NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F090595

Metagenome / Metatranscriptome Family F090595

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F090595
Family Type Metagenome / Metatranscriptome
Number of Sequences 108
Average Sequence Length 48 residues
Representative Sequence MFKLDHKLAPDEFIQTFFEVNRQDHQRPPHPWEALFREGKCTREQLQGWAKE
Number of Associated Samples 101
Number of Associated Scaffolds 108

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 98.15 %
% of genes near scaffold ends (potentially truncated) 91.67 %
% of genes from short scaffolds (< 2000 bps) 94.44 %
Associated GOLD sequencing projects 97
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.148 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(13.889 % of family members)
Environment Ontology (ENVO) Unclassified
(31.481 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(36.111 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 35.00%    β-sheet: 0.00%    Coil/Unstructured: 65.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 108 Family Scaffolds
PF07883Cupin_2 81.48
PF02887PK_C 4.63
PF09084NMT1 0.93
PF04359DUF493 0.93
PF05598DUF772 0.93
PF07394DUF1501 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 108 Family Scaffolds
COG0469Pyruvate kinaseCarbohydrate transport and metabolism [G] 4.63
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.93
COG2921Putative lipoate-binding regulatory protein, UPF0250 familySignal transduction mechanisms [T] 0.93
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.93


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.15 %
UnclassifiedrootN/A1.85 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2140918013|NODE_251612_length_1960_cov_7.995408All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1992Open in IMG/M
2162886007|SwRhRL2b_contig_1187219All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium876Open in IMG/M
2170459010|GIO7OMY01C41FWAll Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium505Open in IMG/M
2199352025|deepsgr__Contig_80163All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium572Open in IMG/M
3300000793|AF_2010_repII_A001DRAFT_10093955All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium635Open in IMG/M
3300000881|JGI10215J12807_1564276All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium620Open in IMG/M
3300000890|JGI11643J12802_11169313All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium915Open in IMG/M
3300000891|JGI10214J12806_12080048All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium531Open in IMG/M
3300001431|F14TB_100044783All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium781Open in IMG/M
3300003999|Ga0055469_10122680All Organisms → cellular organisms → Bacteria767Open in IMG/M
3300004070|Ga0055488_10026825All Organisms → cellular organisms → Bacteria1119Open in IMG/M
3300004480|Ga0062592_100410544All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1081Open in IMG/M
3300004643|Ga0062591_100346183All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1198Open in IMG/M
3300005186|Ga0066676_10275331All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1106Open in IMG/M
3300005336|Ga0070680_101162295All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300005339|Ga0070660_100098944All Organisms → cellular organisms → Bacteria2309Open in IMG/M
3300005356|Ga0070674_100340995All Organisms → cellular organisms → Bacteria1207Open in IMG/M
3300005445|Ga0070708_100696245All Organisms → cellular organisms → Bacteria957Open in IMG/M
3300005446|Ga0066686_10619980All Organisms → cellular organisms → Bacteria → Proteobacteria735Open in IMG/M
3300005536|Ga0070697_101909458All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium531Open in IMG/M
3300005713|Ga0066905_100564977All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium957Open in IMG/M
3300006049|Ga0075417_10365862All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium709Open in IMG/M
3300006196|Ga0075422_10250781All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium744Open in IMG/M
3300006804|Ga0079221_10044835All Organisms → cellular organisms → Bacteria1953Open in IMG/M
3300006846|Ga0075430_101011881All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium685Open in IMG/M
3300006846|Ga0075430_101476775All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium559Open in IMG/M
3300006846|Ga0075430_101746031All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium510Open in IMG/M
3300006847|Ga0075431_101436190All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300006853|Ga0075420_101737875All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium534Open in IMG/M
3300006854|Ga0075425_100727447All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1139Open in IMG/M
3300006854|Ga0075425_101414710All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium787Open in IMG/M
3300006871|Ga0075434_102559829All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300006881|Ga0068865_100315809All Organisms → cellular organisms → Bacteria1255Open in IMG/M
3300007076|Ga0075435_101759764All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300007255|Ga0099791_10596335All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium540Open in IMG/M
3300009094|Ga0111539_10150047All Organisms → cellular organisms → Bacteria2729Open in IMG/M
3300009146|Ga0105091_10704654All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium529Open in IMG/M
3300009147|Ga0114129_10825128All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1181Open in IMG/M
3300009148|Ga0105243_10628081All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1038Open in IMG/M
3300009156|Ga0111538_10982573All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1068Open in IMG/M
3300009168|Ga0105104_10355937All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium810Open in IMG/M
3300009678|Ga0105252_10298426All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium718Open in IMG/M
3300009816|Ga0105076_1117985Not Available526Open in IMG/M
3300010043|Ga0126380_10487533All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium942Open in IMG/M
3300010046|Ga0126384_11551904All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium622Open in IMG/M
3300010047|Ga0126382_10372703All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1103Open in IMG/M
3300010047|Ga0126382_11529939All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300010359|Ga0126376_10051881All Organisms → cellular organisms → Bacteria2906Open in IMG/M
3300010359|Ga0126376_11260343All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium757Open in IMG/M
3300010359|Ga0126376_13077500All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium516Open in IMG/M
3300010373|Ga0134128_11552847All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium729Open in IMG/M
3300010376|Ga0126381_103611506All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium606Open in IMG/M
3300010398|Ga0126383_10603278All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1169Open in IMG/M
3300010403|Ga0134123_11762677All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium672Open in IMG/M
3300011119|Ga0105246_10516947All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1017Open in IMG/M
3300011397|Ga0137444_1063455All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium577Open in IMG/M
3300011412|Ga0137424_1052940All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium747Open in IMG/M
3300011422|Ga0137425_1177788All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium532Open in IMG/M
3300011444|Ga0137463_1302326All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium585Open in IMG/M
3300011445|Ga0137427_10166368All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium911Open in IMG/M
3300012041|Ga0137430_1030330All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1424Open in IMG/M
3300012355|Ga0137369_10674182All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium713Open in IMG/M
3300012360|Ga0137375_11187465All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium585Open in IMG/M
3300012532|Ga0137373_10727107All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium738Open in IMG/M
3300012915|Ga0157302_10059360All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1105Open in IMG/M
3300012925|Ga0137419_10258918All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1314Open in IMG/M
3300013296|Ga0157374_12385455All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium556Open in IMG/M
3300014154|Ga0134075_10142394All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1023Open in IMG/M
3300014300|Ga0075321_1054633All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium718Open in IMG/M
3300015256|Ga0180073_1047350All Organisms → cellular organisms → Bacteria871Open in IMG/M
3300016404|Ga0182037_10178891All Organisms → cellular organisms → Bacteria1626Open in IMG/M
3300018063|Ga0184637_10465919All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium741Open in IMG/M
3300018072|Ga0184635_10291844All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium641Open in IMG/M
3300018075|Ga0184632_10344957All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium638Open in IMG/M
3300018422|Ga0190265_11230754All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium867Open in IMG/M
3300018422|Ga0190265_13212300All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium545Open in IMG/M
3300018429|Ga0190272_10039606All Organisms → cellular organisms → Bacteria2637Open in IMG/M
3300019228|Ga0180119_1283288All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1175Open in IMG/M
3300019377|Ga0190264_10705566All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium746Open in IMG/M
3300021080|Ga0210382_10367454All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium636Open in IMG/M
3300021344|Ga0193719_10248048All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium753Open in IMG/M
3300021560|Ga0126371_13312125All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium544Open in IMG/M
3300022563|Ga0212128_10818901All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium552Open in IMG/M
3300023064|Ga0247801_1063185All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium583Open in IMG/M
3300025903|Ga0207680_10528603All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium841Open in IMG/M
3300025920|Ga0207649_11265098All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium583Open in IMG/M
3300025959|Ga0210116_1015583All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1395Open in IMG/M
3300025988|Ga0208141_1028238All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium536Open in IMG/M
3300026089|Ga0207648_11559942All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium621Open in IMG/M
3300026118|Ga0207675_102265064Not Available557Open in IMG/M
3300026324|Ga0209470_1178404All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium919Open in IMG/M
3300027006|Ga0209896_1037730All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium555Open in IMG/M
3300027873|Ga0209814_10300537All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium699Open in IMG/M
3300027874|Ga0209465_10028660All Organisms → cellular organisms → Bacteria2612Open in IMG/M
3300028381|Ga0268264_11253508All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium751Open in IMG/M
3300028803|Ga0307281_10125526All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium883Open in IMG/M
3300030606|Ga0299906_11097094All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium578Open in IMG/M
3300031455|Ga0307505_10395899All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium657Open in IMG/M
3300031740|Ga0307468_100015065All Organisms → cellular organisms → Bacteria3207Open in IMG/M
3300031854|Ga0310904_10891216All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium628Open in IMG/M
3300031965|Ga0326597_11099567All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium794Open in IMG/M
3300032001|Ga0306922_10381118All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1512Open in IMG/M
3300032005|Ga0307411_10612915All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium937Open in IMG/M
3300032163|Ga0315281_10698963All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1056Open in IMG/M
3300033487|Ga0316630_10186872All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1507Open in IMG/M
3300034115|Ga0364945_0264627All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium532Open in IMG/M
3300034177|Ga0364932_0045723All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1648Open in IMG/M
3300034178|Ga0364934_0239133All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium688Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere13.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil9.26%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil9.26%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil7.41%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.48%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.63%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands2.78%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.78%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment2.78%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.85%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.85%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.85%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.85%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.85%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.85%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.85%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.93%
Thermal SpringsEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.93%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.93%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.93%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.93%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.93%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.93%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.93%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.93%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere0.93%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2140918013Soil microbial communities from Great Prairies - Iowa soil (MSU Assemblies)EnvironmentalOpen in IMG/M
2162886007Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
2170459010Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!)EnvironmentalOpen in IMG/M
2199352025Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOILEnvironmentalOpen in IMG/M
3300000793Forest soil microbial communities from Amazon forest - 2010 replicate II A001EnvironmentalOpen in IMG/M
3300000881Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soilEnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300003999Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2EnvironmentalOpen in IMG/M
3300004070Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009146Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009678Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100EnvironmentalOpen in IMG/M
3300009816Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011397Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT319_2EnvironmentalOpen in IMG/M
3300011412Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT620_2EnvironmentalOpen in IMG/M
3300011422Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT640_2EnvironmentalOpen in IMG/M
3300011444Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2EnvironmentalOpen in IMG/M
3300011445Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2EnvironmentalOpen in IMG/M
3300012041Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT754_2EnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300014154Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015EnvironmentalOpen in IMG/M
3300014300Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D1EnvironmentalOpen in IMG/M
3300015256Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT333_16_10DEnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300019228Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT790_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022563OV2_combined assemblyEnvironmentalOpen in IMG/M
3300023064Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S001-104B-6EnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025959Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025988Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_101 (SPAdes)EnvironmentalOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300027006Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028803Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120EnvironmentalOpen in IMG/M
3300030606Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125EnvironmentalOpen in IMG/M
3300031455Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_SEnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300033487Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_AEnvironmentalOpen in IMG/M
3300034115Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17EnvironmentalOpen in IMG/M
3300034177Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17EnvironmentalOpen in IMG/M
3300034178Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Iowa-Corn-GraphCirc_028193602140918013SoilMFKLDHKLAPDEFIGTFFEANRQDHQRPPHPWEAIFREGKATRDQLHGWGKER
SwRhRL2b_0607.000019702162886007Switchgrass RhizosphereMYKLDHILSPDEFIQTFSEVNKSDHQRPPHPWETLFREGKCSRE
F62_061492602170459010Grass SoilMFKIDHKLSPDEFIQTFFEANKSDHQTPPHPWEILFRGGNC
deepsgr_011451502199352025SoilMFKIDHKLSPDGFIQTFFEANKSDHQRPPHPWEILFRRELLG
AF_2010_repII_A001DRAFT_1009395513300000793Forest SoilVFKLDRKLDPDEFIQTFSEVNKNDHQRPPHPWETLF
JGI10215J12807_156427613300000881SoilMFSLDRKLKPDEFIETFFAVNKQDHQRPPHPWEAIFREG
JGI11643J12802_1116931323300000890SoilMFKLDHKLAPDEFIGTFFEANRQDHQRPPHPWEAIFREG
JGI10214J12806_1208004823300000891SoilMFKLDRKLLPDEFIQTFFEANRQDHHRPPHPWEAIFRE
F14TB_10004478323300001431SoilMYKLDHILSPDEFIQTFSEVNKSDHQRPPHPWETLFRGGKCTRDQLQGWAKERYYF
Ga0055469_1012268023300003999Natural And Restored WetlandsMFKLDHKLAPDEFIQTFFEVNRQDHQRPPHPWEALFREGKCTREQLQGWAKE
Ga0055488_1002682513300004070Natural And Restored WetlandsMFTLSHKLNADEFIQTFFEVNRQDHQRPAHPWEEIFRNGKCTKEQLQGWGKERYYFTK
Ga0062592_10041054423300004480SoilMFKLDHKLAPDEFIGTFFEANRQDHQRPPHPWEAIFREGKATRDQLHGW
Ga0062591_10034618313300004643SoilMFTLSQKLNPDEFIKTFFEANRQDHQRPAHPWDEIFRNGKCSRE
Ga0066676_1027533123300005186SoilMFKIDHKLGPDEFIQTFFEANKSDHQRPPHPWEILFRGGNC*
Ga0070680_10116229523300005336Corn RhizosphereMFKLDRKLLPDEFIQTFFEANRQDHQRPPHPWEAIFREGKATREQLHGWGKERYYFTKQVPI
Ga0070660_10009894433300005339Corn RhizosphereMFSLDRKLKPDEFIETFFAVNKQDHQRPPHPWEAIFREGKCTREQLQ
Ga0070674_10034099523300005356Miscanthus RhizosphereMFTLDQKLGPDEFIKTFYEANRQDHQRPPHPWEALFREGKCTREQLQGWGKERY
Ga0070708_10069624513300005445Corn, Switchgrass And Miscanthus RhizosphereMYKLDQKLSPDDFIQTFFAVNKSDHQRPPHPWETLFRGGKCTKEQLQGWAKERFYF
Ga0066686_1061998023300005446SoilMYKLAQKLSPAEFKETFARVNKEDHQRPPHPWDLLFRDGKCTK
Ga0070697_10190945823300005536Corn, Switchgrass And Miscanthus RhizosphereMFKLEQKLRPNEFIETFFQVNKNDHQRSPHPWETLFREGKCT
Ga0066905_10056497723300005713Tropical Forest SoilMYKLDHILSPDEFIQTFSEVNKSDHQRPPHPWETLFRGGKCTREQLQGWAK
Ga0075417_1036586213300006049Populus RhizosphereMFKLESKLGPDEFIKTFYEANRQDHQRPPHPWEALFR
Ga0075422_1025078113300006196Populus RhizosphereMFKLDHKLAPEEFIQTFFEANRQDHQRSPHPWEALFRDGKCTRE
Ga0079221_1004483513300006804Agricultural SoilMFSLDRKLTPDEFIETFFAVNKQDHQRPPHPWEAIFREGK
Ga0075430_10101188113300006846Populus RhizosphereMFTLSQKLNPDEFIKTFFEANRQDHQRPAHPWDEIFRNGKCSREQLQGWG
Ga0075430_10147677523300006846Populus RhizosphereMFTLTQKLNPDEFIKTFFDANRQDHQRPAHPWDEIFRNGKCSREQLQG
Ga0075430_10174603123300006846Populus RhizosphereMFNLTDRLSPDEFIDTFFEVNKRDHQRSPHPWDALFRDGRCTKEQLQGW
Ga0075431_10143619013300006847Populus RhizosphereMFKLESKLGPDEFIKTFYEANRQDHQRLPHPWEALFREGKCTQEQLQGWGK
Ga0075420_10173787523300006853Populus RhizosphereMFTLSQKLNPDEFIKTFFEANRQDHQRPAHPWDEIFRNGKCSREQLQ
Ga0075425_10072744713300006854Populus RhizosphereMYILERKLNPDEFIDIFFAVNKNDHQRPPHPWETLFRGGKC
Ga0075425_10141471023300006854Populus RhizosphereMYKLDQKLSPDDFIQTFFAVNKSDHQRPPHPWETLFRGGKCTKEQL
Ga0075434_10255982913300006871Populus RhizosphereMFKLEQKLSPEEFIRTFFEVNRNDHQRPPHPWEALFQEG
Ga0068865_10031580923300006881Miscanthus RhizosphereMFSLDRKLTPDEFIETFFAVNKQDHQRPPHPWEAIFREGKCTKEQLQGWGKERYYFTKQV
Ga0075435_10175976413300007076Populus RhizosphereMFKLDHKLAPDDFIKTFFEVNKNDHQRPPHPWETLFRGGKCTKEQLQGWGKERYYFV
Ga0099791_1059633523300007255Vadose Zone SoilMFKLDHKLAPDEFIQIFFDANRQDHQRPPHPWEAIFR
Ga0111539_1015004733300009094Populus RhizosphereMFKLDHKLAPEEFIQTFFEANRQDHQRSPHPWEALF
Ga0105091_1070465413300009146Freshwater SedimentVRVIKGAATVYKLEGKLEPDEFIEMFFQVNKNDHQRPPHPWDALFGEVKCTKAQLQGWAKERYYF
Ga0114129_1082512813300009147Populus RhizosphereMFKLDQKLGPDEFIKTFYEANRQDHQRPPHPWEALFREGKCTQEQLQGWGKERYYF
Ga0105243_1062808113300009148Miscanthus RhizosphereMFKLDRKLAADEFIQTFFDANRQDHQRPPHPWEAIFRDGKCTKEQLQGWGK
Ga0111538_1098257323300009156Populus RhizosphereMLRPCIVTSSKGITFMFTLDRKLGPDEFIKTFYEANRQDHQRPPHPWEALFRDGKCTREQLQGWGKERYYFTKQVPI
Ga0105104_1035593723300009168Freshwater SedimentMYKLDHVLSPDEFIQTFSDVNKNDHQRPPHPWEVLFREGKC
Ga0105252_1029842613300009678SoilMFTLAHKLNPDEFIKTFFEVNRHDHQRPAHPWEEIFRNGKCTKEQLQGWGKERYYFTKQV
Ga0105076_111798513300009816Groundwater SandMFTLAQKLTPDEFIKTFFEANRQDHQRPAHPWEDIFRNGKCTKEQLQGWGKERYY
Ga0126380_1048753323300010043Tropical Forest SoilMYKLDHRLSPDEFIQTFSEVNKNDHQRPPHPWETL
Ga0126384_1155190423300010046Tropical Forest SoilMFKLERKLSPDEFISTFFDVNRKDHQRPPHPWETLFRTGQCSRGQLQGWA
Ga0126382_1037270313300010047Tropical Forest SoilVFKLERKLDPDEFGQTFSEVNKNDHQRPPHPWETLFREGKCTREQLQGWAKER
Ga0126382_1152993923300010047Tropical Forest SoilRLSPDEFIQTFSEVNKNDHQRPPHPWETLFRGGKCTREQLQGWAKERYYVS*
Ga0126376_1005188113300010359Tropical Forest SoilMYKLDQKLSPDDFIQTFFEVNKDDHQRPPHPWETLFRGGKCTKEQLQGWAKE
Ga0126376_1126034323300010359Tropical Forest SoilPDEFIQTFSEVNKNDHQRPPHPWETLFRGGKCTREQLQGWAKERYYVS*
Ga0126376_1307750013300010359Tropical Forest SoilVFKLDRKLDPDEFIQTFSEVNKNDHQRRPHPWETLFREGKCTREQLQGWAKERYYVS*
Ga0134128_1155284723300010373Terrestrial SoilMFKLDRKLAADEFIQTFFDANRQDHQRQPTHPWEDLFRNGKCTREQLQGWGKERYYFTKQVPI
Ga0126381_10361150623300010376Tropical Forest SoilMYKLDQKLSPDDFIQTFFEVNKDDHQRPPHPWETLFRGGKCTKEQLQGWAK
Ga0126383_1060327823300010398Tropical Forest SoilVFKLDRKLDPDEFIQTFSEVNKNDHQRPPHPWETLFREGKCTREQLQGWAKERYYVS*
Ga0134123_1176267723300010403Terrestrial SoilMFKLDRKLLPDEFIQTFFEANRQDHQRPPHPWEAIFREGKATREQLHGWGKERYYFTKQVPIKEYS
Ga0105246_1051694723300011119Miscanthus RhizosphereMFKLDRKLAADEFIQTFFDANRQDHQRPPHPWEAIFREGKCTREQLQGWAKERY
Ga0137444_106345513300011397SoilMFTLDQKLSPDEFIKTFFEANRQDHQRPPHPWEEI
Ga0137424_105294023300011412SoilMFTLSQKLNPDEFIKTFFEANRQDHQRPAHPWDEIFRNGKCSREQLQGWGKERYYFT
Ga0137425_117778823300011422SoilMFTLDQKLSPDEFIKTFFEANRQDHQRPPHPWEEIFRNGKCTKEQLQGWGKERY*
Ga0137463_130232623300011444SoilMFTLDQKLGPDEFIKTFYEANRQDHQRPPHPWEALFRDGKCTREQLQGWGKERYYFTKQV
Ga0137427_1016636813300011445SoilMFTLDQKLSPDEFIKTFFEANRQDHQRPPHPWEELFRNGKCTKEQLQGWGKERYYFTKQV
Ga0137430_103033033300012041SoilMFTLSQKLNPDEFINTFFEANRQDHQRPAHPWEKIFRNGKCTKEQLQGWGKERYYFT
Ga0137369_1067418213300012355Vadose Zone SoilMFLLDHKLSPDEFIATFFETNRQDHQRPPHPWEAMFREGKCSKEQLQGW
Ga0137375_1118746523300012360Vadose Zone SoilMFTLDRKLSPDEFIATFFETNRQDHQRPPHPWEAMFREGKCSKE
Ga0137373_1072710723300012532Vadose Zone SoilMFKVDHKLSPDEFIQTFSEANKSDHQRPPHPWESLFRGGKCTKDQLQ
Ga0157302_1005936023300012915SoilMFSLDRKLTPDEFIETFFAVNKQDHQRPPHPWEAIFREGKCTREQLQGWAK
Ga0137419_1025891813300012925Vadose Zone SoilMFTLDQKLGPDEFIKTFYEANRQDHQRPPHPWEAIFREGKCTQEQLQ
Ga0157374_1238545523300013296Miscanthus RhizosphereMFSLDRKLTPDEFIETFFAVNKQDHQRPPHPWEAIFREGKCTRE
Ga0134075_1014239413300014154Grasslands SoilMFTLDRKLSPDEFITTFFEANRQDHQRLPHPWEAIFREGKCSKEQLQG
Ga0075321_105463323300014300Natural And Restored WetlandsMFKLDRKLAPDEFIQTFFEANRQDHQCPPHPWEAIFRNGKATQDQLQGWAKER
Ga0180073_104735013300015256SoilMFKLEHKLNPDAFIDTFIEVNRNDHQRPPHPWETLFRDGKCTKEQLQGWAKERYY
Ga0182037_1017889113300016404SoilMFSLDHKLTPDEFIETFFAVNKQDHQRPPHPWETIFREGKCT
Ga0184637_1046591913300018063Groundwater SedimentMFKLDHKLSPDEFINTFFEANRQDHQRPPHPWEAIFREGKCTTEQLQGWAKERYY
Ga0184635_1029184413300018072Groundwater SedimentVVKLERKLDPDEFIQTFSEVNKSDHQRPPHPWETLFREGKCSREQLQGW
Ga0184632_1034495723300018075Groundwater SedimentMFKLDHKLSPDEFIDTFLEANRQDHQRPPHPWEAIFRE
Ga0190265_1123075413300018422SoilMFTLDHKLSPDAFITTFFEVNRQDHQRPAHPWEEIFRNGKCTKEQLQGW
Ga0190265_1321230023300018422SoilMFKLDRKLSPDEFIATFYETNKKDHERPPHPWDLLFRTGKCTPEQLQ
Ga0190272_1003960613300018429SoilMFTLDHKLSPDEFIKTFFDVNRQDHQRPPHPWEELFRNGKC
Ga0180119_128328813300019228Groundwater SedimentVFKLERKLAPDEFIKTFFEVNRNDHQRPPHPWETLFREGKCTKEQLRGWAKE
Ga0190264_1070556623300019377SoilVFKLDHKLTPDEFIKTFFEVNKQDHQRPPHPWDALFREGKCTKEQL
Ga0210382_1036745423300021080Groundwater SedimentMFKLDHKLNPDEFITKFFEAKRQDHQRAPHPWETLFR
Ga0193719_1024804823300021344SoilMFTLDQKLGPDEFIKTFYEANRQDHQRPPHPWEAIFREGKCTQEQLQGWG
Ga0126371_1331212523300021560Tropical Forest SoilVFKLDRKLDPDEFIQTFSEVNKNDHQRPPHPWETLFREGKCTREQLQGWAKERYYVS
Ga0212128_1081890123300022563Thermal SpringsMHKLERTLSPDEFIQTFFEVNKKDHQRPLHPWDAL
Ga0247801_106318523300023064SoilMFSLDRKLTPDEFIETFFAVNKQDHQRPPHPWEAIFREGKCTREQL
Ga0207680_1052860323300025903Switchgrass RhizosphereMFSLDRKLTPDEFIETFFAVNKQDHQRPPHPWEAIFREGKCTREQLQGWAKE
Ga0207649_1126509823300025920Corn RhizosphereMFSLDRKLTPDEFVETFFAVNKQDHQRPPHPWEAIFRA
Ga0210116_101558323300025959Natural And Restored WetlandsMFTLSHKLNADEFIQTFFEVNRQDHQRPAHPWEEIFRNGKCTKEQLQGWGK
Ga0208141_102823823300025988Rice Paddy SoilMFKLDGKLGPDEFIRTFFEANRQDHQRPPHPWEAIFRQGKCTREQLQGWAKERYY
Ga0207648_1155994213300026089Miscanthus RhizosphereMFSLDRKLSPDDFINTFFDVNRKDHQGSPHPWESLFREGKCTKEQ
Ga0207675_10226506413300026118Switchgrass RhizosphereMFTLSQKLDPDEFIKTFFEANRQDHQRPAHPWDEIFRSGKCTKEQ
Ga0209470_117840423300026324SoilMFTLDRKLSPDEFITTFFEATRQDHQRPPHPWEAIFREGKC
Ga0209896_103773013300027006Groundwater SandMFKLDHKLSPDEFIQTFFEANKSDHQRPPHPWETLFRGGKCTKDQLQGWAKE
Ga0209814_1030053723300027873Populus RhizosphereMFKLDHKLNPDEFISTFFEANRQDHQRPAHPWEALFREGKCSKEQLQG
Ga0209465_1002866013300027874Tropical Forest SoilVFKLDRKLDPDEFIQTFSEVNKNDHQRPPHPWETLFREG
Ga0268264_1125350813300028381Switchgrass RhizosphereMFKLDHQLAPEEFIQTFFEANRQDHQRSPHPWEALFRDGKCTREQL
Ga0307281_1012552623300028803SoilMFTLARKLNSDEFISTFFEANRQDHQRPAHPWEEIFRNGKCTKEQLQGWGK
Ga0299906_1109709413300030606SoilMFKLDRKLGPDEFIATFFEANKRDHQRPPHPWESIFRSGKCTKEQLQGWAK
Ga0307505_1039589913300031455SoilMFTLDHKLSPDAFITTFFAVNRQDHQRPPHPWEELFRNGKCSNEQL
Ga0307468_10001506533300031740Hardwood Forest SoilMFKIDHKLGPDEFIQTFFEANKSDHQRPPHPWEILFRGGNC
Ga0310904_1089121613300031854SoilMFKLDRKLLPDEFIQTFFEANRQDHQRPPHPWEAIFREGKATREQL
Ga0326597_1109956723300031965SoilMFKLDRKLGPDEFIATFFEANKRDHQRPPHPWESIFRAGKCTKEQLQ
Ga0306922_1038111813300032001SoilMFSLDHKLTPDEFIETFFAVNKQDHQRPPHPWETIFR
Ga0307411_1061291523300032005RhizosphereMFTLSHKLNPDEFIKTFFEVNRLDHQRPAHPWEEIFR
Ga0315281_1069896323300032163SedimentMFTLAQKLNPDEFIKTFFETNRQDHQRQPHPWDELFHNGKC
Ga0316630_1018687213300033487SoilMFTLSHKLNPDEFIKTFFEVNRQDHQRPAHPWEEI
Ga0364945_0264627_408_5303300034115SedimentMFKLDRKLAPGEFIQTFFDANRQDHQRPPHPWEAIFREGKC
Ga0364932_0045723_2_1063300034177SedimentMFTLRQKLSPDEFIKTFFEANRQDHQRPPHPWEEI
Ga0364934_0239133_1_1623300034178SedimentMFKLENKLGPDAFIDTFLEVNRNDHQRPPHPWETLFREGRCTREQLQGWAKERY


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.