NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F090703

Metagenome / Metatranscriptome Family F090703

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F090703
Family Type Metagenome / Metatranscriptome
Number of Sequences 108
Average Sequence Length 41 residues
Representative Sequence RATTDKYGWLSAEDLEADERPAHPDIPDLIRKAVASVRAE
Number of Associated Samples 97
Number of Associated Scaffolds 108

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.85 %
% of genes near scaffold ends (potentially truncated) 98.15 %
% of genes from short scaffolds (< 2000 bps) 87.96 %
Associated GOLD sequencing projects 96
AlphaFold2 3D model prediction Yes
3D model pTM-score0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (73.148 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(17.593 % of family members)
Environment Ontology (ENVO) Unclassified
(23.148 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(56.481 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 25.00%    β-sheet: 0.00%    Coil/Unstructured: 75.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 108 Family Scaffolds
PF02625XdhC_CoxI 61.11
PF13478XdhC_C 21.30
PF00196GerE 4.63
PF04672Methyltransf_19 2.78
PF01522Polysacc_deac_1 1.85
PF12804NTP_transf_3 0.93
PF07179SseB 0.93
PF00218IGPS 0.93
PF11392DUF2877 0.93
PF01264Chorismate_synt 0.93
PF13401AAA_22 0.93
PF13581HATPase_c_2 0.93
PF01810LysE 0.93
PF01263Aldose_epim 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 108 Family Scaffolds
COG1975Molybdoenzyme maturation factor PaoD (Mo cofactor insertion), XdhC/CoxF familyPosttranslational modification, protein turnover, chaperones [O] 61.11
COG0726Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 familyCell wall/membrane/envelope biogenesis [M] 1.85
COG0082Chorismate synthaseAmino acid transport and metabolism [E] 0.93
COG0134Indole-3-glycerol phosphate synthaseAmino acid transport and metabolism [E] 0.93
COG0676D-hexose-6-phosphate mutarotaseCarbohydrate transport and metabolism [G] 0.93
COG2017Galactose mutarotase or related enzymeCarbohydrate transport and metabolism [G] 0.93


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms73.15 %
UnclassifiedrootN/A26.85 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003505|JGIcombinedJ51221_10448025All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia522Open in IMG/M
3300005332|Ga0066388_108783661All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia502Open in IMG/M
3300005363|Ga0008090_15827410All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia573Open in IMG/M
3300005764|Ga0066903_106900458All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia589Open in IMG/M
3300005921|Ga0070766_11153447All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia536Open in IMG/M
3300005921|Ga0070766_11317973Not Available500Open in IMG/M
3300006028|Ga0070717_10050068All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales3431Open in IMG/M
3300006057|Ga0075026_100424805All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia752Open in IMG/M
3300006175|Ga0070712_100646252Not Available898Open in IMG/M
3300006176|Ga0070765_102244201All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia509Open in IMG/M
3300006797|Ga0066659_10812575All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia774Open in IMG/M
3300006903|Ga0075426_11240897All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300006914|Ga0075436_101042711All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia614Open in IMG/M
3300009628|Ga0116125_1094032All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia796Open in IMG/M
3300009683|Ga0116224_10209090Not Available934Open in IMG/M
3300009764|Ga0116134_1074584All Organisms → cellular organisms → Bacteria → Terrabacteria group1255Open in IMG/M
3300010048|Ga0126373_12876155All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia537Open in IMG/M
3300010322|Ga0134084_10352435All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300010326|Ga0134065_10105795Not Available940Open in IMG/M
3300010358|Ga0126370_10627111All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia933Open in IMG/M
3300010359|Ga0126376_11543579All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia694Open in IMG/M
3300010856|Ga0126358_1247073All Organisms → cellular organisms → Bacteria → Terrabacteria group1352Open in IMG/M
3300010867|Ga0126347_1229187All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300010876|Ga0126361_10933932All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia619Open in IMG/M
3300011075|Ga0138555_1155288Not Available565Open in IMG/M
3300011077|Ga0138572_1049167Not Available848Open in IMG/M
3300011120|Ga0150983_10579010All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia629Open in IMG/M
3300011120|Ga0150983_10973957Not Available500Open in IMG/M
3300011120|Ga0150983_12663447Not Available995Open in IMG/M
3300011120|Ga0150983_13766054All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia642Open in IMG/M
3300012349|Ga0137387_10203870Not Available1421Open in IMG/M
3300012362|Ga0137361_11636199All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300012390|Ga0134054_1183573All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300012403|Ga0134049_1014844All Organisms → cellular organisms → Bacteria → Terrabacteria group1094Open in IMG/M
3300012481|Ga0157320_1000540All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1580Open in IMG/M
3300012944|Ga0137410_10141297All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp.1825Open in IMG/M
3300012987|Ga0164307_11793324All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300015372|Ga0132256_102440549All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia625Open in IMG/M
3300016422|Ga0182039_10730813Not Available875Open in IMG/M
3300017924|Ga0187820_1035485All Organisms → cellular organisms → Bacteria → Terrabacteria group1308Open in IMG/M
3300017937|Ga0187809_10312602All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300017942|Ga0187808_10132443Not Available1094Open in IMG/M
3300017955|Ga0187817_10079095All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales2054Open in IMG/M
3300017972|Ga0187781_10562198All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia821Open in IMG/M
3300018007|Ga0187805_10213456Not Available882Open in IMG/M
3300018033|Ga0187867_10742972All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300018035|Ga0187875_10347544All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia797Open in IMG/M
3300018037|Ga0187883_10585916All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300018058|Ga0187766_10018794All Organisms → cellular organisms → Bacteria3959Open in IMG/M
3300018058|Ga0187766_10346381Not Available972Open in IMG/M
3300018086|Ga0187769_11061055Not Available613Open in IMG/M
3300019883|Ga0193725_1036291Not Available1300Open in IMG/M
3300020581|Ga0210399_10786992All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia777Open in IMG/M
3300020581|Ga0210399_11369748Not Available554Open in IMG/M
3300021377|Ga0213874_10407570All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300021405|Ga0210387_11223102Not Available652Open in IMG/M
3300021474|Ga0210390_10079527All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales2716Open in IMG/M
3300021477|Ga0210398_10571193All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia919Open in IMG/M
3300022499|Ga0242641_1018329All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia691Open in IMG/M
3300022716|Ga0242673_1134219All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia507Open in IMG/M
3300022718|Ga0242675_1052714All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia686Open in IMG/M
3300022733|Ga0224562_1013708All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia652Open in IMG/M
3300024275|Ga0247674_1044755All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300025917|Ga0207660_10716532All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia816Open in IMG/M
3300026294|Ga0209839_10024759All Organisms → cellular organisms → Bacteria → Terrabacteria group2322Open in IMG/M
3300026377|Ga0257171_1049161All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia730Open in IMG/M
3300027047|Ga0208730_1018837Not Available775Open in IMG/M
3300027370|Ga0209010_1084681All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia540Open in IMG/M
3300027545|Ga0209008_1048588Not Available969Open in IMG/M
3300027680|Ga0207826_1053859Not Available1113Open in IMG/M
3300027846|Ga0209180_10136095Not Available1412Open in IMG/M
3300027869|Ga0209579_10416024All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300027889|Ga0209380_10747841Not Available558Open in IMG/M
3300028742|Ga0302220_10195074All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia756Open in IMG/M
3300028798|Ga0302222_10376005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia555Open in IMG/M
3300028806|Ga0302221_10271306All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia740Open in IMG/M
3300028877|Ga0302235_10004109All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales10037Open in IMG/M
3300028877|Ga0302235_10004551All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales9479Open in IMG/M
3300028880|Ga0307300_10250099All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia588Open in IMG/M
3300029943|Ga0311340_10023769All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae7611Open in IMG/M
3300029943|Ga0311340_10372464Not Available1324Open in IMG/M
3300029999|Ga0311339_10022036All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales9419Open in IMG/M
3300030007|Ga0311338_10420505All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1428Open in IMG/M
3300030007|Ga0311338_10482330Not Available1305Open in IMG/M
3300030490|Ga0302184_10301251All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia643Open in IMG/M
3300030520|Ga0311372_10267540All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura2745Open in IMG/M
3300030520|Ga0311372_12183322All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia638Open in IMG/M
3300030580|Ga0311355_11170639All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia680Open in IMG/M
3300030617|Ga0311356_10162857All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura2301Open in IMG/M
3300030738|Ga0265462_10157756All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae1159Open in IMG/M
3300031027|Ga0302308_10453399All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia761Open in IMG/M
3300031234|Ga0302325_11854253All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia752Open in IMG/M
3300031572|Ga0318515_10738927All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia520Open in IMG/M
3300031751|Ga0318494_10385523Not Available812Open in IMG/M
3300031751|Ga0318494_10582728All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia654Open in IMG/M
3300031912|Ga0306921_10147233All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales2754Open in IMG/M
3300032001|Ga0306922_10608407Not Available1157Open in IMG/M
3300032010|Ga0318569_10194496Not Available939Open in IMG/M
3300032039|Ga0318559_10481938Not Available579Open in IMG/M
3300032054|Ga0318570_10094082Not Available1302Open in IMG/M
3300032066|Ga0318514_10717873All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia532Open in IMG/M
3300032261|Ga0306920_100961819All Organisms → cellular organisms → Bacteria → Terrabacteria group1246Open in IMG/M
3300032515|Ga0348332_12498253All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia544Open in IMG/M
3300032896|Ga0335075_10817535All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria870Open in IMG/M
3300032954|Ga0335083_11124274All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia612Open in IMG/M
3300032955|Ga0335076_10532648All Organisms → cellular organisms → Bacteria → Terrabacteria group1057Open in IMG/M
3300033289|Ga0310914_10034588All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales4061Open in IMG/M
3300034124|Ga0370483_0313707All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia542Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil17.59%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa15.74%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil7.41%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment4.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.70%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.70%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.70%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.70%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.70%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.78%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.78%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.78%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.78%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.78%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil2.78%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland1.85%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.85%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.85%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.93%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.93%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.93%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.93%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.93%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.93%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.93%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.93%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006057Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300009628Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10EnvironmentalOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010856Boreal forest soil eukaryotic communities from Alaska, USA - W4-2 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010867Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011075Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 36 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011077Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 57 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012390Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012403Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012481Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610Host-AssociatedOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300019883Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021377Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7Host-AssociatedOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300022499Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022716Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022718Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022733Soil microbial communities from Bohemian Forest, Czech Republic ? CSU3EnvironmentalOpen in IMG/M
3300024275Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK15EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026294Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes)EnvironmentalOpen in IMG/M
3300026377Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-BEnvironmentalOpen in IMG/M
3300027047Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF042 (SPAdes)EnvironmentalOpen in IMG/M
3300027370Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027545Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027680Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300028742Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3EnvironmentalOpen in IMG/M
3300028798Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2EnvironmentalOpen in IMG/M
3300028806Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1EnvironmentalOpen in IMG/M
3300028877Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3EnvironmentalOpen in IMG/M
3300028880Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181EnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030490Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3EnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030617II_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030738Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assemblyEnvironmentalOpen in IMG/M
3300031027Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300034124Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGIcombinedJ51221_1044802513300003505Forest SoilWERATTDKYGWLSAEDLEADERPAHPDIPDLIRQAVASVRA*
Ga0066388_10878366123300005332Tropical Forest SoilERATTDKYGWLTAEDFEDGERPAHPDIPDLIRVAAARAGNRHRRE*
Ga0008090_1582741023300005363Tropical Rainforest SoilATTDKYGWLAAADLGADERPAHPDIPDLIRAAVASVRRE*
Ga0066903_10690045823300005764Tropical Forest SoilLWERATTDKYGWLTAEDLEAGEHPAHPELPDLIRAAVASVRRG*
Ga0070766_1115344723300005921SoilWERATTDKYGWLSAEDLGGDERPADPAIPDLMRAAAASVRDPRP*
Ga0070766_1131797313300005921SoilYGWLSADDLGPDMPPADPSLPGLIRAAAVSVRDRRSSGS*
Ga0070717_1005006843300006028Corn, Switchgrass And Miscanthus RhizosphereMDAWERATTDKYGWLTAEDLGGDERPADPDLPRLIRAAVASARNRRSRE*
Ga0075026_10042480513300006057WatershedsDKFGWLAVGDLSAGDPPAHPDIPDLIRAAAASVRHR*
Ga0070712_10064625223300006175Corn, Switchgrass And Miscanthus RhizosphereATTDKYGWLTAEDLETDERPADVGIPDIIRAAVASVGRDQAGE*
Ga0070765_10224420113300006176SoilTTDKYGWLSAEDLEADERPADPEIPDLIRKAVASVRAG*
Ga0066659_1081257513300006797SoilDQWERATTDKYGWVTADDLGADEHPAHPDIPDLMRAAAAAVGNQELR*
Ga0075426_1124089723300006903Populus RhizosphereLDQWERATTDKYGWLTADDLGADERPAHPDIPDLMRAAAAAVRPRE*
Ga0075436_10104271123300006914Populus RhizosphereKYGWLTAEDLEAGERPAHPDIPDLIRAAVASVRREQAGE*
Ga0116125_109403223300009628PeatlandYGWLSAEDLETDERPADPEIPDLIRKAVASVRAG*
Ga0116224_1020909023300009683Peatlands SoilWERATTDTYGWLTADELGPDKPPADPGLPDLMRAAAASLRDR*
Ga0116134_107458413300009764PeatlandYGWLTPADLEADERPAHPDIPDLIRTAAASVRHR*
Ga0126373_1287615513300010048Tropical Forest SoilTTDKYGWLSAGDLGPEMPPADPSLPGLIRAAAASVRDRQPWRL*
Ga0134084_1035243513300010322Grasslands SoilDKYGWLTAEDLEAGERPAHPGIPDLIRAAVASVRREQAGE*
Ga0134065_1010579513300010326Grasslands SoilTTDKYGWLTAEDLETGERPAHPDIPDLIRAAVASVRREQAGE*
Ga0126370_1062711123300010358Tropical Forest SoilERATTDKYGWLTAEDLEAGEHPAHSELPDLIRAAVASVRRE*
Ga0126376_1154357923300010359Tropical Forest SoilLDHWERATTDKYGWLTAEDLETDERPADAGIPDLIRAAVASVRRV*
Ga0126358_124707323300010856Boreal Forest SoilWERATTDKYGWLTAEDLEDGERPAHPDIPDLVRVAAASVRRE*
Ga0126347_122918723300010867Boreal Forest SoilDKYGWLAAAELEDGERPAHPDIPDLIRAAAASVLGE*
Ga0126361_1093393223300010876Boreal Forest SoilERATTDKYGWLSADDLGPDMPPADPSLPGLIRAAAASVRDRT*
Ga0138555_115528823300011075Peatlands SoilDWERATTDTYGWLTADDLAPDKPPADPGLPDLIRAAAASVRGRRRE*
Ga0138572_104916713300011077Peatlands SoilTDTYGWLTADDLGPDKPPADPGLPDLIRAAAASVRGRRRE*
Ga0150983_1057901013300011120Forest SoilRATTDKYGWLSAEDLEADERPADPEIPDLIRKAVASVRAG*
Ga0150983_1097395713300011120Forest SoilWERATTDKYGWLSAEDLEADERPAHPDIPDLIRKAVASVRA*
Ga0150983_1266344713300011120Forest SoilTDKYGWLTADDLGADERPAHPEIPDLMRAAAAAVGIRS*
Ga0150983_1376605413300011120Forest SoilTTDRYGWLSAEDLEADETPGHPEIPGLIRAAVASVRSRRP*
Ga0137387_1020387013300012349Vadose Zone SoilEQATTDKYGWLAATDFDADERPAHPDIPELMRAAAAAVRVRS*
Ga0137361_1163619913300012362Vadose Zone SoilKYGWIAAGDLGADERPAHPDIPDLIRAAAASVRR*
Ga0134054_118357323300012390Grasslands SoilYGWLTAEDLGTDERPAHPDIPDLMRAAVASVRREQAGE*
Ga0134049_101484413300012403Grasslands SoilPTDKYGWLTAEDLEAGERPAHPDIPELIRAAVASARNRHSREQPRE*
Ga0157320_100054033300012481Arabidopsis RhizosphereTDKYGWLTAEDLETDERPADVGIPDVIRAAVASVGRV*
Ga0137410_1014129733300012944Vadose Zone SoilERATTDKYGWLTADDLGVDERPAHPDIPDLMRAAAAAVGIRS*
Ga0164307_1179332423300012987SoilATTDKYGWLTAEDLGADERPAHPDIPDLMRAAAAAVRPRE*
Ga0132256_10244054913300015372Arabidopsis RhizosphereTDKYGWLTAEDLEAGERPAHPDIPNLIRAAVASVRREQAGE*
Ga0182039_1073081323300016422SoilDAYEWLSADDLGPDKPPADPSLPDLIRAAVASVRGRPR
Ga0187820_103548513300017924Freshwater SedimentAYGWLSADDLGPDKPPADPGLPDLIRAAVASVRGRPR
Ga0187809_1031260213300017937Freshwater SedimentQWERATTDTYGWLTADELGPDKPPADPSLPDLIRAAVASIRDRQP
Ga0187808_1013244313300017942Freshwater SedimentGWLSADDLGPDKPPADPSLPDLIRAAVASIRDRQP
Ga0187817_1007909533300017955Freshwater SedimentGLDQWERATTDKYGWLTAADLEADERPAHPDIPDLIRAAAASVRYR
Ga0187781_1056219823300017972Tropical PeatlandEQATTDKYGWLAAGDLGADERPAHPDIPDLIRAAAASVRRE
Ga0187805_1021345623300018007Freshwater SedimentERATTDKYGWLSADDLGPDQRPADPSLPDLIRAAAASVRDRGPERS
Ga0187867_1074297223300018033PeatlandKYGWLSAEDLEADERSAHPDIPDLIRKAVVSVRAE
Ga0187875_1034754423300018035PeatlandATTDKYGWLAAGELDGDERPAHPDIPDLMRVAAARVLGK
Ga0187883_1058591613300018037PeatlandTTDKYGWLTPADLEADERPAHPDIPDLIRTAAASVRHR
Ga0187766_1001879433300018058Tropical PeatlandDKYGWLSADDLGADEPPAHPDIPDLIRAAVASAGISPR
Ga0187766_1034638113300018058Tropical PeatlandDAYGWLSADDLGPDQPPADPGLPDLIRAAVAIVRDRPR
Ga0187769_1106105523300018086Tropical PeatlandDSWERATTDKYAWFSAEDLESGEPLADPDLPDLARSAVAAVRARPR
Ga0193725_103629123300019883SoilKYGWLTAEDLEAGERPAHPDIPDLIRAAVAIVRRDQAGE
Ga0210399_1078699213300020581SoilDKYAWLSADDLGPDMPPADPSLPGLIRAAAVSVRDRT
Ga0210399_1136974823300020581SoilSWERATTDKYGWLSADDLGPDMPPADPALPDLIRAAAASVRGGA
Ga0213874_1040757013300021377Plant RootsEQATTDKYGWLAAEDLGADERPAHPDIPDLIRAAAASVRRE
Ga0210387_1122310213300021405SoilASTDKYAWLSAEDFGPDERPADPDIPDLIRAAAAAVQARPR
Ga0210390_1007952753300021474SoilDAYGWLSADDLGPDKPPADPSLPDLIRAAVASIRDRQP
Ga0210398_1057119323300021477SoilTTDKFGWLAVGDLSADDPPAHPDIPDLIRAAAASVRHR
Ga0242641_101832913300022499SoilRATTDRYGWLSADDLGPDMPPADPSLPGLIRAAAVSVRNRT
Ga0242673_113421913300022716SoilLDQWERATTDRYGWLFAEDLEAGERPAHPDILDLIRKAVASVRAD
Ga0242675_105271413300022718SoilDKYGWLSADDLGPDMPPADPSLPGLIRAAAVSVHGRT
Ga0224562_101370823300022733SoilDKFGWLAVADLSADDPPAHPDIPDLIRAAAASVRHR
Ga0247674_104475513300024275SoilDKYAWLTAEDLETDERPADVGIPDIIRAAVASVGRA
Ga0207660_1071653213300025917Corn RhizosphereWERATTDKYAWLTAEDLETDERPADVGIPDIIRAAVASVGRA
Ga0209839_1002475913300026294SoilERATTDKYGWLSADELADGERSAHPDIPDLIRMAVLTVRNRPA
Ga0257171_104916113300026377SoilTTDKYGWLTAEDLEAGERPAHPDIPDLIRAAVASVRREQPRE
Ga0208730_101883713300027047Forest SoilRATTDAYGWLSADDLGPDMPPADPSLPGLIRAAVASVRGE
Ga0209010_108468113300027370Forest SoilTDTYGWLSADDLGPDHPPAEPGLPDLIRAAAASVCGRPGE
Ga0209008_104858823300027545Forest SoilDSWERATTDTYGWLSADDLGPDHPPADPGLPDLIRAAAASVRARRGE
Ga0207826_105385913300027680Tropical Forest SoilDAYGWLLADDLGPDKPPADPGLPDLIRAAVASVRDRRR
Ga0209180_1013609523300027846Vadose Zone SoilTTDKYGWLAAEDLEADERPAHPDIPELIRAAAASVREG
Ga0209579_1041602413300027869Surface SoilMDSWERATTDKYGWLSADDLGPDMPPADPSLPGLIRAAAASVRDRT
Ga0209380_1074784123300027889SoilSWERATTDKYGWLSADDLGPDMPPADPSLPDLIRAAAVSVRGRT
Ga0302220_1019507413300028742PalsaTDKYGWLSAEDLEADERPAHPDIPDLIRKAVASVRAE
Ga0302222_1037600513300028798PalsaQWEQATTDKYGWLSAEDLEADERPAHPDIPDLIRKAVASVRAE
Ga0302221_1027130623300028806PalsaDDWERATTDKYGWLSAEDLGGDERPADPAIPDLMRAAAASVLDRRP
Ga0302235_10004109123300028877PalsaEGLDQWERATTDKYGWLSAEDLEADERPAHPDIPDLIRKAVASVRAE
Ga0302235_10004551113300028877PalsaDKYGWLSAEDLEADERPAHPDIPDLIRKAVASVRAG
Ga0307300_1025009923300028880SoilKYGWLTAEDLETDERPADVGIPDIIRAAVASVGRDQAGE
Ga0311340_1002376913300029943PalsaQWERATTDKYGWLSAEDLEADERPAHPDIPDLIRKAVASVRAE
Ga0311340_1037246413300029943PalsaRATTDKYGWFCAADLENDEPPAHPDIPDLIRLAVASVLGRPA
Ga0311339_10022036113300029999PalsaQWERATTDKYGWLSAEDLEADERPAHPDIPDLIRKAVASVRAG
Ga0311338_1042050513300030007PalsaLDQWERATTDKYGWFCAADLENDEPPAHPDIPDLIRLAVASVLGRPA
Ga0311338_1048233023300030007PalsaGWFCAADLENDEPPAHPDIPDLIRLAVASVLGRPA
Ga0302184_1030125123300030490PalsaRATTDKYGWLSAEDLEADERPAHPDIPDLIRKAVASVRAE
Ga0311372_1026754013300030520PalsaERATTDKYGWLSAEDLEADERPAHPDIPDLIRKAVASVRAG
Ga0311372_1218332213300030520PalsaRATTDKYGWLSAEDLEAGERPADPEIPDLIRKAVASVRAG
Ga0311355_1117063923300030580PalsaERATTDKYGWLSAEDLEAGERPADPEIPDLIRKAVASVRAG
Ga0311356_1016285713300030617PalsaTTDKYGWLSAEDLEADERPAHPDIPDLIRKAVASVRAG
Ga0265462_1015775613300030738SoilDEWEKATTDRYGWLSAEDLEADETPGHPELPGLIRAAVASVRSRRP
Ga0302308_1045339913300031027PalsaWERATTDKYGWLSAEDLEADERPAHPDIPDLIRKAVASVRAG
Ga0302325_1185425313300031234PalsaEGLDQWERATTDKYGWLSAEDLEADERPAHPDIPDLIRKAVASVRAG
Ga0318515_1073892713300031572SoilTTDKYGWLSAEDLEGGEPPADPEIPDLIRAAAASVRRE
Ga0318494_1038552313300031751SoilTDRYGWLSPDDLGPDDPPADPEIPDLIRAAAASVRGRQPWRL
Ga0318494_1058272813300031751SoilATTDRYGWLSPDDLGPDDPPADPEIPDLIRAAAASVRGRQPWRL
Ga0306921_1014723343300031912SoilEWERATTDAYGWLSADDLGPDKPPADPSLPDLIRAAVASVRGRPR
Ga0306922_1060840723300032001SoilWERATTDAYGWLSAEDLGPEKPPADPGLPDLIRAAVASVRDRLR
Ga0318569_1019449613300032010SoilLSPDDLGPDDPPADPEIPDLIRAAAASVRGRQPWRL
Ga0318559_1048193823300032039SoilWERATTDTYGWLSADDLGPGMPPADPSLPGLIRAAAASVRDRPPWRP
Ga0318570_1009408213300032054SoilWERATTDAYGWLSADDLGPDKPPADPSLPDLIRAAVASVRGRPR
Ga0318514_1071787313300032066SoilDKYGWLTAEDLETTERPADSGIPDIIRAAVASVRRE
Ga0306920_10096181923300032261SoilDRYGWLSPDDLGPDDPPADPEIPDLIRAAAASVRDRQPWRS
Ga0348332_1249825323300032515Plant LitterATTDKYGWLSAEDLEADERPAHPDIPDLIRKAVASVRA
Ga0335075_1081753513300032896SoilQWEQATTDTYGWLAAGDLEGDERPAHPDIPDLMRVAEARVLGN
Ga0335083_1112427423300032954SoilATTDKYGWLTAGDLEAGERPAHPDIPDLIRAAVASVRREQAGE
Ga0335076_1053264813300032955SoilRATTDKYGWLTAEDLEADGHPADSGIPDLIRAAVVSVRRE
Ga0310914_1003458813300033289SoilDGLDLWERATTDKYGWLTAEDLEAGEHPAHSELPDLIRAAVASVRRG
Ga0370483_0313707_429_5423300034124Untreated Peat SoilKYGWFSAADLENGEPPAHPDIPDLIRLAVATVRSQPG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.