NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F090653

Metagenome / Metatranscriptome Family F090653

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F090653
Family Type Metagenome / Metatranscriptome
Number of Sequences 108
Average Sequence Length 103 residues
Representative Sequence ARFTLSTPQGERSEETLETGKSREVGFRLGNLAGTVYIVAKRTDLRWAFLGALAASRLGAHPEANLVQVNIEEWVMPTMAEYRVGARPRWRSLHDATFVRTSRSQP
Number of Associated Samples 101
Number of Associated Scaffolds 108

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 22.22 %
% of genes near scaffold ends (potentially truncated) 78.70 %
% of genes from short scaffolds (< 2000 bps) 91.67 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction Yes
3D model pTM-score0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil
(8.333 % of family members)
Environment Ontology (ENVO) Unclassified
(37.037 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(45.370 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 17.16%    β-sheet: 30.60%    Coil/Unstructured: 52.24%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.47
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 108 Family Scaffolds
PF05090VKG_Carbox 11.11
PF00144Beta-lactamase 4.63
PF09865DUF2092 0.93
PF04392ABC_sub_bind 0.93
PF12344UvrB 0.93
PF13350Y_phosphatase3 0.93
PF13628DUF4142 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 108 Family Scaffolds
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 4.63
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 4.63
COG2367Beta-lactamase class ADefense mechanisms [V] 4.63
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 0.93


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002568|C688J35102_118642653All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales580Open in IMG/M
3300004114|Ga0062593_100044160All Organisms → cellular organisms → Bacteria2707Open in IMG/M
3300005093|Ga0062594_100779821All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium879Open in IMG/M
3300005163|Ga0066823_10054091All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium733Open in IMG/M
3300005165|Ga0066869_10067083All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium664Open in IMG/M
3300005168|Ga0066809_10070419All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium814Open in IMG/M
3300005330|Ga0070690_100382143All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium1030Open in IMG/M
3300005337|Ga0070682_100465525All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium971Open in IMG/M
3300005340|Ga0070689_100673025All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium902Open in IMG/M
3300005353|Ga0070669_100515263All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium994Open in IMG/M
3300005436|Ga0070713_101120271All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium761Open in IMG/M
3300005459|Ga0068867_100066176All Organisms → cellular organisms → Bacteria2691Open in IMG/M
3300005543|Ga0070672_102087382All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium511Open in IMG/M
3300005548|Ga0070665_100137405All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium2447Open in IMG/M
3300005548|Ga0070665_102169863All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales559Open in IMG/M
3300005549|Ga0070704_101647549All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium592Open in IMG/M
3300005578|Ga0068854_100330511All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium1242Open in IMG/M
3300005614|Ga0068856_102146951All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium568Open in IMG/M
3300005841|Ga0068863_100562376All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium1127Open in IMG/M
3300005844|Ga0068862_102691596All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium509Open in IMG/M
3300006176|Ga0070765_100596589All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium1041Open in IMG/M
3300006606|Ga0074062_12804686All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium625Open in IMG/M
3300006844|Ga0075428_102138041All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium578Open in IMG/M
3300006865|Ga0073934_10817288All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium530Open in IMG/M
3300006881|Ga0068865_100179720All Organisms → cellular organisms → Bacteria1628Open in IMG/M
3300009094|Ga0111539_10182333All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium2452Open in IMG/M
3300009156|Ga0111538_13833918All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium520Open in IMG/M
3300009177|Ga0105248_12864420All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium550Open in IMG/M
3300009678|Ga0105252_10547005All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium534Open in IMG/M
3300010325|Ga0134064_10408132All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium544Open in IMG/M
3300010366|Ga0126379_13216732All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium547Open in IMG/M
3300010398|Ga0126383_11429997All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium781Open in IMG/M
3300011422|Ga0137425_1139477All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium602Open in IMG/M
3300011445|Ga0137427_10307437All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium667Open in IMG/M
3300012204|Ga0137374_10576225All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium862Open in IMG/M
3300012212|Ga0150985_107394844All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium987Open in IMG/M
3300012212|Ga0150985_112227709All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium619Open in IMG/M
3300012212|Ga0150985_122305566All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium866Open in IMG/M
3300012469|Ga0150984_106577586All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium1118Open in IMG/M
3300012532|Ga0137373_10033652All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales4944Open in IMG/M
3300012986|Ga0164304_10358726All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium1021Open in IMG/M
3300013296|Ga0157374_10114623All Organisms → cellular organisms → Bacteria2595Open in IMG/M
3300013296|Ga0157374_11315817All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium745Open in IMG/M
3300014165|Ga0181523_10481417All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium686Open in IMG/M
3300014254|Ga0075312_1102488All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium597Open in IMG/M
3300014325|Ga0163163_12167549All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium615Open in IMG/M
3300014969|Ga0157376_11999691All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium617Open in IMG/M
3300015371|Ga0132258_10860975All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2287Open in IMG/M
3300015371|Ga0132258_11884496All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales1505Open in IMG/M
3300015372|Ga0132256_101291308All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum843Open in IMG/M
3300015373|Ga0132257_102282457All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium701Open in IMG/M
3300015374|Ga0132255_104239551All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium608Open in IMG/M
3300016270|Ga0182036_10122687All Organisms → cellular organisms → Bacteria1806Open in IMG/M
3300016319|Ga0182033_10627266All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium936Open in IMG/M
3300016341|Ga0182035_10369532All Organisms → cellular organisms → Bacteria1197Open in IMG/M
3300016445|Ga0182038_11678839All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium572Open in IMG/M
3300017974|Ga0187777_10242455All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium1222Open in IMG/M
3300021170|Ga0210400_11208806All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium609Open in IMG/M
3300025310|Ga0209172_10518789All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium545Open in IMG/M
3300025903|Ga0207680_10149885All Organisms → cellular organisms → Bacteria1554Open in IMG/M
3300025907|Ga0207645_10086844All Organisms → cellular organisms → Bacteria2010Open in IMG/M
3300025923|Ga0207681_11265938All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium619Open in IMG/M
3300025928|Ga0207700_10939341All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium774Open in IMG/M
3300025929|Ga0207664_10400304All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium1221Open in IMG/M
3300025934|Ga0207686_11701965All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum521Open in IMG/M
3300025940|Ga0207691_10524346All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium1005Open in IMG/M
3300025981|Ga0207640_11139649All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium691Open in IMG/M
3300026088|Ga0207641_11980445All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium584Open in IMG/M
3300026088|Ga0207641_12600458All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium504Open in IMG/M
3300027900|Ga0209253_10304634All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium1236Open in IMG/M
3300027907|Ga0207428_11310616All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium502Open in IMG/M
3300027909|Ga0209382_10895990All Organisms → cellular organisms → Bacteria934Open in IMG/M
3300028379|Ga0268266_10950175All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum831Open in IMG/M
3300028380|Ga0268265_12165634All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium563Open in IMG/M
3300028381|Ga0268264_10705804All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum1002Open in IMG/M
3300030339|Ga0311360_11254782All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium582Open in IMG/M
3300030552|Ga0247654_1138542All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium574Open in IMG/M
3300031198|Ga0307500_10065031All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium913Open in IMG/M
3300031239|Ga0265328_10160792All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum847Open in IMG/M
3300031242|Ga0265329_10000204All Organisms → cellular organisms → Bacteria30851Open in IMG/M
3300031446|Ga0170820_13559652All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium667Open in IMG/M
3300031474|Ga0170818_102553574All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales707Open in IMG/M
3300031538|Ga0310888_11108955All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium501Open in IMG/M
3300031547|Ga0310887_11047151All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium522Open in IMG/M
3300031712|Ga0265342_10258545All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium927Open in IMG/M
3300031781|Ga0318547_10879993All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium559Open in IMG/M
3300031820|Ga0307473_10289698All Organisms → cellular organisms → Bacteria1025Open in IMG/M
3300031833|Ga0310917_10903906All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium594Open in IMG/M
3300031879|Ga0306919_11431645All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium521Open in IMG/M
3300031890|Ga0306925_10601904All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium1161Open in IMG/M
3300031910|Ga0306923_11691491All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium654Open in IMG/M
3300031918|Ga0311367_10444380All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium1334Open in IMG/M
3300031946|Ga0310910_11236474All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum578Open in IMG/M
3300032001|Ga0306922_10780166All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium1000Open in IMG/M
3300032043|Ga0318556_10498606All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum637Open in IMG/M
3300032059|Ga0318533_11394652All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium512Open in IMG/M
3300032205|Ga0307472_100124655All Organisms → cellular organisms → Bacteria1829Open in IMG/M
3300032261|Ga0306920_103829854All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium550Open in IMG/M
3300032893|Ga0335069_12201272All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium577Open in IMG/M
3300033486|Ga0316624_10340025All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium1233Open in IMG/M
3300033550|Ga0247829_10931329All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium723Open in IMG/M
3300034659|Ga0314780_031380All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium974Open in IMG/M
3300034659|Ga0314780_033041All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum957Open in IMG/M
3300034664|Ga0314786_059424All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium742Open in IMG/M
3300034668|Ga0314793_019884All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium1043Open in IMG/M
3300034670|Ga0314795_038317All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium808Open in IMG/M
3300034671|Ga0314796_029174All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium954Open in IMG/M
3300034817|Ga0373948_0114013All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium648Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil8.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.48%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere5.56%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere5.56%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.70%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere3.70%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil2.78%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.78%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere2.78%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.78%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere2.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.78%
Hot Spring SedimentEnvironmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment1.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.85%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.85%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.85%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.85%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.85%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.85%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.85%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.93%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.93%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.93%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.93%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.93%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.93%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.93%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.93%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.93%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.93%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.93%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.93%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.93%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005163Soil and rhizosphere microbial communities from Laval, Canada - mgHMBEnvironmentalOpen in IMG/M
3300005165Soil and rhizosphere microbial communities from Laval, Canada - mgHMCEnvironmentalOpen in IMG/M
3300005168Soil and rhizosphere microbial communities from Laval, Canada - mgLPCEnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006606Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006865Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaGEnvironmentalOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009678Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100EnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011422Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT640_2EnvironmentalOpen in IMG/M
3300011445Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2EnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014254Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D2EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300025310Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027900Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300030339III_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300030552Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031198Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_SEnvironmentalOpen in IMG/M
3300031239Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaGHost-AssociatedOpen in IMG/M
3300031242Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaGHost-AssociatedOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031712Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaGHost-AssociatedOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031918III_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300033486Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_AEnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300034659Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034664Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034668Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034670Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034671Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034817Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
C688J35102_11864265313300002568SoilRGGRFEETLETGKNREVGFRVGNLAGTIYIAAKRTDLRRAFLGALAASRFGAHPEANRVQVDIEDWVMPTMADYRLGARPRWHSLHDATFVRSASGPP*
Ga0062593_10004416013300004114SoilGEHIEETLENGKSREVSFRLGNLAGTIYVVAKRTDLRRAFLGALAASRLAAHREANRVQVDIEEWVMPTMAEYRFGARPRWRTLHDATFVRTSRGQP*
Ga0062594_10077982113300005093SoilFVLSSPQGEHSEETLETGKSREVGFRLGTLAGTIYIAAKRTDLRRAFLGALAASSFGAHPEASHVQVHIEEWVMPTMADYRAGVRPWWRVLHDATFVRTQRSQP*
Ga0066823_1005409113300005163SoilLETGKSREVGLRLGNLIGEIYVVARRDDLRRAFLGALAANRLGAHPEANLVQVNVEEWVMPTMAKHRLGARPSWRSSYEATFVRTSYEATFVRTSSSRP*
Ga0066869_1006708313300005165SoilPSVGPQFQARFTLSTPQGARSEETLETGKSREVGLRLGNLTGEIYIVARRDDLRRAFLGALAANRLGAHPEANLVQVNVEEWVMPTMAKHRLGARPCWRSLYEATFVRTSYEATFVPTSRSRP*
Ga0066809_1007041913300005168SoilARSEETLETGKSREVGLRLGNLTGEIYIVARRDDLRRAFLGALAANRLGAHPEANLVQVNVEEWVMPTMAKHRLGARPCWRSLYEATFVRTSYEATFVRTSRSRP*
Ga0070690_10038214313300005330Switchgrass RhizosphereERSEETLEAGKSREVGFRVGNLAGTIYIAAKRTDLRRAFLGALAANRLGAHPEANRVQVDIEDWVMPTMAEYRLGARPRWRSLHDATFVRRSSGSP*
Ga0070682_10046552513300005337Corn RhizospherePQGARSEETLETGKSREVSLRLGNLTGEIYIVARRDDLRRAFLGALAANRLGAHPEANLVQVNVEEWVMPTMAEHRLGARPCWRSLYEATFVRASYEATFVRTSESRP*
Ga0070689_10067302523300005340Switchgrass RhizosphereVGPQLRAGFILSTPRGEHIEETLENGKGREVSFRLGNLAGTIYVVAKRTDLRRAFLGALAASRLAAHREANRVQVDIEEWVMPTMAEYRFGARPRWRTLHDATFVRTSRGQP*
Ga0070669_10051526313300005353Switchgrass RhizosphereRFTLSTARGDRSEETLEAGKSREVGFRVGNLAGTIYIAAKRTDLRRAFLGALAANRLGAHPEANRVQVDIEDWVMPTMAEYRLGARPRWRSLHDATFVRRSSGSP*
Ga0070713_10112027113300005436Corn, Switchgrass And Miscanthus RhizosphereEETLETGKSREVGLRLGNLAGTVRIVARRDDLRRAFFGALAANRLGVHPEANLVQVNIEDWVMPTMAQYRLGARPWWRSLHEATFVRTSRSPP*
Ga0068867_10006617623300005459Miscanthus RhizosphereLHVRFTGDHIDETLEAGKSREVGFRLGNVAGTVYVASKRDDDLRRAFLASLAARFFGAHPDASVIRVSIEAWEVPTMSEYRAGARPRWRALHDATFVRNVP*
Ga0070672_10208738223300005543Miscanthus RhizosphereAPAVGPQLRARFTLSTSRGERSEETLETGKSREVGFRVGNLAGTIYIAAKRTDLRRAFLGALAANRLGAHPEANRVQVDIEDWVMPTMAEYRLGARPRWRSLHDATFVRRSSGSP*
Ga0070665_10013740513300005548Switchgrass RhizosphereGADKNREVGFRLGTLAGTVYVLTKHTDVRRAFLGALAANRLGAHPEASRVEVSIDAWEMPTMAEYRIGLRPRWRSLNEATFVREPRFAP*
Ga0070665_10216986313300005548Switchgrass RhizosphereGADKNREVGFRLGTLAGTVYVLTKHTDVRRAFLGALAANRFGAHPEASRVDVSIDAWEMPTMAEYRIGLRPRWRALNEATFVREPRFVP*
Ga0070704_10164754923300005549Corn, Switchgrass And Miscanthus RhizosphereSTSQGARSEETLETGKSREVGLRLGNLTGEIYIVARRDDLRRAFLGALAANRLGAHPEANLVQVNLEEWVMPTMAKHRLGARPCWRSLYEATFVRTSRSRP*
Ga0068854_10033051113300005578Corn RhizospherePSVGPQFQARFTLSTPQGARSEETLETGKSREVGLRLGNLTGEITIVARRDDLRRAFLGALAANRLGAHPEANLVQVNVEEWVMPTMAEHRLGARPCWRSLYEATFVRTSYEATFVRTSMSRP*
Ga0068856_10214695123300005614Corn RhizosphereSREVGFRVGNLAGTIYIAAKRTDLRRAFLGALAASRLGAHPEANRVQVDIEDWVMPTMAEYRLGARPRWRSLHDATFVRRSSAPP*
Ga0068863_10056237613300005841Switchgrass RhizosphereEETLERGKSREVGLRLGNLAGTILIVAKRTDLRRAFLGALAANRFGAHPEANRVQVTIEEWVMPTMAAYRVGARPQWRSLHDATFVRTSRSAP*
Ga0068862_10269159613300005844Switchgrass RhizosphereTGKSREVGFRVGNLAGTIYIAAKRTDLRRAFLGALAANRLGAHPEANRVQVDIEDWVMPTMAEYRLGARPRWRSLHDATFVRRSSGSP*
Ga0070765_10059658913300006176SoilETLETGKSREVGFRLGNLAGTAYVVARDTDLRRAFLGALAASRFGAHPGANLVQVTIEEWEMPTMAEHRAGARPRWRTLHDATFERTPVSQR*
Ga0074062_1280468613300006606SoilTPQGARSEETLETGKSREVGLRLGNLTGEIYIVARRDDLRRAFLGALAANRLGAHPEANLVQVNVEEWVMPTMAKHRLGARPCWRSLYEATFVRTSRSRP*
Ga0075428_10213804113300006844Populus RhizosphereLRTRFTLSTPKGERFETTLERGKSREVGFRLGNLAGTVYVASKRTDLRRAFLAALAANGLGAHPEANIVHVDIEEWVMPTMPEYRVGARPYWRSLHGARFVRRSRTQP*
Ga0073934_1081728813300006865Hot Spring SedimentPEGRSEETLETGKNREVDFRLGNLAGTVHIAATRSDLRRAFLGALAANRFDAHPEANAVQVIIEEWVMPTMAEYRLGARPVWRSLEEATFVRASK*
Ga0068865_10017972013300006881Miscanthus RhizospherePSVGPQFQARFTLSTPQGARSEETLETGKSREVGLRLGNLTGEIYIVARRDDLRRAFLGALAANRLGAHPEANLVQVNVEEWVMPTMAEHRLGARPCWRSLYEATFVRTSYEATFVRTSRSRP*
Ga0111539_1018233333300009094Populus RhizosphereLRARFTVSTPQGERSEETLESGKSREVGFRLGNLAGTVYIVAKRTDLRRAFLGALAASRLGAHPEADLVQVNIEEWVMPTMAEYRVGARPRWHSLHDATFVRTPRSQP*
Ga0111538_1383391813300009156Populus RhizosphereAETLETGKSREVGFRVGNLAGTIYVVARRTDLRRAFLGALAASRLGAHPEANRIQVDIEDWVMPTMAEYRLGVRPRWRSLHDATFVRRSSGQP*
Ga0105248_1286442013300009177Switchgrass RhizospherePQLHVRFTGDHFDETLEAGKSREVGFRLGNVAGTVYVASKRDDLRRAFLASLAARFFGAHPDANVVRVSIEAWEVPTMSEYRAGARPRWRALHDATFVRNAP*
Ga0105252_1054700513300009678SoilLRARFTLSTPQGERSEETLETGKSREVGFRLGNLAGTIYIVAKRTDLRRAFLGALAASRFGVHPEANRVQVDIEDWVMPTMAEYRLGARPRWRSLHDATFVRRSSSQP*
Ga0134064_1040813223300010325Grasslands SoilARFTLSTPQGERSDETLETGKSREVGLRLGNLAGTVYIVANRTDLRRAFLGALAASRLGAHREANRVQVDIEEWVMPTMAEYRLGVRPRWRSLHDATFVRTSCGEQ*
Ga0126379_1321673213300010366Tropical Forest SoilAVGPQLRARFTLSTPRGERSEETLETGKSREVGFRVGNLAGTIYIAAKRTDLRRAFLGALAASRLGAHPEANRVQVDIEDWVMPTMAEYRLGARPRWRSLHDATFVRRPSGQP*
Ga0126383_1142999713300010398Tropical Forest SoilLRARFTLSTPRGERCEETLETGKSREVGFRVGNLAGTVYIVAQRADLRRAFLGALAASRLGAHPEANRVQVDIEDWVMPTMAEYRLGARPRWRSLHDATFVRKSSSPP*
Ga0137425_113947713300011422SoilLRARFTLSTPQGERSEETLETGKSREVGFRLGNLAGTIYIVAKRTDLRRAFLGALAASRFGVHPEANRVQVDIEDWVMPTMAEYRLGARPRWRS
Ga0137427_1030743723300011445SoilGPQLRARFTLSTPQGERSEETLETGKSREVAFRVGNLAGTIYIVAKRTDLRRAFLGALAASRFGVHPEANRVQVDIEDWVMPTMAEYRLGARPRWRSLHDATFVRRSSSQP*
Ga0137374_1057622523300012204Vadose Zone SoilLRARLILSTPRGERSEEILETGKSREVGFRLGNVAGTIYLVGNRTGLRRAFLGALAANRFGAHPEANLVQVNIEEWVMPTMAEYRLGKRPSWRPLHDATFLRTSRNPP*
Ga0150985_10739484423300012212Avena Fatua RhizosphereLRASFILSTPQGEHIRETLETGKSREVSFRLGNLAGMIYVVAKRDDVRRAFLGALAASRLGAHREANRVQVDIEEWVMPTMPQYRFGARPRWCSLHEATFVRTSRGQP*
Ga0150985_11222770933300012212Avena Fatua RhizosphereMETGKSREVGFRLGNLAGTVYIAGQRTDLRRAFLGALAANRFGAHPDADRVQVTIEQWEMPTMSEYRAGARPRWLPL
Ga0150985_12230556623300012212Avena Fatua RhizosphereLRARFILSSPQGERSEETLETGKSREVGFRLGNLAGTIYIAAKRTDLRWAFLGALAASSFGAHPEASHVQVHIEEWVMPTMADYRTGVRPQWRVLNDATFVRTKRSQP*
Ga0150984_10657758623300012469Avena Fatua RhizosphereLRASFILSTPQGEHIRETLETGKSREVSFRLGNLAGMIYVVAKRDDVRRAFLGALAASRLGAHREANRVQVDIEEWVMPTMADYRFGARPRWRSLHEATFVRTSRGQP*
Ga0137373_1003365243300012532Vadose Zone SoilLRARFILSTPRGKRSEEILETGKSREVGFRLGNVAGTIYLVGNRTGLRRAFLGALAANRFGAHPEANLVQVNIEEWVMPTMAEYRLGKRPRWRPLHDATFLRTSRNPP*
Ga0164304_1035872623300012986SoilLRARFTLSTPRGERFEETLETGKSREVGFRVGNLAGTIYIAAKRTALRRAFLGALAASRLGAHPEASRVQVDIEDWVMPTMAEYRLGSRPRWRSLHDATFVRRSSGPP*
Ga0157374_1011462333300013296Miscanthus RhizosphereEETLETGKSSEVGLSLGNLAGTIYHVAERVDLRRAFLGALAANRLGAHPEANLVEVSIEEWVMPTMVEYRLGARARWHSLYEATFTRTSESHP*
Ga0157374_1131581723300013296Miscanthus RhizosphereSFFAPAVGPQLHVRFTGDHIDETLEAGKSREVGFRLGNVAGTVYVASKRDDLRRAFLASLAARFFGAHPDASVVRVSIEAWEVPTMSEYRAGARPRWRALHDATFVRNVP*
Ga0181523_1048141723300014165BogLRARFTLSTPQGKRSEETLETGKSREVGFRLGNLAGTVYIVARRTDLRRAFLGALAASRLGAHPEANLVQVSIEEWEMPTMAEYRVGARPRWRSLHDATFVRTSRSQP*
Ga0075312_110248823300014254Natural And Restored WetlandsLRARFILSSPQGERSEETLETGKSREVGFRLGNLAGTIYIAAKRTDLRRAFLGALAASRFGAHPEASHVQVNIEEWVMPTMADYRSGVRPQWRVLHDATFVRTQRSQP*
Ga0163163_1216754913300014325Switchgrass RhizosphereTGKSREVGLRLGNLTGEIYVVARRDDLRRAFLGALAANRLGAHPEANLVQVNVEEWVMPTMAEHRLGARPCWRSSYEATFVRTSTSRP*
Ga0157376_1199969123300014969Miscanthus RhizosphereFTLSTPQGARSEETLETGKSREVGLRLGNLTGEIYIVARRDDLRRAFLGALAANRLGAHPEANLVQVNVEEWVMPTMAQHRLGARPGWRSSYEATFVRTSYEATFVSTSRSQP*
Ga0132258_1086097513300015371Arabidopsis RhizosphereLRVRFVLSSPKGERSEETLEAGKSREVGLRLGNLAGTIYIAAKRTDLRRAFLGALAASSFGAHPEASQVQVNIEEWVMPTMADYRAGVRPRWRVLNDATFV
Ga0132258_1188449633300015371Arabidopsis RhizosphereQLRARFVLSAPLGERSEEKLETGKSREVGFRLGNLAGTIYIAAQRPDLRRAFLGALAASSFGAHPEASHVQVNIEEWVMPTMADYRAGVRPRWRVLHDATFMRTKRSQP*
Ga0132256_10129130823300015372Arabidopsis RhizosphereQLRARFVLSAPLGERSEEKLETGKSREVGFRLGNLAGTIYIAAKRTDLRRAFLGALAASSFGAHPEASHVQVNIEEWVMPTMADYRAGVRPRWRVLNDATFVRTKRSQP*
Ga0132257_10228245723300015373Arabidopsis RhizosphereLRARFILSSPQGERSEETLETGKSREVGFRLGNLAGTIYIAAKRTDLRRAFLGALAASSFGAHPEASHVQVNIEEWVMPTMADYRAGVRPRWRVLNDATFVRTKRSQP*
Ga0132255_10423955113300015374Arabidopsis RhizosphereLRARFTLSTPQGERSEETLETGKSREVGFRLGNLAGTVYIVAQRTDLRRAFLGALAASRLGAHPEANLVEVTIEEWVMPTMAEYRLGARPYWRSLHEATFVRSSKRQP*
Ga0182036_1012268723300016270SoilLRARFILSSPQGERSEETLETGKSREVGFRLGNLAGTIYIAAKRPDLRRAFLGALAARSFGAHPEASHVQVHIEEWVMPTMADYRAGVRPRWRVLNDATFVRTKRSQP
Ga0182033_1062726623300016319SoilLRARFILSSPQGERSEETLETGKSREVGFRLGNLAGTIYIAAKRTDLRRAFLGVLAASSFGAHPEASHVQVNIEEWVMPTMADYRAGVRPRWRVLNDATFVRTKRSQP
Ga0182035_1036953213300016341SoilFILSSPQGERSEETLETGKSREVGFRLGNLAGTIYIAAKRPDLRRAFLGALAARSFGAHPEASHVQVHIEEWVMPTMADYRAGVRPRWRVLHDATFVRTKRSQP
Ga0182038_1167883923300016445SoilLETGKSREVGFRVGNLAGTIYIAAKRTEVRRAFLGALAASRLGAHPEANRVQVDIEDWVMPTMAEYRLGARPRWRSLHDATFVRRSSSQP
Ga0187777_1024245523300017974Tropical PeatlandLSTPEGERSEETLESGKSREVGFRLGNVAGTVHVVAKRTDLRRAFLGALAADRFGAHPEADLVQVTIEEWVMPTMAEYRLGARPRWRSLHEATFVRAPQSQP
Ga0210400_1120880623300021170SoilSTPQGERSEETLETGKSREVGFRLGNLAGTIYILAKRTDLRRAFLGALAANRFGAHPEANIVQVNIEEWVMPTMAAYRLGERPRWRSLYDATFVRRSTSQP
Ga0209172_1051878923300025310Hot Spring SedimentVLSTPEGRSEETLETGKNREVDFRLGNLAGTVHIAATRSDLRRAFLGALAANRFDAHPEANAVQVIIEEWVMPTMAEYRLGARPVWRSLEEATFVRASK
Ga0207680_1014988533300025903Switchgrass RhizosphereVLATPQGTRSEEVLGADKNREVGFRLGTLAGTVYVLTKHTDVRRAFLGALAANRLGAHPEASRVEVSIDAWEMPTMAEYRIGLRPRWRSLNEATFVREPRFAP
Ga0207645_1008684433300025907Miscanthus RhizosphereTARGDRSEETLEAGKSREVGFRVGNLAGTIYIAAKRTDLRRAFLGALAANRLGAHPEANRVQVDIEDWVMPTMAEYRLGARPRWRSLHDATFVRRSSGSP
Ga0207681_1126593813300025923Switchgrass RhizosphereARSEETLETGKSREVGLRLGNLTGEITIVARRDDLRRAFLGALAANRLGAHPEANLVQVNVEEWVMPTMAEHRLGARPCWRSLYEATFVRTSYEATFVRTSRSPP
Ga0207700_1093934113300025928Corn, Switchgrass And Miscanthus RhizosphereARSEETLETGKSREVGLRLGNLAGTVRIVARRDDLRRAFFGALAANRLGVHPEANLVQVNIEDWVMPTMAQYRLGARPWWRSLHEATFVRTSRSPP
Ga0207664_1040030423300025929Agricultural SoilGERFEETLETGKSREVGLRLGNLAGTIYIVAERVDLRRAFLGALAANRLGAHPEANLVQVSIEEWVMPTMVEYRLGARPRWHSLYEATFTRTSESHP
Ga0207686_1170196513300025934Miscanthus RhizosphereTALAWAFERVLVHPEVRARFVLVTPRGTRTEEVLGTGKNREVAFRLGTLAGTVYVLTKRTNVRRAFLGALAANRLGAHPDASEVAVSIDTWEMPTMAEYRLGMRPRWRSLIEATFARGARDAP
Ga0207691_1052434623300025940Miscanthus RhizosphereLSTSRGERSEETLETGKSREVGFRVGNLAGTIYIAAKRTDLRRAFLGALAANRLGAHPEANRVQVDIEDWVMPTMAEYRLGARPRWRPLHDATFVRRSSGSP
Ga0207640_1113964923300025981Corn RhizosphereLRSEETLEAGKSREVGFRVGNLAGTIYIAAKRTDLRRAFLGALAANRLGAHPEANRVQVDIEDWVMPTMAEYRLGARPRWRSLHDATFVRRSSGSP
Ga0207641_1198044523300026088Switchgrass RhizosphereTLETGKSREVGFRLGNLAGTVYVVGQRTDLRRAFLGALAANRLGAHPEAKRVQVTIEEWVMPGLAEYRDGARPGWRSLHEATFVRASTSPP
Ga0207641_1260045823300026088Switchgrass RhizospherePQLRARFDLSTPEGRRFEETLETGKSREVGFRVGNLAGTVFIVAERTDLRRAFLGALAASSLGAHPDASRVQVSIEAWEMPTMAEYRVGARPRWRGLRDATFVRAPRGQP
Ga0209253_1030463423300027900Freshwater Lake SedimentARFTLSTPQGERSEETLETGKSREVGFRLGNLAGTVYIVAKRTDLRWAFLGALAASRLGAHPEANLVQVNIEEWVMPTMAEYRVGARPRWRSLHDATFVRTSRSQP
Ga0207428_1131061613300027907Populus RhizosphereETLESGKSREVGFRLGNLAGTVYIVAKRTDLRRAFLGALAASRLGAHPEADLVQVNIEEWVMPTMAEYRVGARPRWHSLHDATFVRTPRSQP
Ga0209382_1089599013300027909Populus RhizosphereGKSREVGFRLGNLAGTIYIAAERTDLRRAFLGALAASSFGAHPEASHVQVNIEEWVMPTMADYRAGVRPRWRVLNDATFVRTKRSQP
Ga0268266_1095017523300028379Switchgrass RhizosphereVLGADKNREVGFRLGTLAGTVYVLTKHTDVRRAFLGALAANRFGAHPEASRVEVSIDAWEMPTMAEYRIGLRPRWRSLNEATFVREPRFAP
Ga0268265_1216563413300028380Switchgrass RhizosphereRGDRSEETLEAGKSREVGFRVGNLAGTIYIAAKRTDLRRAFLGALAANRLGAHPEANRVQVDIEDWVMPTMAEYRLGARPRWRSLHDATFVRRSSGSP
Ga0268264_1070580423300028381Switchgrass RhizosphereSYSFFAPAVGPQLRVRFTGEHVDEALEAGKSREVGFRLGNVAGTVYIASKRDDMRRALLAALAARFFGGHPDANVVRVSIEAWEVPTMSEYRAGARPRWRALHDATFVRNVP
Ga0311360_1125478213300030339BogETGKSREVGFRVGNLAGTIYVAAKRTDLRRAFLGALAASRLGAHPEANRVQVDIEDWVMPTMAEYRLGARPRWRSLHDATFVRSSGPP
Ga0247654_113854213300030552SoilPQLRARFILSSPQGERSEETLETGKSREVGFRLGNLAGTIYIAAKRTDLRRAFLGALAASSFGAHPEASHVQVNIEEWVMPTMADYRAGVRPQWRVLHDATFVRTKRSQP
Ga0307500_1006503123300031198SoilPSVGPQFQARFTLSTPQGARSEETLETGKSREVGLRLGNLTGEIYIVARRDDLRRAFLGALAANRLGAHPEANLVQVNVEEWVMPTMANHRLGARPCWRSLYEATFVRTSYEATFVRTSRSRP
Ga0265328_1016079223300031239RhizosphereTAQGARSEEALETGKSREVSFRLGNLAGTVYIVAKHTDLRRAFLGALAANRLGVHPEANLVQVSIEEWEMPTMAEYRVGARPRWHSLHDATFVRASSVRASRESQP
Ga0265329_10000204333300031242RhizospherePAVGPQLRAQFALSTPQGVRSEETLETGKSREVGFRLGNLAGTVYIVAKRTDLRRAFLGALAANCLGAHPQANVVQVSIVGWEMPTMAEYRVGARPRWRSLHDATFVRTSPSQP
Ga0170820_1355965213300031446Forest SoilRGERFEEALETGKSREVGFRVGNLAGTIYIAAKRPDLRRAFLGALAASRLGEHPEADRVQVDIEDWVMPTMAEYRLGARPRWRSLHDATFVRRSSGPP
Ga0170818_10255357423300031474Forest SoilRSEETLETGKSREVGFRLGNLAGTIYIAAKRTDLRRAFLGALAASSFGAHPEASDVQVNIEEWVMPTMADYRAGVRPRWRVLNDATFVHTKRSQP
Ga0310888_1110895523300031538SoilLRARFTLSTARGERSEETLEAGKSREVGFRVGNLAGTIYIAAKRTDLRRAFLGALAASRLGAHPEANRVQVDIEDWVMPTMAEYRLGARPRWRSLHDATFVRRSSGSP
Ga0310887_1104715123300031547SoilEETLETGKSREVGFRVGNLAGTIYIAAKRTDLRRAFLGALAASRLGAHPEANRVQVDIEDWVMPTMAEYRLGARPRWRSLHDATFVRRSSGSP
Ga0265342_1025854513300031712RhizosphereRFTLSTPQGARSEETLESGKSREVGLRLGNLAGTIHLVAGRDDLRRAFLAALAANRLGAHPEANLVQVNIEEWVMPTMAEYRLGARPWWRSLYEATFVRTSRSRP
Ga0318547_1087999323300031781SoilRARFILSSPQGERSEETLETGKSREVGFRLGNLAGTIYIAAKRADLRRAFLGALAASSFGAHPEASHVQVNIEEWVMPTMADYRAGVRPRWRVLNDATFVRTKRSQP
Ga0307473_1028969813300031820Hardwood Forest SoilSSPQGERSEETLETGKSREVGFRLGNLAGTIYIAAKRTDLRRAFLGALAASSFGAHPEASHVQVNIEEWVMPTMADYRAGVRPRWRVLNDATFVRTKRSQP
Ga0310917_1090390613300031833SoilQLRARFILSSPQGERSEETLETGKSREVGFRLGNLAGTIYIAAKRTDLRRAFLGALAASSFGAHPEASHVQVNIEEWVMPTMADYRAGVRPRWRVLNDATFVRTKRSQP
Ga0306919_1143164513300031879SoilRFILSSPQGERSEETLETGKSREVGFRLGNLAGTIYIAAKRTDLRRAFLGALAASSFGAHPEASHVQVNIEEWVMPTMADYRAGVRPRWRVLNDATFVRTKRSQP
Ga0306925_1060190413300031890SoilTREAGKSREVGLRLGNLAGTIQIVAQRTDLRRAFLGALAADRLGAHPEANLVQVTIEEWVMPTMVEYRLGARPRWHALHEATFTRASGNQP
Ga0306923_1169149113300031910SoilGKSREVGLRLGNLAGTIYIVAKRADLRRAFLGALAANRFGAHPEASLVQVRIEELVMPTMVDYRLGARPWWHSLHEATFTRASRSQP
Ga0311367_1044438013300031918FenPAVGPQLRARFTLSTPPGERFEETLETGKSREVGFRVGNLAGTIYVAAKRTDLRRAFLGALAASRLGAHPEANRVQVDIEDWVMPTMAEYRLGARPRWRSLHDATFVRSSGPP
Ga0310910_1123647413300031946SoilETGKSREVGFRLGNLAGTIYIAAKRTDLRRAFLGALAASSFGAHPEASHVQVNIEEWVMPTMADYRAGVRPRWRVLNDATFVRTKRSQP
Ga0306922_1078016623300032001SoilLRARFILSSPQGERSEETLETGKSREVGFRLGNLAGTIYIAAKRTDLRRAFLGALAASSFGAHPEASHVQVNIEEWVMPTMADYRAGVRPRWRVLNDATFVRTKRSQP
Ga0318556_1049860613300032043SoilLSTPQGERSEETLETGKSREVGFRLGNLAGTVYVMAERTDLRRAFLGALAASSFGAHPEASHVQVNIEEWVMPTMADYRAGVRPRWRVLNDATFVRTKRSQP
Ga0318533_1139465213300032059SoilTPQGARYDETLETGKSREVGFRLGNLAGTVYIASTRTDLRRAFLGALAASRFGAHREANRVRVSVEEWEMPTMAEYRVGARPRWRSLRDATFLRTSSGQL
Ga0307472_10012465513300032205Hardwood Forest SoilSREVGLRLGNLTGEIYIVARRDDLRRAFLGALAANRLGAHPEANLVQVNVEEWVMPTMAKHRLGARPCWRSLYEATFVRTSYEATFVRTSRSRP
Ga0306920_10382985423300032261SoilARFTLSTARGERSEETLETGKSREVGLRLGNLAGTINIVAKRTDLRRAFLGALAADRLGAHPEANLVRVTIEEWVVPTMADYRLGARPRWHSLHEATFTRASEGQP
Ga0335069_1220127213300032893SoilSEETLETGASREVGFRLGNVAGTVYIVAQQTDLRRAFLGALAASRFTAHPEADRVQVTIEEWVVPTMAQYRAGVRPGWRWLHDATFVRNAKGPR
Ga0316624_1034002523300033486SoilTPQGARSEEILEAGKSREVGFRLGNVAGTIYLVADRTDVRRAFLGALAANRFGAHPEASRVQVDIEEWVMPAMAEYRLGARPRWRSLYDATFVRTSKSPP
Ga0247829_1093132913300033550SoilLRARFILSTPTGERSEETLETGKSREIGLRLGNLAETIHVVATRTDLRRALLGALAANRLGAHPEANLVQVRIEEWVMPTMAEYRRGARPRWRSLHEATFVRTPSSQS
Ga0314780_031380_133_4533300034659SoilLRVRFTVCTPEGTCSDATLETGKSREVSLRLGEIAGTVYIVANRTDLRRAFLGALAASRFGAHPEASRVQVSIEEWVMPTMAEYRDGSRPRWHRLYDATFVRAPST
Ga0314780_033041_581_9073300034659SoilLRARFILSSPQGERSEETLETGKSREVGFRLGNLAGTIYIAAKRTDLRRAFLGALAASSFGAHPEASHVQVNIEEWVMPTMADYRAGVRPRWRVLHDATFVRTQRSQP
Ga0314786_059424_40_3663300034664SoilLRVRFTVCTPEGTCSDATLETGKSREVSLRLGEIAGTVYIVANRTDLRRAFLGALAASRLGAHPGASRVEVTIEEWVVPAMAEYRGGARPRWHRLHDATFVRTSSVPE
Ga0314793_019884_491_8173300034668SoilLRARFILSSPQGERSEETLETGKSREVGFRLGNLAGTIYIAAKRTDLRRAFLGALAASSFGAHPEASHVQVHIEEWVMPTMADYRAGVRPWWRVLHDATFVRTQRSQP
Ga0314795_038317_467_7933300034670SoilLRARFILSSPQGERSEETLETGKSREVGFRLGNLAGTIYIAAKRTDLRRAFLGALAASSFGAHPEASHVQVHIEEWVMPTMADYRAGVRPRWRVLHDATFMRTKRSQP
Ga0314796_029174_596_9223300034671SoilLRARFILSSPQGERSEETLETGKSREVGFRLGNLAGTIYIAAKRTDLRRAFLGALAASSFGAHPEASHVQVNIEEWVMPTMADYRSGVRPQWRVLHDATFVRTQRSQP
Ga0373948_0114013_318_6473300034817Rhizosphere SoilSTPQGARSEETLETGKSREVSLRLGNLTGEITIVARRDDLRRAFLGALAANRLGAHPEANLVQVNVEEWVMPTMAEHRLGARPCWRSSYEATFVRTSYEATFVTSRSRP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.