Basic Information | |
---|---|
Family ID | F091059 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 108 |
Average Sequence Length | 42 residues |
Representative Sequence | MMAASSLISELRGSLSDESARIQREFEASGDGRAAVAQR |
Number of Associated Samples | 98 |
Number of Associated Scaffolds | 108 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 47.22 % |
% of genes near scaffold ends (potentially truncated) | 99.07 % |
% of genes from short scaffolds (< 2000 bps) | 91.67 % |
Associated GOLD sequencing projects | 96 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.62 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (62.963 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (18.518 % of family members) |
Environment Ontology (ENVO) | Unclassified (31.481 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (60.185 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.75% β-sheet: 0.00% Coil/Unstructured: 49.25% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.62 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 108 Family Scaffolds |
---|---|---|
PF00543 | P-II | 76.85 |
PF00909 | Ammonium_transp | 12.96 |
PF02276 | CytoC_RC | 3.70 |
PF03712 | Cu2_monoox_C | 1.85 |
PF00005 | ABC_tran | 1.85 |
PF03441 | FAD_binding_7 | 0.93 |
COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
---|---|---|---|
COG0347 | Nitrogen regulatory protein PII | Signal transduction mechanisms [T] | 76.85 |
COG0004 | Ammonia channel protein AmtB | Inorganic ion transport and metabolism [P] | 12.96 |
COG0415 | Deoxyribodipyrimidine photolyase | Replication, recombination and repair [L] | 0.93 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 62.96 % |
Unclassified | root | N/A | 37.04 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001356|JGI12269J14319_10369124 | Not Available | 502 | Open in IMG/M |
3300001648|JGI20242J16303_105652 | Not Available | 611 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100162107 | All Organisms → cellular organisms → Bacteria | 2114 | Open in IMG/M |
3300005437|Ga0070710_11215122 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300005542|Ga0070732_10308511 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 950 | Open in IMG/M |
3300005575|Ga0066702_10114366 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1559 | Open in IMG/M |
3300005712|Ga0070764_10243443 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1022 | Open in IMG/M |
3300005712|Ga0070764_10246729 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
3300006034|Ga0066656_10557539 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella tundricola | 744 | Open in IMG/M |
3300006052|Ga0075029_100544825 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
3300006059|Ga0075017_100077388 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2282 | Open in IMG/M |
3300009520|Ga0116214_1324289 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
3300009522|Ga0116218_1464958 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300009624|Ga0116105_1069836 | Not Available | 837 | Open in IMG/M |
3300009634|Ga0116124_1181099 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300009638|Ga0116113_1054686 | Not Available | 926 | Open in IMG/M |
3300010361|Ga0126378_10258051 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. | 1838 | Open in IMG/M |
3300010361|Ga0126378_12559978 | Not Available | 583 | Open in IMG/M |
3300010376|Ga0126381_101259148 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
3300010379|Ga0136449_101024283 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella | 1325 | Open in IMG/M |
3300011069|Ga0138592_1029640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b | 673 | Open in IMG/M |
3300011076|Ga0138574_1052557 | Not Available | 701 | Open in IMG/M |
3300011084|Ga0138562_1092164 | Not Available | 655 | Open in IMG/M |
3300012205|Ga0137362_11440231 | Not Available | 575 | Open in IMG/M |
3300012354|Ga0137366_10766854 | Not Available | 685 | Open in IMG/M |
3300012957|Ga0164303_10669253 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
3300012971|Ga0126369_11589934 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 743 | Open in IMG/M |
3300014159|Ga0181530_10296146 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 850 | Open in IMG/M |
3300014501|Ga0182024_12652882 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300015078|Ga0167660_1038715 | Not Available | 512 | Open in IMG/M |
3300016750|Ga0181505_10366187 | Not Available | 585 | Open in IMG/M |
3300017823|Ga0187818_10562768 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300017955|Ga0187817_10881359 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300017975|Ga0187782_10445117 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 987 | Open in IMG/M |
3300018044|Ga0187890_10035128 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3035 | Open in IMG/M |
3300018060|Ga0187765_10373859 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 873 | Open in IMG/M |
3300018090|Ga0187770_10645859 | Not Available | 843 | Open in IMG/M |
3300018090|Ga0187770_11575897 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300019240|Ga0181510_1272280 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
3300019240|Ga0181510_1403390 | Not Available | 742 | Open in IMG/M |
3300019241|Ga0187793_1071848 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300019278|Ga0187800_1064586 | Not Available | 657 | Open in IMG/M |
3300019890|Ga0193728_1218103 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 788 | Open in IMG/M |
3300020582|Ga0210395_10333816 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1140 | Open in IMG/M |
3300021180|Ga0210396_10901460 | Not Available | 754 | Open in IMG/M |
3300021181|Ga0210388_11408159 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
3300021402|Ga0210385_10408631 | Not Available | 1020 | Open in IMG/M |
3300021402|Ga0210385_10613472 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
3300021404|Ga0210389_10454330 | Not Available | 1008 | Open in IMG/M |
3300021407|Ga0210383_10482247 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
3300021479|Ga0210410_10220126 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1701 | Open in IMG/M |
3300021559|Ga0210409_11274505 | Not Available | 611 | Open in IMG/M |
3300022505|Ga0242647_1007995 | Not Available | 897 | Open in IMG/M |
3300022505|Ga0242647_1025710 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
3300022508|Ga0222728_1046058 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
3300022508|Ga0222728_1058297 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
3300022508|Ga0222728_1074123 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
3300022512|Ga0242676_1023170 | Not Available | 659 | Open in IMG/M |
3300022532|Ga0242655_10069293 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
3300022533|Ga0242662_10138117 | Not Available | 728 | Open in IMG/M |
3300022533|Ga0242662_10297749 | Not Available | 537 | Open in IMG/M |
3300022716|Ga0242673_1071856 | Not Available | 623 | Open in IMG/M |
3300022873|Ga0224550_1070475 | Not Available | 503 | Open in IMG/M |
3300023255|Ga0224547_1051517 | Not Available | 535 | Open in IMG/M |
3300023259|Ga0224551_1041330 | Not Available | 801 | Open in IMG/M |
3300024225|Ga0224572_1003972 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2538 | Open in IMG/M |
3300024295|Ga0224556_1005935 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3351 | Open in IMG/M |
3300025500|Ga0208686_1099868 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
3300025906|Ga0207699_10278723 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1161 | Open in IMG/M |
3300025920|Ga0207649_11102760 | Not Available | 626 | Open in IMG/M |
3300025928|Ga0207700_10762650 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 865 | Open in IMG/M |
3300025949|Ga0207667_11425027 | Not Available | 666 | Open in IMG/M |
3300026551|Ga0209648_10480709 | Not Available | 740 | Open in IMG/M |
3300027388|Ga0208995_1041208 | Not Available | 812 | Open in IMG/M |
3300027619|Ga0209330_1016651 | Not Available | 1645 | Open in IMG/M |
3300027625|Ga0208044_1143681 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
3300027662|Ga0208565_1077731 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1022 | Open in IMG/M |
3300027684|Ga0209626_1159259 | Not Available | 597 | Open in IMG/M |
3300027701|Ga0209447_10056501 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1081 | Open in IMG/M |
3300027879|Ga0209169_10044969 | All Organisms → cellular organisms → Bacteria | 2305 | Open in IMG/M |
3300027884|Ga0209275_10688360 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
3300027889|Ga0209380_10458306 | Not Available | 745 | Open in IMG/M |
3300027911|Ga0209698_10479130 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 965 | Open in IMG/M |
3300028798|Ga0302222_10096702 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1177 | Open in IMG/M |
3300028871|Ga0302230_10438367 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300029910|Ga0311369_10125234 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2528 | Open in IMG/M |
3300030020|Ga0311344_10187294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2152 | Open in IMG/M |
3300030575|Ga0210288_1173039 | Not Available | 591 | Open in IMG/M |
3300030646|Ga0302316_10305600 | Not Available | 643 | Open in IMG/M |
3300030707|Ga0310038_10315739 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
3300030814|Ga0265741_105745 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
3300030872|Ga0265723_1010807 | Not Available | 655 | Open in IMG/M |
3300031010|Ga0265771_1031165 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300031231|Ga0170824_116666662 | Not Available | 574 | Open in IMG/M |
3300031233|Ga0302307_10073866 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1795 | Open in IMG/M |
3300031235|Ga0265330_10061013 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1641 | Open in IMG/M |
3300031241|Ga0265325_10310601 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
3300031247|Ga0265340_10528103 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300031715|Ga0307476_10114004 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella | 1919 | Open in IMG/M |
3300031715|Ga0307476_11107480 | Not Available | 581 | Open in IMG/M |
3300032515|Ga0348332_10282342 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
3300032770|Ga0335085_11433698 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 722 | Open in IMG/M |
3300032897|Ga0335071_11177948 | Not Available | 711 | Open in IMG/M |
3300032898|Ga0335072_10284469 | All Organisms → cellular organisms → Bacteria | 1868 | Open in IMG/M |
3300032954|Ga0335083_10312359 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1376 | Open in IMG/M |
3300034125|Ga0370484_0033564 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1231 | Open in IMG/M |
3300034195|Ga0370501_0000208 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 11750 | Open in IMG/M |
3300034282|Ga0370492_0456467 | Not Available | 518 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.52% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 9.26% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.63% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.63% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.63% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.63% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.70% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.70% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.70% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.70% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.70% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 3.70% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.78% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 2.78% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.78% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 2.78% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.85% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.85% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.85% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.85% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.93% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.93% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.93% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.93% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.93% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.93% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.93% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.93% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.93% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.93% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.93% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.93% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
3300001648 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
3300009634 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 | Environmental | Open in IMG/M |
3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300011069 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 19 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011076 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 59 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011084 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 47 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300015078 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11a, vegetated hydrological feature) | Environmental | Open in IMG/M |
3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300019240 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019241 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300022505 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022508 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022512 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022716 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022873 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 10-14 | Environmental | Open in IMG/M |
3300023255 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 10-14 | Environmental | Open in IMG/M |
3300023259 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24 | Environmental | Open in IMG/M |
3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
3300024295 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5 | Environmental | Open in IMG/M |
3300025500 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300027388 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027619 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
3300028871 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_1 | Environmental | Open in IMG/M |
3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
3300030020 | II_Bog_N1 coassembly | Environmental | Open in IMG/M |
3300030575 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE050SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030646 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_2 | Environmental | Open in IMG/M |
3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
3300030814 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030872 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031010 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Host-Associated | Open in IMG/M |
3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
3300034195 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17 | Environmental | Open in IMG/M |
3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12269J14319_103691242 | 3300001356 | Peatlands Soil | MTAASSLISELRGSLNDESARIQREFAANGDGRTAVAQRTELIEGI |
JGI20242J16303_1056521 | 3300001648 | Forest Soil | MMAASSLISELRGSLAAESARMASDFAAMGDGRAAVAQRTRLIEDIL |
JGIcombinedJ26739_1001621071 | 3300002245 | Forest Soil | MATSSLIGELRSTLGEHSARIQREFESSGDGRAAVIQRTRL |
Ga0070710_112151222 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MAASSLIGELRGSINDESARIRREFEAAGDGRACVAARTHL |
Ga0070732_103085111 | 3300005542 | Surface Soil | MMAASSLISELRGSLNDESARIHREFEATGDGRAAVAQRTRL |
Ga0066702_101143663 | 3300005575 | Soil | MAASSLISELRSSLTDESARIQREFESTGDGRAALAQRTRLVEE |
Ga0070764_102434433 | 3300005712 | Soil | MTAASLLITELRSSLADAGERIARDFAATGDGRAAIAQ |
Ga0070764_102467293 | 3300005712 | Soil | MWPAPGEYEFTFMTAASSLISELRGSLNEESARIQREFAASGDGR |
Ga0066656_105575391 | 3300006034 | Soil | MVAASSLIGELRGSINDESARMRREFEAAGDGRACV |
Ga0075029_1005448251 | 3300006052 | Watersheds | MTAAPPLISELRTSLGEQSAKIARDFAATGDGRAAIA |
Ga0075017_1000773881 | 3300006059 | Watersheds | MMAASPLINELRSSLSEESARIQREFESSGDGRAAVAQRTRLIE |
Ga0116214_13242891 | 3300009520 | Peatlands Soil | MTAASSIIGELRESLAEESARIRRGFEATGNGRAAVA |
Ga0116218_14649581 | 3300009522 | Peatlands Soil | MMAASSISELRISQLRGSISEESARIQREFEVTADGRAALAQRTR |
Ga0116105_10698361 | 3300009624 | Peatland | MMAASSISELRISELRGSLSEESARIQREFEASADG |
Ga0116124_11810991 | 3300009634 | Peatland | MMESSSLISELRGALAEESARMGRDFAATGDGRAAVGQRT |
Ga0116113_10546862 | 3300009638 | Peatland | MMESSSLISELRGALAEESARMGRDFAATGDGRAAVGQ |
Ga0126378_102580511 | 3300010361 | Tropical Forest Soil | MMAASSLIGELRASIGDESARIQQEFEATADGRAAVT |
Ga0126378_125599782 | 3300010361 | Tropical Forest Soil | MMAASPLIGELRSSISDESARIQREFETAADGRVSVYQRTRMVEEILTR* |
Ga0126381_1012591481 | 3300010376 | Tropical Forest Soil | MMAASSLIGELRGSINQESARILREFEASGDGRGAVTERTRLVEDIL |
Ga0136449_1010242831 | 3300010379 | Peatlands Soil | MTAASSLISELRSSLADESARIATDFAASGDGRAAVAQR |
Ga0138592_10296401 | 3300011069 | Peatlands Soil | MAASSLIGELRVSLNDESARIQRAFEASGDGRAAVAQRTRLIE |
Ga0138574_10525571 | 3300011076 | Peatlands Soil | MMAASSLISELRVSLNDESARIQREFEASGDGRAALAQRTRLVEDILARLW |
Ga0138562_10921642 | 3300011084 | Peatlands Soil | MMAASSLISELRGSLSDESARIQREFEASGDGRAALAQRTRLVED |
Ga0137362_114402311 | 3300012205 | Vadose Zone Soil | MAASSLISELRGSLSDESARIQREFGAFGDGRAALAQRTRLIEEI |
Ga0137366_107668542 | 3300012354 | Vadose Zone Soil | MMAASSLISELRGSLSEESARIQREFEVSGDGRAAVAQRTQLIE |
Ga0164303_106692531 | 3300012957 | Soil | MAASFSIGELRGSLNDETARIQREFESTGDGRACVTQ |
Ga0126369_115899341 | 3300012971 | Tropical Forest Soil | MAASPLISELRGSLIEESARIQREFEATGEGRTCVTQRTRLVED |
Ga0181530_102961461 | 3300014159 | Bog | MAASSLIGELRTFLSDESARIQRAFEASGDGRAAVGQRTRLIEETL |
Ga0182024_126528821 | 3300014501 | Permafrost | MTEASLLISELRRSLAEGSEHIATDFEAIGDGRAAVAQRT |
Ga0167660_10387152 | 3300015078 | Glacier Forefield Soil | MAASTLISELRSSLIEESARIQSAFEASGDGRAAVAQRTRLV |
Ga0181505_103661871 | 3300016750 | Peatland | MTAASSLISELRNSLAEESARMASDFAATGDGCTAIAQRTQLIENIL |
Ga0187818_105627682 | 3300017823 | Freshwater Sediment | MMAASSLIGELRGSLSDESARIQREFEASGDGRAAVAQR |
Ga0187817_108813591 | 3300017955 | Freshwater Sediment | MMAPSLLVSELRSSLAEQSARIERDFAVTADGRAAVAERT |
Ga0187782_104451173 | 3300017975 | Tropical Peatland | MMAASSLIGELRSSIGHQSARIQREFEATGDGRAAVTQR |
Ga0187890_100351284 | 3300018044 | Peatland | MTFIMAASSLISELRGSLSDESARIQREFEASGDGRVAV |
Ga0187765_103738593 | 3300018060 | Tropical Peatland | MTGRFTFMMAASSLISELRGSLNDESSRIHREFEATGDGRAAVAERTRLVED |
Ga0187770_106458592 | 3300018090 | Tropical Peatland | MIAASLIGELRTFLNVESARIQQEFEGSGDGRAAVAGRTRLI |
Ga0187770_115758971 | 3300018090 | Tropical Peatland | MMAASSLISELRGSLNDESARIQRAFEASGDGRAAVAERTRL |
Ga0181510_12722801 | 3300019240 | Peatland | MTAASSLISELRGSLSDESARIQREFAASGDGRTA |
Ga0181510_14033902 | 3300019240 | Peatland | MTFIMAASSLISELRGSLSDESARIQREFEASGDGRVAVAQRTRLV |
Ga0187793_10718482 | 3300019241 | Peatland | MAASSLIGELRGSISDESSRIQREFEATGDGRACVTQRTRMVEDIL |
Ga0187800_10645862 | 3300019278 | Peatland | MIAASLIGELRTFLNVESARIQQEFEGSGDGRAAVAGRTRLIEDILKR |
Ga0193728_12181032 | 3300019890 | Soil | MTATSSLIGELRSCIAEESARIARDFASAGDGAAA |
Ga0210395_103338163 | 3300020582 | Soil | MMAASSLISELRGSLSDESARIQREFEISGDGRTAV |
Ga0210396_109014601 | 3300021180 | Soil | MMAASSLISELRGSLSDESARIQRDFEASGDGRAALAQRTRL |
Ga0210388_114081592 | 3300021181 | Soil | MVMMAASSLISELRGSLVEESARIARDFAVTGDGHAAVALRTR |
Ga0210385_104086311 | 3300021402 | Soil | MMAASLTNELRTSELRLSELRSSLSGESTRIQREFEASS |
Ga0210385_106134723 | 3300021402 | Soil | MGDSDFTFMTAASSLIGELRGSLAEESARIQREFGSSGDGRTAVAQRT |
Ga0210389_104543301 | 3300021404 | Soil | MVMTAASSLISELRGSLAEASARIARDFAVTGDGRAAVAQRTRLIED |
Ga0210383_104822472 | 3300021407 | Soil | MTAASSLIGELRGSLNEESARIQREFAASGDGRTAVAQRTELI |
Ga0210410_102201261 | 3300021479 | Soil | MAASLLISELRSSLAEESARMARDFAASGDGRAAVAQRA |
Ga0210409_112745052 | 3300021559 | Soil | MMAASLLISELRSSLAEESARMARDFAGTGDGLAAV |
Ga0242647_10079951 | 3300022505 | Soil | MTAASSLIGELRGSLNEESARIQREFAASGDGRTAVAQ |
Ga0242647_10257102 | 3300022505 | Soil | MMAASSLISELRGSLSDESARIQREFEASGDGRAAL |
Ga0222728_10460581 | 3300022508 | Soil | MTAASSLIGELRGSLNEESARIQREFGARGDGRTAVAQRTELIE |
Ga0222728_10582971 | 3300022508 | Soil | MAASSLISELRGSLSDESARIQREFEASGDGRAALAQRTR |
Ga0222728_10741232 | 3300022508 | Soil | MTAASSLIGELRGSLNEESARIQREFASSGDGRTAVAQRTEL |
Ga0242676_10231701 | 3300022512 | Soil | MMAASSLISELRGSLSDESARIQREFEASGDRRAAVAERTRLV |
Ga0242655_100692932 | 3300022532 | Soil | MTAASSLIGELRGSLNEESARIQREFAASGDGRTAVAQRTELIG |
Ga0242662_101381171 | 3300022533 | Soil | MMAASSLISELRGSLSDESARIQREFEASGDGRAAV |
Ga0242662_102977492 | 3300022533 | Soil | MMGASPLIGELRGALSEQSANIQREFEATGNGRAAVG |
Ga0242673_10718562 | 3300022716 | Soil | MMAASSLISELRGSLSDESTRIQREFEASGDGRAALAQRTRLV |
Ga0224550_10704751 | 3300022873 | Soil | MTAASLLISELRGSLADESARMARDFAATGDGCAAVATRTRLIEDILRRLWRNLV |
Ga0224547_10515171 | 3300023255 | Soil | MAASSLISELRSTLAEETARIAQEFASTGDGRRAVAQRT |
Ga0224551_10413302 | 3300023259 | Soil | MAAPSLISELRDSLSDESARIQREFEAFGDGRAAVAQR |
Ga0224572_10039721 | 3300024225 | Rhizosphere | MMAASSLANESSTSDLRISELRGSLSEESARIQREFEASGDGRATVA |
Ga0224556_10059354 | 3300024295 | Soil | MTFIMAASSLISELRGSLSDESARIQREFEASGDGRVAVAQR |
Ga0208686_10998682 | 3300025500 | Peatland | MTAASLLISELRGSLAEESARIAREFAASGDGRAAVAQRTLLIED |
Ga0207699_102787231 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MAASTLIGELRGSLQDESARIQKEFEAAGDGRACVTGRTRLIEEILSRLWR |
Ga0207649_111027601 | 3300025920 | Corn Rhizosphere | MVAASSLIGELRGSINDESARIRREFEAAGDGRACVAARTHLVEEIL |
Ga0207700_107626501 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MMAASSLINELRSSLSDESARIQREFEVSGDGRAAVAQRTRLV |
Ga0207667_114250273 | 3300025949 | Corn Rhizosphere | MAASSLIGELRGSINDESTRIQREFEATGDGRVCVAQRTRL |
Ga0209648_104807091 | 3300026551 | Grasslands Soil | MTASSSSTGELRDSLQEESARIQRQFEATGDGRAAVAART |
Ga0208995_10412083 | 3300027388 | Forest Soil | MTASSSSTGELRDSLQEESARIQREFEATGDGRAAVAA |
Ga0209330_10166511 | 3300027619 | Forest Soil | MAASSLISELRDSLSDESARIQRDFEAFGDGRAAVAQRTRLVE |
Ga0208044_11436812 | 3300027625 | Peatlands Soil | MMAASSISESRISELRGSLNEASARIQREFEVSADGRAALAQRTRLVEDIL |
Ga0208565_10777313 | 3300027662 | Peatlands Soil | MMAASSLISELRGSLSDESARIQREFEASGDGRAAVAQR |
Ga0209626_11592591 | 3300027684 | Forest Soil | MTAASSLIGELRGSIAEESARIARDFAATGDGSAAVAQRTQLIDEILKRLWRD |
Ga0209447_100565011 | 3300027701 | Bog Forest Soil | MTAGSSLISELRDSLAEESAKIGRDFAATGHGRTAVA |
Ga0209169_100449694 | 3300027879 | Soil | MTAASSLISELRGSLNEESARIQREFAASGDGRTAVAQRTELIEGILQRL |
Ga0209275_106883602 | 3300027884 | Soil | MVMTAASSLISELRGSLAEESARIARDFAATGDGRAAVAERTR |
Ga0209380_104583061 | 3300027889 | Soil | LKHGRDGVSSLISELRGSLSEESARIAREFAMTGDGRAAVAQRTRL |
Ga0209698_104791303 | 3300027911 | Watersheds | LINELRSSLSEESARIQQAFESSGDGRAAVAQRTRLIEDIL |
Ga0302222_100967023 | 3300028798 | Palsa | MTAASSLISELRGSLNEESARIQRDFAASGDGRTAVAQRTELIEGI |
Ga0302230_104383672 | 3300028871 | Palsa | MMAASLLISELRGSLAEESARIARDFAATGDGCAAVATRTRLIEDI |
Ga0311369_101252341 | 3300029910 | Palsa | MWPAHGEYEFTFMTAASSLISELRGSLNEESARIQRDFAASGDGRT |
Ga0311344_101872944 | 3300030020 | Bog | MTAASSLISELRGSLAEESARMERDFAATGDGRAAVAHRT |
Ga0210288_11730391 | 3300030575 | Soil | MTAASLLITELRSSLADASERIARDFAATGDGRAAIAQRTLLIE |
Ga0302316_103056001 | 3300030646 | Palsa | MTAASSLISELRGSLAEESARMERDFTATGDGGAAVAH |
Ga0310038_103157392 | 3300030707 | Peatlands Soil | MMAASSLISELRGSLSDESARIQREFEASGDGRAALAQRTRLVEDILS |
Ga0265741_1057451 | 3300030814 | Soil | MTAASSLISELRGSLNEESARIQQEFAASGDGRTAVAQRTELIEGILQRLW |
Ga0265723_10108071 | 3300030872 | Soil | MMAASSLIGELRTSLSDESARIQRKFEASGDGRGAVA |
Ga0265771_10311652 | 3300031010 | Soil | MTAASSLIGELRGSLNEESARIQREFGASGDGRTAVAQRT |
Ga0170824_1166666621 | 3300031231 | Forest Soil | MAASSLISQLRSSLSDESARIQLEFEASGDGRVALAQRTRLIEEILARLWRD |
Ga0302307_100738661 | 3300031233 | Palsa | MTAASSLISELRGSLNEESARIQRDFAASGDGRTAV |
Ga0265330_100610131 | 3300031235 | Rhizosphere | LISELRGSLSDESARIQREFEVSGDGRSAVAQRTRLVEDILARLWRDII |
Ga0265325_103106011 | 3300031241 | Rhizosphere | MMAASSLISELRGSLSDESARIQREFEVSGEGRAAL |
Ga0265340_105281031 | 3300031247 | Rhizosphere | MMAASSLISELRGSLSDESARIQREFEVSGDGRSAVAQRTRL |
Ga0307476_101140043 | 3300031715 | Hardwood Forest Soil | MMAASSLITELRSSLTDESARIQREFEGSGDGRVAVA |
Ga0307476_111074802 | 3300031715 | Hardwood Forest Soil | MTAASSLIGELRGSLAEESAQIARDFALTGDGRVAVAQ |
Ga0348332_102823421 | 3300032515 | Plant Litter | MTAASLLISELRGSLAEESARIARDFTTTGDGRTVVAQRTQLIEDILRRLW |
Ga0335085_114336983 | 3300032770 | Soil | MGAAGIEFMMAASPLISELRGFLGDESARIQREFEATGDGRACIT |
Ga0335071_111779481 | 3300032897 | Soil | MMAASSLIGELRGSINDESARIQREFEATSDGRACVT |
Ga0335072_102844693 | 3300032898 | Soil | MAASSLIGELRSSISEESARIQRDFEASGDGRSAVAQRTRLIE |
Ga0335083_103123591 | 3300032954 | Soil | MAASSLIGELRSSINDESARIQRAFDSTGDGRAAVGQRTA |
Ga0370484_0033564_1099_1230 | 3300034125 | Untreated Peat Soil | MMAASSLISELRGSLSDESARIQREFEVSGDGRSAVAQRTRLVE |
Ga0370501_0000208_3_131 | 3300034195 | Untreated Peat Soil | MKAASSLISELRSSLSEESARIQREFEVSGDGRVSVAQRTRLV |
Ga0370492_0456467_2_124 | 3300034282 | Untreated Peat Soil | MPASSLISELRGSLSDESARIRREFDASGDGRAAVLQRTRL |
⦗Top⦘ |