 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F090765 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 108 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MANEGTIRIHRSIGGTGAAFRVTFVPYGGEGEEAAVAGERSFHE |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 108 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 99.07 % |
| % of genes near scaffold ends (potentially truncated) | 96.30 % |
| % of genes from short scaffolds (< 2000 bps) | 93.52 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (87.963 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (29.630 % of family members) |
| Environment Ontology (ENVO) | Unclassified (46.296 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (70.370 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 38.64% Coil/Unstructured: 61.36% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 108 Family Scaffolds |
|---|---|---|
| PF00266 | Aminotran_5 | 93.52 |
| PF02082 | Rrf2 | 2.78 |
| PF00012 | HSP70 | 0.93 |
| PF01592 | NifU_N | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
|---|---|---|---|
| COG0640 | DNA-binding transcriptional regulator, ArsR family | Transcription [K] | 2.78 |
| COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 2.78 |
| COG1725 | DNA-binding transcriptional regulator YhcF, GntR family | Transcription [K] | 2.78 |
| COG1959 | DNA-binding transcriptional regulator, IscR family | Transcription [K] | 2.78 |
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 2.78 |
| COG2188 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 2.78 |
| COG2378 | Predicted DNA-binding transcriptional regulator YobV, contains HTH and WYL domains | Transcription [K] | 2.78 |
| COG2524 | Predicted transcriptional regulator, contains C-terminal CBS domains | Transcription [K] | 2.78 |
| COG0443 | Molecular chaperone DnaK (HSP70) | Posttranslational modification, protein turnover, chaperones [O] | 0.93 |
| COG0822 | Fe-S cluster assembly scaffold protein IscU, NifU family | Posttranslational modification, protein turnover, chaperones [O] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 87.96 % |
| All Organisms | root | All Organisms | 12.04 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 29.63% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 12.96% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.11% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.63% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.70% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.70% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.78% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.85% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.85% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.85% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.85% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.93% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.93% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.93% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.93% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.93% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.93% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300001664 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - 5cm_reassembled | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300003223 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 | Environmental | Open in IMG/M |
| 3300004100 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF244 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004101 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF228 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004102 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF212 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004120 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF238 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004132 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF240 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004133 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF220 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004559 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010856 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010895 | Grasslands soil microbial communities from Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012169 | Attine ant fungus gardens microbial communities from North Carolina, USA - TSNC074 MetaG | Host-Associated | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012395 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300019182 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZE1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019251 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022498 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022512 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022530 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022712 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026214 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026376 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-B | Environmental | Open in IMG/M |
| 3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300027439 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027537 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300030597 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE046SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12630J15595_100313552 | 3300001545 | Forest Soil | MANEGTIRIHRSIGGTGAAFRVTFVPYGGEGEDAAAAGERSFH |
| P5cmW16_10460581 | 3300001664 | Permafrost | MASEGTIRIHRSIGGTGAAFRVTFVPYGGEGEDAPAAGERSFHELQQVRAFLKLI |
| JGIcombinedJ26739_1011399422 | 3300002245 | Forest Soil | MANEGTIRIHRLIGGAGAAFRVSFVPYDSDGEGTAGVRSFHEVQ |
| JGI25616J43925_103749241 | 3300002917 | Grasslands Soil | MANEGTIRIHRSIGGTGAAFRVTFVPYGGEGEEAAVAGERSFHELQQVRAFLKM |
| JGI26343J46809_10008291 | 3300003223 | Bog Forest Soil | MANEGTIRIHRSIGGTGAAFRVTFVPYEEGEEAPAAGERSFHELQQ |
| Ga0058904_14399153 | 3300004100 | Forest Soil | MAIDGTIRIHRSIGGTGAAFRVSFVPYDTDGETTASVRSFHEVQ |
| Ga0058904_14495992 | 3300004100 | Forest Soil | MANEGTIRIHRSIGGTGAAFRVTFVPYGGEGEEAAVAGERSFHELQQV |
| Ga0058896_14503932 | 3300004101 | Forest Soil | MANEGTIRIHRSIGGTGAAFRVTFVPYGGEGEEAAVAGERSFH |
| Ga0058888_14231452 | 3300004102 | Forest Soil | MANEGTIRIHRSIGGTGAAFRVTFVPYGGEGEEAAVAGERSFHELQ |
| Ga0058901_15777971 | 3300004120 | Forest Soil | MANEGTIRIHRSIGGTGAAFRVTFVPYGGEGEEAAVAGERS |
| Ga0058902_12271982 | 3300004132 | Forest Soil | MANEGTIRIHRSIGGTGAAFRVTFVPYGGEGEEAAVAGERSFHE |
| Ga0058892_13135332 | 3300004133 | Forest Soil | MANEGTIRIHRSIGGTGAAFRVTFVPYEEGEEAPAAGERSFHELQQVRAFLKMLG |
| Ga0068942_11676792 | 3300004559 | Peatlands Soil | MASEGTIRIHRSIGGTGAAFRVTFVPYGGEGEEAAVAGERSF |
| Ga0058899_120998611 | 3300004631 | Forest Soil | MANEGTIRIHRSIGGTGAAFRVTFVPYGGEGEDAAVAGERSFHELQQVRAFLKM |
| Ga0070699_1018351142 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MAIDGTIRIHRSIGGTGAAFRVSFVPYDTDGETTASVRSFHE |
| Ga0070734_100234085 | 3300005533 | Surface Soil | MANEGTIRIHRSIGGVGAAFRVSFVPYDSDGEGVAGVRSFHEVQQ |
| Ga0066701_101399061 | 3300005552 | Soil | MANEGTIRIHRSIGGTGAAFRVAFVPYDGEKEDAAGGERSFRELQ |
| Ga0066903_1026287382 | 3300005764 | Tropical Forest Soil | MANEGTIRIHRSIGGTGAAFRVTFVPYDAEAEDSGGERT |
| Ga0080026_102009082 | 3300005952 | Permafrost Soil | MANEGTIRIHRSIGGTGAAFRVTFVPYGGEGEDAPAAGERSFHELQQVRA |
| Ga0075015_1006582252 | 3300006102 | Watersheds | MANEGTIRIHRSIGGSGAAFRVTFVPYGGEGEEAAVAGERSFHELQQV |
| Ga0070716_1014770562 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MANEGTIRIHRSIGGTGAAFRVTFVPYEEGEEAPA |
| Ga0079222_119627372 | 3300006755 | Agricultural Soil | MANEGTIRIHRSIGGTGAAFRVTFVPYEEGEEASAAGERSFHELQ |
| Ga0099829_104163812 | 3300009038 | Vadose Zone Soil | MANEGTIRIHRSIGGTGAAFRVTFVPYNDGEESAAAGERSFHEL |
| Ga0099792_104915312 | 3300009143 | Vadose Zone Soil | MANEGTIRIHRSIGGTGAAFRVTFVPYGGEGEDAASAGERSFHEL |
| Ga0116214_11312891 | 3300009520 | Peatlands Soil | MASEGTIRIHRSIGGTGAAFRVTFMPYGGEGEEAAVAGERSFHE |
| Ga0134062_101279992 | 3300010337 | Grasslands Soil | MANEGTIRIHRSIAGTGAAFRVSFVPYDAEEESGGERSFRE |
| Ga0134062_103988912 | 3300010337 | Grasslands Soil | MANEGTIRIHRSIAGTGAAFRVAFVPYDAEAEEGGERSF |
| Ga0126370_107612263 | 3300010358 | Tropical Forest Soil | MANEGTIRIHRSIDGTGATFRVTFVPYDAEAENSGG |
| Ga0126378_121045972 | 3300010361 | Tropical Forest Soil | MANEGTIRIHRSIGGTGAAFRVTFVPYDEEEDGAGERTFRELQQVRAFL |
| Ga0126378_125389892 | 3300010361 | Tropical Forest Soil | MPNEGTIRIHRSIGGTGAAFRVTFVPYDAEEESGGERTFRE |
| Ga0126377_125292922 | 3300010362 | Tropical Forest Soil | MAANEGTIRIHRSIAGTGATFRVSFVPYDSEEESGGERSFRE |
| Ga0126377_129194181 | 3300010362 | Tropical Forest Soil | MANEGTIRIHRSIGGVGAAFRVSFVPYDSDDQGTAGVRSFHEVQQVRT |
| Ga0105239_135851312 | 3300010375 | Corn Rhizosphere | MANDGTIRIHRSIAGSGAAFRVTFVPYDSDDQGVAGVRSF |
| Ga0126358_10199612 | 3300010856 | Boreal Forest Soil | MTIEGTIRIHRSIGGTGAAFRVSFVPYDADGESTAG |
| Ga0126358_10681352 | 3300010856 | Boreal Forest Soil | MANEGTIRIHRLIGGAGAAFRVSFVPYDSDGEGTAGVRSFHEVQQ |
| Ga0138113_1318951 | 3300010895 | Grasslands Soil | MANEGTIRIHRSIAGTGAAFRVSFVPYDAEEESGGERSF |
| Ga0137389_104113511 | 3300012096 | Vadose Zone Soil | MANEGTIRIHRSIGGTGAAFRVAFVPYDSDGEGIASMRSFHE |
| Ga0153990_10540472 | 3300012169 | Attine Ant Fungus Gardens | MAIEGTIRIHRSIGGTGAAFRVSFVPYDTDGESTASV |
| Ga0137363_116532612 | 3300012202 | Vadose Zone Soil | MANEGTIRIHRSIGGTGAAFRVTFVPYGGEGEDAASAGER |
| Ga0137361_105423612 | 3300012362 | Vadose Zone Soil | MAIEGTIRIHRSIGGTGAAFRVSFVPYDTDGESTAAVRSFHEVQQVR |
| Ga0137361_106666941 | 3300012362 | Vadose Zone Soil | MANEGTIRIHRSIGGTGAAFRVTFVPYGGEGEDAASAGE |
| Ga0134044_11642631 | 3300012395 | Grasslands Soil | MANEGTIRIHRSIAGTTAAFRVSFVPYDAEEESGGERSFRELQQVRA |
| Ga0137396_111362081 | 3300012918 | Vadose Zone Soil | MAIEGTIRIHRSIGGTGAAFRVSFVPYDTDGESTAAVRSFHE |
| Ga0137420_13805487 | 3300015054 | Vadose Zone Soil | MANEGTIRIHRSIGGTGAAFRVTFVPYGGEGEEAASPAERSFHELQAKCAPF* |
| Ga0137409_109390071 | 3300015245 | Vadose Zone Soil | MANEGTIRIHRLIGGNGAAFRVSFVPYDSDGEGTAGV |
| Ga0187779_109193781 | 3300017959 | Tropical Peatland | MANEGTIRIHRSIGGTGAAFRVTFVPYGGEGEEAAVAGERSFHELQQ |
| Ga0184598_1018512 | 3300019182 | Soil | MANEGTIRIHRSIGGTGAAFRVTFVPYEEGEEAPAAGERSF |
| Ga0187795_11679172 | 3300019251 | Peatland | MANEGTIRIHRSIGGTGAAFRVTFVPYDGEGEEAAGGERSF |
| Ga0187797_12311331 | 3300019284 | Peatland | MANEGTIRIHRSIGGTGAAFRVSFVPYDGEGEEAAGGERSFNE |
| Ga0137408_14390534 | 3300019789 | Vadose Zone Soil | MANEGTIRIHRSIGGTGAAFRVTFVPYGGEGEDAASAGERSFHELQQVRAF |
| Ga0193724_10867552 | 3300020062 | Soil | MASEGTIRIHRSIGGTGAAFRVTFVPYGGEGEDAPAAGERS |
| Ga0210407_101064363 | 3300020579 | Soil | MAIEGTIRIHRSIGGTGAAFRVSFVPYDTDGESTASVRSF |
| Ga0210407_104259591 | 3300020579 | Soil | MANEGTIRIHRSIGGTGAAFRVTFVPYGGEGEEAAVAG |
| Ga0210407_107530371 | 3300020579 | Soil | MANEGTIRIHRSIGGTGAAFRVTFVPYGGEGEEAAVA |
| Ga0210399_101235653 | 3300020581 | Soil | MANEGTIRIHRSIGGTGAAFRVTFVPYGGEGEEAAVAGE |
| Ga0210399_112877481 | 3300020581 | Soil | MANEGTIRIHRSIGGTGAAFRVTFVPYEEGEEAPAAGERSFHELQQVRAFLKMLGV |
| Ga0210395_109926981 | 3300020582 | Soil | MANEGTIRIHRSIGGTGAAFRVTFVPYEEGEEAPAAGERSFHELQQVRAFLK |
| Ga0210406_100761634 | 3300021168 | Soil | MANEGTIRIHRSIGGTGAAFRVTFVPYEEGEEAPAAGERS |
| Ga0210400_105796912 | 3300021170 | Soil | MAIEGTIRIHRSIGGTGAAFRVSFVPYDTDGESTAS |
| Ga0210393_102208872 | 3300021401 | Soil | MANEGTIRIHRSIGGTGAAFRVTFVPYEEGEEAPAAGERSFHELQQVRAFL |
| Ga0210397_108343462 | 3300021403 | Soil | MANEGTIRIHRSIGGVGAAFRVSFVPYDSDGEGTAGVRS |
| Ga0210389_109230911 | 3300021404 | Soil | MANEGTIRIHRSIGGTGAAFRVTFVPYGGEGEDAAAAGERSFHELQQVRA |
| Ga0210391_100366325 | 3300021433 | Soil | MANEGTIRIHRSIGGTGAAFRVTFVPYEEGEEAPAAGERSFHELQQVRAFLKML |
| Ga0210402_115555512 | 3300021478 | Soil | MANEGTIRIHRSIGGTGAAFRVTFVPYEEGEEAPAAGERSFHELQQVRAF |
| Ga0210410_108239412 | 3300021479 | Soil | MANEGTIRIHRSIGGTGAAFRVTFVPYEEGEEAPAAGERSFHELQQV |
| Ga0210410_109878242 | 3300021479 | Soil | MANEGTIRIHRSIGGTGAAFRVTFVPYEEGEEAPAAGER |
| Ga0242644_10177852 | 3300022498 | Soil | MANEGTIRIHRSIGGTGAAFRVTFVPYEEGEEATAAGERSL |
| Ga0242676_10541952 | 3300022512 | Soil | MANEGTIRIHRSIGGTGAAFRVTFVPYEEGEEAPAAGERSFHELQQVRAFLKMLGVGA |
| Ga0242658_11049481 | 3300022530 | Soil | MANEGTIRIHRSIGGTGAAFRVTFVPYGGEGEDAAAAGERSFHELQQVRAFL |
| Ga0242658_11969701 | 3300022530 | Soil | MANEGTIRIHRSIGGVGAAFRVSFVPYDSDGEGVAGV |
| Ga0242662_100600351 | 3300022533 | Soil | MANEGTIRIHRSIGGTGAAFRVTFVPYGGEGEEAAVAGERSF |
| Ga0242653_10830982 | 3300022712 | Soil | MANEGTIRIHRSIGGTGAAFRVTFVPYEEGEEAPAAGERSFHELQQVRAFLKMLGVGAEF |
| Ga0242661_11345312 | 3300022717 | Soil | MANEGTIRIHRSIGGTGAAFRVTFVPYGGEGEEAAVAGER |
| Ga0242657_12258142 | 3300022722 | Soil | MANEGIIRIHRSIGGIGAAFRVTFVPYEEGEEAPAAGERSFHEL |
| Ga0242657_12332062 | 3300022722 | Soil | MANEGTIRIHRSIGGTGAAFRVTFVPYGGEGEEAAVAGERSFHELQQVRAFLKL |
| Ga0242665_101180301 | 3300022724 | Soil | MANEGTIRIHRLIGGNGAAFRVSFVPYDSDGEGTAGVRSCHEVQQVRT |
| Ga0207680_111324722 | 3300025903 | Switchgrass Rhizosphere | MANDGTIRIHRSIAGSGAAFRVTFVPYDSDDQGVAGVRSFHEAQQVRAFLK |
| Ga0207665_108910821 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MANEGTILIHRSIGGVGAAFRVSFVPYDSDGEGTAGVRAFHEV |
| Ga0209838_10302511 | 3300026214 | Soil | MANEGTIRIHRSIGGTGAAFRVTFVPYGGEGEDAPAAGERSFHELQQVRAFLK |
| Ga0209234_10773631 | 3300026295 | Grasslands Soil | MANEGTIRIHRSIGGTGAAFRVTFVPYGGEGEEAAVAGERSFHEL |
| Ga0209469_11149871 | 3300026307 | Soil | MANEGTIRIHRSIGGTGAAFRVTFVPYGGEGEEAAVAGERSFHELQQVRAFL |
| Ga0209055_10837592 | 3300026309 | Soil | MANEGTIRIHRSIGGTGAAFRVTFVPYGGEGEEAAVAGERSFHELQQVRAF |
| Ga0257167_10109581 | 3300026376 | Soil | MANEGTIRIHRSIGGTGAAFRVTFVPYGGEGEEAAVAGERSFHELQQVRAFLK |
| Ga0257181_10184982 | 3300026499 | Soil | MAIEGTIRIHRSIGGTGAAFRVSFVPYDNDGESTAAV |
| Ga0209160_11645942 | 3300026532 | Soil | MANEGTIRIHRSIGGTGAAFRVTFVPYGGEGEEAAVAGERSFHELQQVRA |
| Ga0209332_10183841 | 3300027439 | Forest Soil | MANEGTIRIHRSIGGTGAAFRVTFVPYGGEGEDAPAAGERSFHELQQVRAFLKLLGVG |
| Ga0209419_10304141 | 3300027537 | Forest Soil | MANEGTIRIHRSIGGTGAAFRVTFVPYGGEGEDAAAA |
| Ga0209076_10362861 | 3300027643 | Vadose Zone Soil | MAIEGTIRIHRSIGGTGAAFRVSFVPYDTDGESTAA |
| Ga0209656_104742181 | 3300027812 | Bog Forest Soil | MANEGTIRIHRSIGGTGAAFRVTFVPYTEGEDAAAAGERSFHELQQVRAFLKMLGVG |
| Ga0209180_100869681 | 3300027846 | Vadose Zone Soil | MANEGTIRIHRSIGGTGAAFRVTFVPYGGEGEEAA |
| Ga0209693_102588721 | 3300027855 | Soil | MANEGTIRIHRSIGGTGAAFRVTFVPYGGEGEEAAVAGERSFHELQQVR |
| Ga0209465_103334321 | 3300027874 | Tropical Forest Soil | MANEGTIRIHRSIAGTGAAFRVSFVPYDSEEESGGE |
| Ga0209624_106638952 | 3300027895 | Forest Soil | MANEGTIRIHRSIGGVGAAFRVSFVPYDSDGEGTA |
| Ga0209526_106323542 | 3300028047 | Forest Soil | MAIEGTIRIHRSIGGTGAAFRVSFVPYDADGESTAG |
| Ga0210286_10044242 | 3300030597 | Soil | MANEGTIRIHRSIGGTGAAFRVTFVPYEEGEEAPAAGERSFHELQQKREKM |
| Ga0307482_10775232 | 3300030730 | Hardwood Forest Soil | MANEGTIRIHRSIGGVGAAFRVSFVPYDSDGEGVAGVRSFH |
| Ga0265766_10163142 | 3300030863 | Soil | MANEGTIRIHRSIGGTGAAFRVTFVPYEEGEEAPAAGERSFHELQ |
| Ga0073994_122764951 | 3300030991 | Soil | MANEGTIRIHRSIGGTGAAFRVTFVPYGGEGEDAVKQYL |
| Ga0318538_101845321 | 3300031546 | Soil | MANEGTIRIHRSIAGTGAAFRVTFVPYDTEGEEGGERSFRE |
| Ga0310686_1013029262 | 3300031708 | Soil | MVNEGTIRIHRSIGGTGAAFRVTFVPYEEGEEAPAA |
| Ga0307469_104758542 | 3300031720 | Hardwood Forest Soil | MANEGTIRIHRSIGGTGAAFRVTFVPYEEGEEAPAAGERSFHELQQVR |
| Ga0307468_1005381302 | 3300031740 | Hardwood Forest Soil | MANEGTIRIHRSIGGTGAAFRVTFVPYGGEGEDAAAAGERSFHE |
| Ga0307477_101160843 | 3300031753 | Hardwood Forest Soil | MAIEGTIRIHRSIGGTGAAFRVSFVPYDTDGESTAAVRSFHEVQQV |
| Ga0318543_101555501 | 3300031777 | Soil | MANEGTIRIHRSIAGTGAAFRVTFVPYDTEGEEGGERSFRELQQVRA |
| Ga0318557_102032631 | 3300031795 | Soil | MANEGTIRIHRSIAGTGAAFRVTFVPYDTEGEEGGE |
| Ga0307479_112712602 | 3300031962 | Hardwood Forest Soil | MANEGTIRIHRSIGGTGAAFRVSFVPYDSDGEGTA |
| Ga0348332_139710893 | 3300032515 | Plant Litter | MANEGTIRIHRSIGGTGAAFRVTFVPYEEGEEAPAAGERSFH |
| Ga0335083_103719082 | 3300032954 | Soil | MANEGTIRIHRSIGGIGAAFRVSFVPYDSDGEGTAGVRSFHE |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |