Ga0207686_10070305 | All Organisms → cellular organisms → Bacteria | 2249 | Open in IMG/M |
3300025960|Ga0207651_10683519 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 903 | Open in IMG/M |
3300025971|Ga0210102_1049047 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 912 | Open in IMG/M |
3300026035|Ga0207703_10658137 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 994 | Open in IMG/M |
3300026118|Ga0207675_100195452 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1942 | Open in IMG/M |
3300026285|Ga0209438_1021171 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2171 | Open in IMG/M |
3300026332|Ga0209803_1329935 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
3300027731|Ga0209592_1159995 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 804 | Open in IMG/M |
3300028380|Ga0268265_10536479 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1108 | Open in IMG/M |
3300028380|Ga0268265_10672837 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 997 | Open in IMG/M |
3300031538|Ga0310888_11108889 | Not Available | 501 | Open in IMG/M |
3300031716|Ga0310813_11785720 | Not Available | 577 | Open in IMG/M |
3300031740|Ga0307468_100904075 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 766 | Open in IMG/M |
3300031908|Ga0310900_10912313 | Not Available | 717 | Open in IMG/M |
3300031911|Ga0307412_11941632 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
3300031995|Ga0307409_102057478 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
3300032003|Ga0310897_10315064 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 719 | Open in IMG/M |
3300033513|Ga0316628_100095703 | All Organisms → cellular organisms → Bacteria | 3310 | Open in IMG/M |
3300034165|Ga0364942_0006747 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3495 | Open in IMG/M |
3300034165|Ga0364942_0009754 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2970 | Open in IMG/M |
3300034818|Ga0373950_0082884 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 672 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 14.95% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.35% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.48% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.48% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.61% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 5.61% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.74% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.74% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.80% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.80% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.80% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.87% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.87% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.87% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.87% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.87% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.87% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.87% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.87% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.87% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.93% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.93% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.93% |
Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.93% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.93% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.93% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.93% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.93% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.93% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.93% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.93% |
Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.93% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.93% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.93% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300002120 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 | Environmental | Open in IMG/M |
3300002886 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011417 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT500_2 | Environmental | Open in IMG/M |
3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
3300011993 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C1.rep1 | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025971 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
3300027731 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
3300034165 | Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17 | Environmental | Open in IMG/M |
3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
deepsgr_00528700 | 2199352025 | Soil | MAEMTIRRFGVFSVAKMQSLLMGIIGLIIGVIYGFIFIFLGAAFSALGVRGDAP |
JGI1027J12803_1047713201 | 3300000955 | Soil | MAEMTIKRFGVLSVGKMQSLLMGIIGLIIGVIYGLIFIFVGAAFTA |
JGI1027J12803_1071773781 | 3300000955 | Soil | MAEMTIRRFGVISVAKMYGLLLFVMGLIIGVIYGLFFIIFGAAMTAIAPGGRDA |
C687J26616_100057071 | 3300002120 | Soil | MAEMTIRRFGILSVAKMQALLMFVIGLITGVIYGLLFMLFGAAVA |
JGI25612J43240_10391251 | 3300002886 | Grasslands Soil | MAEMTIRRFGIFSVAKMQCLVMFVIGLIVGVIYGLIFMLVGASLSAFGARG |
Ga0062593_1005706313 | 3300004114 | Soil | MAEMTIRRFGVFSVAKMHGLLMFIFGLIIGVIYGLFFIIFGAAMSAMGGAR |
Ga0062593_1010062091 | 3300004114 | Soil | MAEMTIRRFGVISIAKMYGLLMFIFGLVFGVIYGLILIVFGAAISA |
Ga0063356_1034549012 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MAEMTIRRLGVFSVAKIEGLLLFVMGLIIGVIYGLVFMIF |
Ga0062594_1009539482 | 3300005093 | Soil | MAEMTIRRFGVISVAKMYGLLMFIFGLVFGVIYGLILIVFGAAISAMA |
Ga0066679_110616821 | 3300005176 | Soil | MALMTIRRVGVFSLAKIQGLLMLVIGLIIGVIYGLIFMIFG |
Ga0065712_107779021 | 3300005290 | Miscanthus Rhizosphere | MAEMTIRRFGVLSVAKMQSLLMGIIGLIVGVIYGLIFIFVGAAF |
Ga0068869_1000616671 | 3300005334 | Miscanthus Rhizosphere | MAEMTIRRFGVLSVAKMYGLLMFIFGLVFGVIYGLFLILFGAAM |
Ga0070689_1016813582 | 3300005340 | Switchgrass Rhizosphere | MAEMTIRRFGVVSVGKMYGLLMFIFGLIFGVIYGLFFIIFGAAMSALGGGRE |
Ga0070703_101366921 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEMTIRRFGVLSVAKMYGLLMFIFGLVFGVIYGLFLILF |
Ga0070705_1001905731 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEMTIRRFGVISVAKMYGLLTFVIGLIIGVIYGLFFILFGAAMSAIAPGGRD |
Ga0070705_1005844011 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEMTIRRFGVISVAKMYALLMFIFGLIFGVIYGLILIVFGAAISALTPGSD |
Ga0070694_1001148024 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEMTIRRFGVFSVAKMYGLLTFIFGLVFGVIYGLFFIIFGAAMS |
Ga0070694_1008189491 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEMTIRRFGIFSVAKMQSLVMFVIGIIIGVIYGLFFMLFGAAISAF |
Ga0070694_1015714801 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEMTIRRFNVFSVAKIQGFLTFVIGLLIGVIYGFAFMIFGAAISSLAP |
Ga0070708_1006981421 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQMTIRRVGIFSVAKIQALLSLVLGLIFGVIYGLFFMLFGAAISAM |
Ga0070708_1014385242 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEMTIRRVGVLSLAKIQGFLMFIMGLIIGVIYGLMFMIFGVAI |
Ga0070681_101604211 | 3300005458 | Corn Rhizosphere | MAEMTIRRFGVVSVGKMHGLLMFIMGLIIGVLYGLFFIIFGAAATLGGGGDNA |
Ga0070706_1006403851 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEMTIRRFGIFSVAKMQSLVMFVIGIIIGVIYGLFFMLFGAAISAFGVRGEGSAA |
Ga0070707_1008498872 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEMTIRRFGVFSVAKMYGLLTFIFGLVFGVIYGLFFIIFGAA |
Ga0070699_1000111571 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEMTIRRFGVISVAKMYGLLMFIFGLIFGVLYGLFFIIFG |
Ga0070697_1011979662 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEMTIRRFGVLSVAKMYGLLTFIFGLIFGVIYGLFFIIFGAAMTAMTGSNSTA |
Ga0070695_1003670911 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEMTIRRFGVISVAKMYGLLMFIFGLVFGVIYGLILIVFGAAI* |
Ga0070695_1007412881 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEMTIKRFGVISVAKMYGLITFIFGLIFGVLYGLFFIIFGAAMS |
Ga0070696_1001290151 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEMTIKRFGVFSVAKMQSLVMFVIGLVIGVIYGLIFIIFGAAITA |
Ga0070665_1004203413 | 3300005548 | Switchgrass Rhizosphere | MAEMTIRRFGVFSVAKMQSLLMGVIGLIVGVIYGLIFIFVGAAFSALGVRGDAPNL |
Ga0070704_1013137262 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEMTIKRFGVWSVAKMYGILSFIFGLIIGVIYGVFLMIFGAAMASLAPEGE |
Ga0070664_1018859072 | 3300005564 | Corn Rhizosphere | MAEMTIRRFGVFSVAKMYGLLMFLFGLIFGVIYGLILIVFGAA |
Ga0066703_106345902 | 3300005568 | Soil | MAEMTVRRVGVLSLAKMQGLLMFVMGLIIGVIYGLIIMLFGAAM |
Ga0066694_103120072 | 3300005574 | Soil | MAEMTIRRVGVLSLAKIQGLLMLVIGLIIGVIYGLIFMI |
Ga0066702_105091602 | 3300005575 | Soil | MAEMTIRRVGVFSLAKIQGLLMLVIGLIIGVIYGLIFMIFG |
Ga0068857_1012713011 | 3300005577 | Corn Rhizosphere | MAEMTIRRFNVFSVAKIQGFLGFVIGLLIGVIYGLVFMIF |
Ga0068854_1018665742 | 3300005578 | Corn Rhizosphere | MAEMTIRRFGVISVAKMYGLLLFVMGLVIGVIYGLFFIIFGAAMSA |
Ga0068852_1022389361 | 3300005616 | Corn Rhizosphere | MAEMTIRRFGVISVAKMYGLLMFIFGLVFGVIYGLILIV |
Ga0068859_1011936811 | 3300005617 | Switchgrass Rhizosphere | MAEMTIRRFGVISVAKMYGLLTFVIGLIIGVIYGLFFI |
Ga0068861_1013236262 | 3300005719 | Switchgrass Rhizosphere | MAEMTIRRFGVLSVAKMYGLLMFIFGLVFGVIYGLFLILFGAAMTAASGEGINA |
Ga0066658_101035171 | 3300006794 | Soil | MAEMTIRRVGVFSLAKIQGLLMLVIGLIIGVIYGLIFMIFGAAL |
Ga0079220_103417581 | 3300006806 | Agricultural Soil | MAEMTIRRFGVISVAKIYGLLMFIFGLIIGVIYGL |
Ga0075424_1025462581 | 3300006904 | Populus Rhizosphere | MAEMTIRRFGVFSVAKMQSLLMGVIGLIVGVIYGLIFIFVG |
Ga0075436_1010086671 | 3300006914 | Populus Rhizosphere | MAEMTIRRFSVISVAKMYGLITFIFGLIFGVLYGLFFIIFGAAMSAVG |
Ga0079218_119671231 | 3300007004 | Agricultural Soil | MAEMTIRRFGVLSVAKMQALVMFVLGLVIGVIYGLIFIVFGAAITAMSPSGDAAAAGA |
Ga0099791_106675091 | 3300007255 | Vadose Zone Soil | MAQMTIRRVGVLSIAKIEGFLMFIVGLIIGVIYGLTVMIFGAVIMSA |
Ga0105244_103868751 | 3300009036 | Miscanthus Rhizosphere | MAEMTIKRFSVLSVGKMQSLLMGIIGLIIGVIYGLIFIF |
Ga0105244_104870292 | 3300009036 | Miscanthus Rhizosphere | MAEMTIRRFGVISVAKMYSLLLFIFGLIFGVIYGLILIVFGAAISALGPGRDATAG |
Ga0105245_103930183 | 3300009098 | Miscanthus Rhizosphere | MAEMTIRRFNVFSVAKIQGFLGFVIGLLIGVIYGFLFMIFGAAIS |
Ga0105243_124241313 | 3300009148 | Miscanthus Rhizosphere | MAEMTIKRFGVISIAKMYGLLMFIFGLVFGVIYGLILIVFGAA |
Ga0111538_122710622 | 3300009156 | Populus Rhizosphere | MAEMTIKRFGVFSVAKMQSLVMFVIGLVIGVIYGLIFI |
Ga0111538_127971112 | 3300009156 | Populus Rhizosphere | MAEMTIKRFGVFSVAKMQSLVMFVIGLVIGVIYGLIF |
Ga0105241_124323352 | 3300009174 | Corn Rhizosphere | MAEMTIRRFNVFSVAKIQGFLGFVIGLLIGVVYGLVFMIFGAAISSLAPQG |
Ga0105242_103357543 | 3300009176 | Miscanthus Rhizosphere | MAEMTIRRFGVFSVAKMQSLVMFVIGLVIGVIYGLIFIIFGAAITALAP |
Ga0126307_106590822 | 3300009789 | Serpentine Soil | MAEMTIRRFGVMSVAKMYGLLMFIFGLIFGVIYGLFFIIFGAA |
Ga0099796_105021532 | 3300010159 | Vadose Zone Soil | MAEMTIRRFGIFSVAKMQSLVMFVIGLIVGVIYGLFFMLF |
Ga0134109_100985632 | 3300010320 | Grasslands Soil | MAEMTIRRVGVFSLAKIQGLLMLVIGLIIGVIYGLIFMIFGAALTSVMPKDESQ |
Ga0134126_128907411 | 3300010396 | Terrestrial Soil | MAEMTIRRFGVLSVAKMYGLLTFVIGLIIGVIYGLFFI |
Ga0134124_101414131 | 3300010397 | Terrestrial Soil | MAEMTIRRFGVISVAKMYSLLLFIFGLIFGVIYGLILIVF |
Ga0134121_122240031 | 3300010401 | Terrestrial Soil | MAEMTIRRFGVISVAKMYALLMFIFGLIFGVIYGLILIVF |
Ga0134123_134635622 | 3300010403 | Terrestrial Soil | MAEMTIRRFNVFSVAKIQGFLGFVIGLLIGVIYGFLFMIFGAAISSLAP |
Ga0137326_11233631 | 3300011417 | Soil | MAEMTIKRFSVLSVAKMQSLLMGVIGLIIGVIYGLIFIF |
Ga0137463_12518492 | 3300011444 | Soil | MAEMTIRRFGVFSVAKIQGLLAFVIGLLIGVIYGLFFMLFGAFMSSLAPRSD |
Ga0120182_10130221 | 3300011993 | Terrestrial | MAEMTIRRFGVISVAKMYGLLMFLFGLIFGVIYGLILIVFGAAISAMGPGSA |
Ga0137399_101865621 | 3300012203 | Vadose Zone Soil | MAEMTIRRFGIFSVAKMQSLVMFVVGLIVGVIYGLFFMLFGAAISAFGARGDSSVAGG |
Ga0137367_111684942 | 3300012353 | Vadose Zone Soil | MAEMTIRRFGVFSVAKMQGLLMFVIGLLIGVIYGLVFMIFGAAMSAMM |
Ga0137366_105235722 | 3300012354 | Vadose Zone Soil | MAEMTVRRVGVLSLAKMQGLLMFVMGLIIGVIYGLI |
Ga0137384_101123711 | 3300012357 | Vadose Zone Soil | MAEMTVRRVGVLSLAKMQGLLMFVMGLIIGVIYGLIIMLFGAAMSSL |
Ga0137390_101223051 | 3300012363 | Vadose Zone Soil | MAEMTIKRFGIFSVAKMQSLVMFVIGLIVGVIYGLFFMLFGAA |
Ga0137397_110434882 | 3300012685 | Vadose Zone Soil | MAEMTIRRFSVFSVAKIQGLLGLVIGLLIGILYGLFFMIF |
Ga0137394_115919682 | 3300012922 | Vadose Zone Soil | MAEMTIRRFNVFSVAKIQGFLAFVIGLLIGVIYGFAFM |
Ga0137359_105316071 | 3300012923 | Vadose Zone Soil | MAQMTIRRVGVFSLAKIQALLTFVIGLIFGVIYGLFFMLFGAAISAMAQRG |
Ga0164302_112921372 | 3300012961 | Soil | MAEMTIKRFGVISVAKMYGLITFIFGLIFGVLYGLFFIIFGAAMSAAAGGN |
Ga0164304_104102772 | 3300012986 | Soil | MAEMTIRHFGVISVAKMYGLLMFIFGLVFGVIYGLILIVFG |
Ga0164304_115333771 | 3300012986 | Soil | MAEMTIRRFGVFSVAKMQSLLMGIIGLIIGVIYGLIFIFVGAAFSALGVR |
Ga0132256_1009906241 | 3300015372 | Arabidopsis Rhizosphere | MAEMTIRRFGVFSVAKMQSLLMGIIGLIVGVIYGL |
Ga0132255_1009875733 | 3300015374 | Arabidopsis Rhizosphere | MAEMTIKRFGVFSVAKMYGLVTFVIGFIAGVIYGLGMILFGAAISAFGGREATAGGAS |
Ga0184623_104494271 | 3300018056 | Groundwater Sediment | MAEMTIRRFSVFSVAKIQGFLGFVIGLLIGVVYGLVIMIFGAAISSLAP |
Ga0184615_102125952 | 3300018059 | Groundwater Sediment | MAEMTIRRFSVFSVAKLQGLLAFVIGLLIGVIYGLIFMIFGAAISSMMPQS |
Ga0190265_134502202 | 3300018422 | Soil | MAEMTIKRFGVFSVAKMQSLVMLVIGLVIGVIYGLAFMIFGAAISA |
Ga0190275_109752772 | 3300018432 | Soil | MAEMTIRRFGVLSVAKMYGLLMFIFGLIIGVIYGLFFILFGAAMS |
Ga0190274_108457341 | 3300018476 | Soil | MAEMTIRRFGVLSVAKMYGLLMFIFGLVFGVIYGLILIVFGAAMSA |
Ga0193735_10194324 | 3300020006 | Soil | MAEMMVRRIGVLSLAKMQALLMFVIGLIIGVIYGLIFMIFG |
Ga0207697_101767261 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEMTIKRFSVLSVGKMQSLLMGIIGLIIGVIYGLIFIFVGAAFTAIG |
Ga0207695_114195691 | 3300025913 | Corn Rhizosphere | MAEMTIRRFNVFSVAKIQGFLGFVIGLLIGVIYGFLF |
Ga0207660_113748631 | 3300025917 | Corn Rhizosphere | MAEMTIKRFSVLSVGKMQSLLMGIIGLIIGVIYGLIFIFVGAAFTAIGSRSD |
Ga0207686_100703051 | 3300025934 | Miscanthus Rhizosphere | MAEMTIRRFNVFSVAKIQGFLAFVIGLLIGVLYGFAFMIF |
Ga0207651_106835191 | 3300025960 | Switchgrass Rhizosphere | MAEMTIRRFGVISVAKMYSLLLFIFGLIFGVIYGLILIVFGAAI |
Ga0210102_10490471 | 3300025971 | Natural And Restored Wetlands | MAEMTIRRFGVFSVAKINGLLGFIIGLLIGLIYGLFLILFGAA |
Ga0207703_106581371 | 3300026035 | Switchgrass Rhizosphere | MAEMTIRRFGVISVAKMYGLLMFIFGLVFGVIYGLILIVFGAAISA |
Ga0207675_1001954523 | 3300026118 | Switchgrass Rhizosphere | MAKMMVKRVGVLSAAKMYAMVGLGIGLIVGVIYGLIFMIFG |
Ga0209438_10211711 | 3300026285 | Grasslands Soil | MAEMTIRRFGIFSVAKMQCLVMFVIGLIVGVIYGLIFMLVGA |
Ga0209803_13299351 | 3300026332 | Soil | MAEMTIRRVGVLSLARIQGLLMLVIGLIIGVIYGLIHNALAGVV |
Ga0209592_11599952 | 3300027731 | Freshwater Sediment | MAEMTIKRFSVISVAKIQGLLMFVIGLIIGVIYGLFFMVFG |
Ga0268265_105364793 | 3300028380 | Switchgrass Rhizosphere | MAEMTIKRFGVLSVGKMQSLLMGIIGLIIGVIYGL |
Ga0268265_106728373 | 3300028380 | Switchgrass Rhizosphere | MAEMTIKRFGVISIAKMYGLLMFIFGLVFGVIYGLILIVFGAAISAFGPNRDA |
Ga0310888_111088891 | 3300031538 | Soil | MAEMTIKRFGVFSVAKMQSLVMFVIGLVIGVIYGLIFIIFG |
Ga0310813_117857201 | 3300031716 | Soil | MAEMTIRRFGVISVAKMYGLLMFIFGLVFGVIYGLILIVLGASLSAFGGGRD |
Ga0307468_1009040751 | 3300031740 | Hardwood Forest Soil | MAEMTIRRFNVFSVAKIQGFLTFVIGLLIGVIYGFVFMIFGAAISSLAPQG |
Ga0310900_109123132 | 3300031908 | Soil | MAEMTIKRFGVFSVAKMQSLVMFVIGLVIGVIYGLIFIIFGAAIT |
Ga0307412_119416321 | 3300031911 | Rhizosphere | MAEMTIRRFGVISVAKMYGLLMFLFGLIFGVIYGLILIVFGAAISAMGPNSD |
Ga0307409_1020574782 | 3300031995 | Rhizosphere | MAEMTIRRFGVISVAKMYGLLMFLFGLIFGVIYGLILIVFGAA |
Ga0310897_103150642 | 3300032003 | Soil | MAEMTIRRFGVLSVAKMYALLLFVFGLIIGVIYGLIFIVMGASMFALS |
Ga0316628_1000957035 | 3300033513 | Soil | MAEMTIRRFGVFSVAKMQSLVMCVIGLIIGVIYGLVFMIFGAAISALAPKGESQ |
Ga0364942_0006747_2_157 | 3300034165 | Sediment | MAEMTIKRFSVFSVAKMQGLLAFVIGLLIGVIYGLFFMVFGAAMSSLMPQGE |
Ga0364942_0009754_2862_2969 | 3300034165 | Sediment | MAEMTIRRFSVFSVAKLQGLLAFVIGLLIGVIYGLI |
Ga0373950_0082884_530_670 | 3300034818 | Rhizosphere Soil | MAEMTIKRFGVFSVAKMYGLVTFVVGFIVGVIYGLILIVFGAAISAF |
⦗Top⦘ |