Basic Information | |
---|---|
Family ID | F090906 |
Family Type | Metagenome |
Number of Sequences | 108 |
Average Sequence Length | 42 residues |
Representative Sequence | HLFIDYKDFRNALLAGEYGAGNEPLYKLNANIFQVFVSIWF |
Number of Associated Samples | 100 |
Number of Associated Scaffolds | 108 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.93 % |
% of genes near scaffold ends (potentially truncated) | 98.15 % |
% of genes from short scaffolds (< 2000 bps) | 92.59 % |
Associated GOLD sequencing projects | 98 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.26 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (100.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (22.222 % of family members) |
Environment Ontology (ENVO) | Unclassified (19.444 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.593 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.58% β-sheet: 0.00% Coil/Unstructured: 59.42% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.26 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 108 Family Scaffolds |
---|---|---|
PF04366 | Ysc84 | 51.85 |
PF01554 | MatE | 4.63 |
PF02424 | ApbE | 1.85 |
PF00857 | Isochorismatase | 0.93 |
PF12094 | DUF3570 | 0.93 |
PF10009 | DUF2252 | 0.93 |
PF13428 | TPR_14 | 0.93 |
PF14559 | TPR_19 | 0.93 |
PF04267 | SoxD | 0.93 |
COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
---|---|---|---|
COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 51.85 |
COG1477 | FAD:protein FMN transferase ApbE | Posttranslational modification, protein turnover, chaperones [O] | 1.85 |
COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.93 |
COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.93 |
COG4311 | Sarcosine oxidase delta subunit | Amino acid transport and metabolism [E] | 0.93 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 100.00 % |
Unclassified | root | N/A | 0.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2162886015|FOassembled-_contig08744 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1337 | Open in IMG/M |
3300002070|JGI24750J21931_1029131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 803 | Open in IMG/M |
3300005181|Ga0066678_10552595 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
3300005181|Ga0066678_10951073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 559 | Open in IMG/M |
3300005332|Ga0066388_100170885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2773 | Open in IMG/M |
3300005437|Ga0070710_10753734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 692 | Open in IMG/M |
3300005444|Ga0070694_100784314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 780 | Open in IMG/M |
3300005454|Ga0066687_10102072 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1449 | Open in IMG/M |
3300005538|Ga0070731_10191242 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1359 | Open in IMG/M |
3300005539|Ga0068853_101820859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 590 | Open in IMG/M |
3300005566|Ga0066693_10008783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2783 | Open in IMG/M |
3300005569|Ga0066705_10231832 | All Organisms → cellular organisms → Bacteria | 1166 | Open in IMG/M |
3300005576|Ga0066708_10065823 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2070 | Open in IMG/M |
3300005842|Ga0068858_101089817 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
3300005993|Ga0080027_10108888 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1043 | Open in IMG/M |
3300006163|Ga0070715_10797438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 573 | Open in IMG/M |
3300006164|Ga0075441_10092605 | All Organisms → cellular organisms → Bacteria | 1163 | Open in IMG/M |
3300006174|Ga0075014_100587151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 635 | Open in IMG/M |
3300006358|Ga0068871_100352795 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1301 | Open in IMG/M |
3300006796|Ga0066665_10059698 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2663 | Open in IMG/M |
3300006800|Ga0066660_11280252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 574 | Open in IMG/M |
3300007258|Ga0099793_10286121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 799 | Open in IMG/M |
3300009093|Ga0105240_11266821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 779 | Open in IMG/M |
3300009137|Ga0066709_100891150 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1296 | Open in IMG/M |
3300009502|Ga0114951_10135356 | All Organisms → cellular organisms → Bacteria | 1368 | Open in IMG/M |
3300010046|Ga0126384_11829041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 577 | Open in IMG/M |
3300010321|Ga0134067_10165558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 796 | Open in IMG/M |
3300010360|Ga0126372_11019567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 840 | Open in IMG/M |
3300010375|Ga0105239_12669801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 583 | Open in IMG/M |
3300010397|Ga0134124_12904643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 523 | Open in IMG/M |
3300012206|Ga0137380_10592448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 970 | Open in IMG/M |
3300012359|Ga0137385_10242322 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1563 | Open in IMG/M |
3300012359|Ga0137385_11099370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 654 | Open in IMG/M |
3300012582|Ga0137358_10373619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 965 | Open in IMG/M |
3300012683|Ga0137398_10448480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 882 | Open in IMG/M |
3300012923|Ga0137359_11669199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 525 | Open in IMG/M |
3300012925|Ga0137419_10360156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1127 | Open in IMG/M |
3300012927|Ga0137416_10468760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1080 | Open in IMG/M |
3300012929|Ga0137404_10901411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 806 | Open in IMG/M |
3300012944|Ga0137410_10666855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 864 | Open in IMG/M |
3300012975|Ga0134110_10240017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 769 | Open in IMG/M |
3300014654|Ga0181525_10778156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 539 | Open in IMG/M |
3300015371|Ga0132258_12722631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1233 | Open in IMG/M |
3300016319|Ga0182033_10457134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1090 | Open in IMG/M |
3300017970|Ga0187783_10523698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 859 | Open in IMG/M |
3300017970|Ga0187783_10739150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 710 | Open in IMG/M |
3300017970|Ga0187783_11318813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 520 | Open in IMG/M |
3300017974|Ga0187777_11306652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 533 | Open in IMG/M |
3300017975|Ga0187782_11140451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 609 | Open in IMG/M |
3300018058|Ga0187766_11406683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 512 | Open in IMG/M |
3300018433|Ga0066667_11220367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 655 | Open in IMG/M |
3300020581|Ga0210399_10786556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 778 | Open in IMG/M |
3300021432|Ga0210384_11201512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 662 | Open in IMG/M |
3300021475|Ga0210392_10539853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 862 | Open in IMG/M |
3300021559|Ga0210409_11220967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 627 | Open in IMG/M |
3300021560|Ga0126371_11807104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 732 | Open in IMG/M |
3300021560|Ga0126371_11839295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 726 | Open in IMG/M |
3300021560|Ga0126371_13866445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 505 | Open in IMG/M |
3300023265|Ga0247780_1040934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1147 | Open in IMG/M |
3300025162|Ga0209083_1081204 | All Organisms → cellular organisms → Bacteria | 1320 | Open in IMG/M |
3300025906|Ga0207699_10172667 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1447 | Open in IMG/M |
3300025914|Ga0207671_10230878 | All Organisms → cellular organisms → Bacteria | 1451 | Open in IMG/M |
3300025914|Ga0207671_11520046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 516 | Open in IMG/M |
3300025916|Ga0207663_10340853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1132 | Open in IMG/M |
3300025928|Ga0207700_10280103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1434 | Open in IMG/M |
3300025929|Ga0207664_10177435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1827 | Open in IMG/M |
3300025938|Ga0207704_10058098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2380 | Open in IMG/M |
3300025939|Ga0207665_11017227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 659 | Open in IMG/M |
3300026088|Ga0207641_10835394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 912 | Open in IMG/M |
3300026312|Ga0209153_1006220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3729 | Open in IMG/M |
3300026481|Ga0257155_1044100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 688 | Open in IMG/M |
3300026527|Ga0209059_1000189 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 26643 | Open in IMG/M |
3300026551|Ga0209648_10456271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 788 | Open in IMG/M |
3300027521|Ga0209524_1035383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1047 | Open in IMG/M |
3300027587|Ga0209220_1018575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1853 | Open in IMG/M |
3300027651|Ga0209217_1114690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 762 | Open in IMG/M |
3300027680|Ga0207826_1067057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 989 | Open in IMG/M |
3300027681|Ga0208991_1077308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1002 | Open in IMG/M |
3300027853|Ga0209274_10686303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 528 | Open in IMG/M |
3300028906|Ga0308309_10327301 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1302 | Open in IMG/M |
3300031231|Ga0170824_108043494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 603 | Open in IMG/M |
3300031544|Ga0318534_10433668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 753 | Open in IMG/M |
3300031681|Ga0318572_10473435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 746 | Open in IMG/M |
3300031715|Ga0307476_10516877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 885 | Open in IMG/M |
3300031723|Ga0318493_10211072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1027 | Open in IMG/M |
3300031744|Ga0306918_10317776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1203 | Open in IMG/M |
3300031765|Ga0318554_10034426 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2732 | Open in IMG/M |
3300031768|Ga0318509_10582799 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300031771|Ga0318546_10349167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1029 | Open in IMG/M |
3300031779|Ga0318566_10242537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 894 | Open in IMG/M |
3300031781|Ga0318547_10605524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 679 | Open in IMG/M |
3300031792|Ga0318529_10316675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 726 | Open in IMG/M |
3300031819|Ga0318568_10219638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1174 | Open in IMG/M |
3300031820|Ga0307473_10885430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 643 | Open in IMG/M |
3300031859|Ga0318527_10370582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 610 | Open in IMG/M |
3300031896|Ga0318551_10663400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 603 | Open in IMG/M |
3300031897|Ga0318520_10635228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 665 | Open in IMG/M |
3300031942|Ga0310916_11326600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 591 | Open in IMG/M |
3300031962|Ga0307479_11916698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 543 | Open in IMG/M |
3300031981|Ga0318531_10284130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 747 | Open in IMG/M |
3300032010|Ga0318569_10537461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 544 | Open in IMG/M |
3300032039|Ga0318559_10215569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 884 | Open in IMG/M |
3300032054|Ga0318570_10423859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 607 | Open in IMG/M |
3300032064|Ga0318510_10034919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1707 | Open in IMG/M |
3300032205|Ga0307472_100266470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1354 | Open in IMG/M |
3300032205|Ga0307472_101747494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 616 | Open in IMG/M |
3300032829|Ga0335070_11492124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 616 | Open in IMG/M |
3300033158|Ga0335077_10876910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 906 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 22.22% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.19% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.26% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.48% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.56% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.63% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.63% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.70% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.70% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.78% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.85% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.85% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.85% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.85% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.85% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.85% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.93% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.93% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.93% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.93% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.93% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.93% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.93% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.93% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.93% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.93% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.93% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.93% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.93% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.93% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.93% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2162886015 | Grass soil microbial communities from Rothamsted Park, UK - FO (Mercury 0.02g/kg) assembled | Environmental | Open in IMG/M |
3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Host-Associated | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009502 | Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300023265 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L079-202R-5 | Environmental | Open in IMG/M |
3300025162 | Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
3300026481 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-A | Environmental | Open in IMG/M |
3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FOassembled-_0744.00000820 | 2162886015 | Grass Soil | DYSDFRNALYAGTDGFTAGNEPLYQLDANILQVFVSIWF |
JGI24750J21931_10291312 | 3300002070 | Corn, Switchgrass And Miscanthus Rhizosphere | NKSSLSIRLDHLLIDYKDYRNALLTGTTPEFTAGNEPLYKLNANIFQIFASIWF* |
Ga0066678_105525951 | 3300005181 | Soil | INVRVDHLLVDYSDFRNALLAGTYGAGNEPLYKLNANIFQVFVSIWF* |
Ga0066678_109510731 | 3300005181 | Soil | LRVDHLMIDYSDFRNALLAGTYGAGNEPLYKLNANIFQVFFSIWF* |
Ga0066388_1001708851 | 3300005332 | Tropical Forest Soil | DHLFIDYKDFRNALLASEYGAGNEPLYKLNANIFQVFVSIWF* |
Ga0070710_107537342 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | VRFDHLFIDYKDFRNALLAGEYGAGNEPLYKLNANIFQIFVSIWF* |
Ga0070694_1007843141 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | RADHLMVNYSDFRNALLAGEFGAGDEPLYKLNANIFQLFVSIWF* |
Ga0066687_101020723 | 3300005454 | Soil | VRVDHLLVDYSDFRNALLAGTYGAGNEPLYELNANIFQVFVSIWF* |
Ga0070731_101912423 | 3300005538 | Surface Soil | DHLLVDYSDFRDALLAAQYGAGKEPLYKLNANILQVFVSVWY* |
Ga0068853_1018208591 | 3300005539 | Corn Rhizosphere | HLMIDYADFRNALLADQYGAGNEPLYKLNANVLTAFFSIWY* |
Ga0066693_100087834 | 3300005566 | Soil | YSDFRNALLAGTYGAGNEPLYKLNANIFQVFVSIWF* |
Ga0066705_102318321 | 3300005569 | Soil | LLVDYSDFRNALLAGTYGAGNEPLYKLNANVFQVFVSIWF* |
Ga0066708_100658233 | 3300005576 | Soil | LVDYSDFRNALLAGTYGAGNEPLYKLNANIFQVFVSIWF* |
Ga0068858_1010898172 | 3300005842 | Switchgrass Rhizosphere | IRYDHLMIDYGDYRNALYSKFGGGQPGAEPLYSLDANIFQVFVSIWF* |
Ga0080027_101088882 | 3300005993 | Prmafrost Soil | FNVHVARLMIDYSDFRNALLAGEYGAGNEPLYKLNATVFTVFISVWY* |
Ga0070715_107974381 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | DYKDFRNALLAGEYGAGNEPLYKLNANIFQIFVSIWF* |
Ga0075441_100926052 | 3300006164 | Marine | DYRNALLIGANPDWTAGSEPLYKLNANILQAFLSVWF* |
Ga0075014_1005871512 | 3300006174 | Watersheds | ANVRFNHMLIDYKDFRNALLASEYGAGNEPLYKLNANIFQVFVSIWF* |
Ga0068871_1003527951 | 3300006358 | Miscanthus Rhizosphere | HYAHLMIDYADFRNALLADQYGAGNEPLYKLNANVLTAFFSIWY* |
Ga0066665_100596981 | 3300006796 | Soil | HLMIDYSDYRNALLAGTYGAGNEPLYKLNANIFQVFVSIWF* |
Ga0066660_112802521 | 3300006800 | Soil | NLRVDHLMIDYSDFRNALLAGTYGAGNEPLYKLNANIFQVFFSIWF* |
Ga0099793_102861211 | 3300007258 | Vadose Zone Soil | SKSSANVRVDHLLVDYSDFRNALLAGTYGAGNEPLYKLNANIFQVFVSIWF* |
Ga0105240_112668211 | 3300009093 | Corn Rhizosphere | YSDFRNALLDGSGYTVGNEPLYKLNANVIQAFVSVWF* |
Ga0066709_1008911501 | 3300009137 | Grasslands Soil | DFRNALLAGTYGAGNEPLYKLNANIFQVFVSIWF* |
Ga0114951_101353561 | 3300009502 | Freshwater | DDFRDATQAQTYGAGNEPLYKYNANVVQAFLTVWF* |
Ga0126384_118290411 | 3300010046 | Tropical Forest Soil | RMRVDYKDFRDALLAARYGAGNEPLYKLDANVLEAFLSIWY* |
Ga0134067_101655581 | 3300010321 | Grasslands Soil | LLVDYSDFRNALLAGTYGAGNEPLYELNANIFQVFVSIWF* |
Ga0126372_110195671 | 3300010360 | Tropical Forest Soil | HLFIDYKDFRNALLAGEYGAGNEPLYKLNANIFQVFVSIWF* |
Ga0105239_126698012 | 3300010375 | Corn Rhizosphere | LLIDYKDYRNALLTGTSGYTAGNEPLYKLNANVVQLYGTLWF* |
Ga0134124_129046431 | 3300010397 | Terrestrial Soil | YRNALLIGANPAWSAGNEPLYKLNANILQAFWSVWF* |
Ga0137380_105924481 | 3300012206 | Vadose Zone Soil | SINLRVDHLMIDYGDFRNALLAGTYGAGNEPLYKLNANIFQVFFSIWF* |
Ga0137385_102423221 | 3300012359 | Vadose Zone Soil | YKDYRNALLTGTSPQFTTGNEPLYKLNANIFQVFASIWF* |
Ga0137385_110993701 | 3300012359 | Vadose Zone Soil | LMIDYRDFRNALLAGTYGAGNEPLYKLNANIFQVFFSIWF* |
Ga0137358_103736191 | 3300012582 | Vadose Zone Soil | SSANVRVDHLLVDYSDFRNALLAGTYGAGNEPLYKLNANIFQVFVSIWF* |
Ga0137398_104484801 | 3300012683 | Vadose Zone Soil | NVRVDHLLVDYSDFRNALLAGTYGAGNEPLYKLNANIFQVFVSLWF* |
Ga0137359_116691992 | 3300012923 | Vadose Zone Soil | ISKSSANVRVDHLLVDYSDFRNALLAGTYGAGNEPLYKLNANIFQVFVSIWF* |
Ga0137419_103601561 | 3300012925 | Vadose Zone Soil | LMIDYGDFRNALLAGTYGAGNEPLYKLNANIFQLFLSIWF* |
Ga0137416_104687601 | 3300012927 | Vadose Zone Soil | KDYRNALLTGTSPEFTAGNEPLYKLNANIFQVFASIWF* |
Ga0137404_109014111 | 3300012929 | Vadose Zone Soil | VRVDHLLVDYRDFRNALLAGTYGAGNEPLYKLNANIFQVFVSIWF* |
Ga0137410_106668552 | 3300012944 | Vadose Zone Soil | NKSSLSIRLDHLLINYKDYRNALLTGTTPEFTAGNEPLYKLNANIFQVFASIWF* |
Ga0134110_102400171 | 3300012975 | Grasslands Soil | DHLMIDYSDFRNALLAGTYGAGNEPLYKLNANIFQVFVSIWF* |
Ga0181525_107781562 | 3300014654 | Bog | LAKYSDFRDALLAPEYGAGNEPLYQLNANVFTMFLSVWY* |
Ga0132258_127226311 | 3300015371 | Arabidopsis Rhizosphere | VRFDHLFIDYKDFRNALLASQYGAGNEPLYKLNANIFQVFVSIWF* |
Ga0182033_104571341 | 3300016319 | Soil | RYDHLFIDYKDFRNALLAGEYGAGNEPLYKLDANIFQIFVSIWF |
Ga0187783_105236982 | 3300017970 | Tropical Peatland | VDYSDFRNALLAGVYGAGKEPLYVLNANIFQLFVSIWY |
Ga0187783_107391502 | 3300017970 | Tropical Peatland | FEHLLVKYSDFRNALLASEYGAGNEPLYVLNANIAQIYISIWY |
Ga0187783_113188131 | 3300017970 | Tropical Peatland | PWISRSTANVALDHLLVKYSDFRNALLAGEYGAGNEPLYVLNANIFQVFVSTWF |
Ga0187777_113066522 | 3300017974 | Tropical Peatland | DHLLIDYKDFRNALLAGEYGAGNEPLYKLNANIFQIFVSIWF |
Ga0187782_111404511 | 3300017975 | Tropical Peatland | RMMISYKDFRDALLAAQYGAGNEPLYKLDANVLEAFLSLWY |
Ga0187766_114066832 | 3300018058 | Tropical Peatland | DYKDFRDALLAAQYGAGNEPLYKLDANVLEAFLSIWY |
Ga0066667_112203672 | 3300018433 | Grasslands Soil | IDYSDFRNALLAGTYGAGNEPLYKLNANIFQVFVSIWF |
Ga0210399_107865561 | 3300020581 | Soil | LLVDYSDFRNALLAGTYGAGNEPLYKLNANIFQVFVSIWF |
Ga0210384_112015121 | 3300021432 | Soil | VDHLLVDYSDFRNALLAGTYGAGNEPLYKLNANIFQVFVSIWF |
Ga0210392_105398532 | 3300021475 | Soil | LLVDYKDFRNALLIGANPDWSAGNEPLYKLNANILQAYLSVWF |
Ga0210409_112209671 | 3300021559 | Soil | YSDLRNALLAPEYGAGNEPLYKLNANVYTILLSIWY |
Ga0126371_118071041 | 3300021560 | Tropical Forest Soil | FDHLFIDYKDFRNALLAGEYGAGNEPLYKLNANIFQVFVSIWF |
Ga0126371_118392951 | 3300021560 | Tropical Forest Soil | KYSDYRNALLASEYGAGNEPLYVLNANIFQVFVSIWF |
Ga0126371_138664452 | 3300021560 | Tropical Forest Soil | SKSTFNVRYDRMMIAYKDFRDALLAAQYGAGGEPLYKLDANVLEAYLSLWY |
Ga0247780_10409342 | 3300023265 | Plant Litter | YKDYRNALLIGANPDWSAGNEPLYKLNANILQLFWSIWF |
Ga0209083_10812043 | 3300025162 | Freshwater | DDFRDATQAQTYGAGNEPLYKYNANVVQAFLTVWF |
Ga0207699_101726671 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | DFRNALLAGNGTYTAGNEPLYKLNANVLQLFWSLWF |
Ga0207671_102308783 | 3300025914 | Corn Rhizosphere | KDYRNALLIGANPDWTAGNEPLYKLNANILQAFISVWF |
Ga0207671_115200461 | 3300025914 | Corn Rhizosphere | NRSTFTLRYDHLLIDYKDFRNALLIGANPDWSAGNEPLYKLNVNILQAYLSVWF |
Ga0207663_103408531 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | HLMIDYADFRNALLADQYGAGNEPLYKLNANVLTAFFSIWY |
Ga0207700_102801031 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | DYKDFRNALLAGEYGAGNEPLYKLNANIFQIFVSIWF |
Ga0207664_101774351 | 3300025929 | Agricultural Soil | SDFRNALLAGEFGAGDEPLYKLNANIFQLFVSIWF |
Ga0207704_100580983 | 3300025938 | Miscanthus Rhizosphere | YAHLMIDYADFRNALLADQYGAGNEPLYKLNANVLTAFFSIWY |
Ga0207665_110172272 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | EHFLADYNDFRNALLAPEYGAGNEPLYKLNANVFTVQVSAWY |
Ga0207641_108353941 | 3300026088 | Switchgrass Rhizosphere | VHYAHLMIDYADFRNALLADQYGAGNEPLYKLNANVLTAFFSIWY |
Ga0209153_10062201 | 3300026312 | Soil | KNSINVRVDHLLVDYSDFRNALLAGTYGAGNEPLYKLNANIFQVFVSIWF |
Ga0257155_10441001 | 3300026481 | Soil | IDYGDFRNALLAGTYGAGNEPLYKLNANVFQVFLSIWF |
Ga0209059_100018924 | 3300026527 | Soil | LVDYSDFRNALLAGTYGAGNEPLYKLNANIFQVFVSIWF |
Ga0209648_104562712 | 3300026551 | Grasslands Soil | VRVDHLLVDYSDFRNALLAGTYGAGNEPLYKLNANIFQVFVSIWF |
Ga0209524_10353831 | 3300027521 | Forest Soil | DHLLVDYSDFRNALLAGSYGPGNEPLYKLNANIFQVFVSIWF |
Ga0209220_10185753 | 3300027587 | Forest Soil | MVDYSDFRNALLAGTYGAGNEPLYKLNANIFQVFVSIWF |
Ga0209217_11146902 | 3300027651 | Forest Soil | RLDHLLIDYKDFRNALLTGTAPGFTAGNEPLYKLNATIFQAFVSVWF |
Ga0207826_10670572 | 3300027680 | Tropical Forest Soil | YDRMMIDYKDFRNALLAAQYGAGNEPLYKLDANILEAWFSIYF |
Ga0208991_10773081 | 3300027681 | Forest Soil | KDFRNALLTGTAPGFTAGNEPLYKLNATIFQGFVSVWF |
Ga0209274_106863031 | 3300027853 | Soil | RADHLLIDYSDYRDALLAEEDGPGREPLYKLNANIFQVFVSIWY |
Ga0308309_103273013 | 3300028906 | Soil | NALYSLDGVAGYTAGNEPLYKLDANIFQLFVSIWF |
Ga0170824_1080434941 | 3300031231 | Forest Soil | NDFRNALLAAQYGAGNEPLYKLNANVFTVFLSIWY |
Ga0318534_104336682 | 3300031544 | Soil | RFDHLFIDYKDFRNALLAGEYGAGNEPLYKLNANIFQVFVSIWF |
Ga0318572_104734351 | 3300031681 | Soil | VRYNRLFIDYKDFRNALLAGEYGAGNEPLYKLNANIFQVFVSIWF |
Ga0307476_105168771 | 3300031715 | Hardwood Forest Soil | YRNALLIGTNPAYTAGNEPLYKLNANILQLFASLYF |
Ga0318493_102110721 | 3300031723 | Soil | NVRFDHLFIDYKDFRNALLASEYGAGNEPLYKLNANIFQVFVSIWF |
Ga0306918_103177761 | 3300031744 | Soil | YKDFRNALLANEYGAGNEPLYKLNANIFQIFVSIWF |
Ga0318554_100344261 | 3300031765 | Soil | VRYDHLFIDYKDFRNALLAGEYGAGNEPLYKLNANIFQLFVSIWF |
Ga0318509_105827991 | 3300031768 | Soil | ANVRYDHLFIDYKDFRNALLAGEYGAGNEPLYKLNANIFQVFVSIWF |
Ga0318546_103491672 | 3300031771 | Soil | NVRFDHLFIDYKDFRNALLAGEYGAGNEPLYKLNANIFQLFVSIWF |
Ga0318566_102425372 | 3300031779 | Soil | NVRFDHLLIDYKDFRNALLAGEYGAGNEPLYKLNANIFQLFVSIWF |
Ga0318547_106055242 | 3300031781 | Soil | LFIDYKDFRNALLASEYGAGNEPLYKLNANIFQVFVSIWF |
Ga0318529_103166752 | 3300031792 | Soil | YNHLMIDYKDFRNALLASEYGAGNEPLYKLNANIFQVFVSIWF |
Ga0318568_102196382 | 3300031819 | Soil | IDYKDFRNALLASEYGAGNEPLYKLNANIFQVFVSIWF |
Ga0307473_108854301 | 3300031820 | Hardwood Forest Soil | MMVDYKDFRDALLAARYGAGNEPLYKLDANVLEAFLSIWY |
Ga0318527_103705822 | 3300031859 | Soil | RYDHLFIDYKDFRNALLAGEYGAGNEPLYKLNANIFQVFVSIWF |
Ga0318551_106634001 | 3300031896 | Soil | DYKDFRNALLAGEYGAGNEPLYKLNANIFQLFVSIWF |
Ga0318520_106352282 | 3300031897 | Soil | KDFRNALLASEYGAGNEPLYKLNANIFQVFVSIWF |
Ga0310916_113266002 | 3300031942 | Soil | DHLFIDYKDFRNALLASEYGAGNEPLYKLNANIFQVFVSIWF |
Ga0307479_119166981 | 3300031962 | Hardwood Forest Soil | ANVRFDHLFIDYKDFRNALLAGEYGAGNEPLYKLNANIFQIFVSIWF |
Ga0318531_102841302 | 3300031981 | Soil | YKDFRNALLAGEYGAGNEPLYKLNANIFQLFVSIWF |
Ga0318569_105374611 | 3300032010 | Soil | LRFDHMYIDYKDFRNALLASEYGAGNEPFYKLNANIFQAFVSIWF |
Ga0318559_102155691 | 3300032039 | Soil | LLIDYKDFRNALLANEYGAGNEPLYKLNANIFQIFVSIWF |
Ga0318570_104238592 | 3300032054 | Soil | FIDYKDFRNALLASEYGAGNEPLYKLNANIFQVFVSIWF |
Ga0318510_100349193 | 3300032064 | Soil | HLFIDYKDFRNALLANEYGAGNEPLYKLNANIFQIFVSIWF |
Ga0307472_1002664701 | 3300032205 | Hardwood Forest Soil | DYSDFRNALLAGTYGAGNEPLYKLNANIFQMFVSIWF |
Ga0307472_1017474941 | 3300032205 | Hardwood Forest Soil | NIQLEHFLADYNDFRNALLAPEYGAGNEPLYKLNANVFTVQVSAWY |
Ga0335070_114921242 | 3300032829 | Soil | LYIDYKDFRNALLASEYGAGNEPLYKLNANIFQVFVSIWF |
Ga0335077_108769101 | 3300033158 | Soil | MMIDYKDFRDALLAAQYGAGNEPLYKLDANVLEAFLSIWY |
⦗Top⦘ |