Basic Information | |
---|---|
Family ID | F090595 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 108 |
Average Sequence Length | 48 residues |
Representative Sequence | MFKLDHKLAPDEFIQTFFEVNRQDHQRPPHPWEALFREGKCTREQLQGWAKE |
Number of Associated Samples | 101 |
Number of Associated Scaffolds | 108 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 98.15 % |
% of genes near scaffold ends (potentially truncated) | 91.67 % |
% of genes from short scaffolds (< 2000 bps) | 94.44 % |
Associated GOLD sequencing projects | 97 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.41 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (98.148 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (13.889 % of family members) |
Environment Ontology (ENVO) | Unclassified (31.481 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (36.111 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.00% β-sheet: 0.00% Coil/Unstructured: 65.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 108 Family Scaffolds |
---|---|---|
PF07883 | Cupin_2 | 81.48 |
PF02887 | PK_C | 4.63 |
PF09084 | NMT1 | 0.93 |
PF04359 | DUF493 | 0.93 |
PF05598 | DUF772 | 0.93 |
PF07394 | DUF1501 | 0.93 |
COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
---|---|---|---|
COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 4.63 |
COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.93 |
COG2921 | Putative lipoate-binding regulatory protein, UPF0250 family | Signal transduction mechanisms [T] | 0.93 |
COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.93 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 98.15 % |
Unclassified | root | N/A | 1.85 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2140918013|NODE_251612_length_1960_cov_7.995408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1992 | Open in IMG/M |
2162886007|SwRhRL2b_contig_1187219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 876 | Open in IMG/M |
2170459010|GIO7OMY01C41FW | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 505 | Open in IMG/M |
2199352025|deepsgr__Contig_80163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 572 | Open in IMG/M |
3300000793|AF_2010_repII_A001DRAFT_10093955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 635 | Open in IMG/M |
3300000881|JGI10215J12807_1564276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 620 | Open in IMG/M |
3300000890|JGI11643J12802_11169313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 915 | Open in IMG/M |
3300000891|JGI10214J12806_12080048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 531 | Open in IMG/M |
3300001431|F14TB_100044783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 781 | Open in IMG/M |
3300003999|Ga0055469_10122680 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
3300004070|Ga0055488_10026825 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
3300004480|Ga0062592_100410544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1081 | Open in IMG/M |
3300004643|Ga0062591_100346183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1198 | Open in IMG/M |
3300005186|Ga0066676_10275331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1106 | Open in IMG/M |
3300005336|Ga0070680_101162295 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300005339|Ga0070660_100098944 | All Organisms → cellular organisms → Bacteria | 2309 | Open in IMG/M |
3300005356|Ga0070674_100340995 | All Organisms → cellular organisms → Bacteria | 1207 | Open in IMG/M |
3300005445|Ga0070708_100696245 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
3300005446|Ga0066686_10619980 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 735 | Open in IMG/M |
3300005536|Ga0070697_101909458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 531 | Open in IMG/M |
3300005713|Ga0066905_100564977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 957 | Open in IMG/M |
3300006049|Ga0075417_10365862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 709 | Open in IMG/M |
3300006196|Ga0075422_10250781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 744 | Open in IMG/M |
3300006804|Ga0079221_10044835 | All Organisms → cellular organisms → Bacteria | 1953 | Open in IMG/M |
3300006846|Ga0075430_101011881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 685 | Open in IMG/M |
3300006846|Ga0075430_101476775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 559 | Open in IMG/M |
3300006846|Ga0075430_101746031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 510 | Open in IMG/M |
3300006847|Ga0075431_101436190 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
3300006853|Ga0075420_101737875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 534 | Open in IMG/M |
3300006854|Ga0075425_100727447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1139 | Open in IMG/M |
3300006854|Ga0075425_101414710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 787 | Open in IMG/M |
3300006871|Ga0075434_102559829 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300006881|Ga0068865_100315809 | All Organisms → cellular organisms → Bacteria | 1255 | Open in IMG/M |
3300007076|Ga0075435_101759764 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300007255|Ga0099791_10596335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 540 | Open in IMG/M |
3300009094|Ga0111539_10150047 | All Organisms → cellular organisms → Bacteria | 2729 | Open in IMG/M |
3300009146|Ga0105091_10704654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 529 | Open in IMG/M |
3300009147|Ga0114129_10825128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1181 | Open in IMG/M |
3300009148|Ga0105243_10628081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1038 | Open in IMG/M |
3300009156|Ga0111538_10982573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1068 | Open in IMG/M |
3300009168|Ga0105104_10355937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 810 | Open in IMG/M |
3300009678|Ga0105252_10298426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 718 | Open in IMG/M |
3300009816|Ga0105076_1117985 | Not Available | 526 | Open in IMG/M |
3300010043|Ga0126380_10487533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 942 | Open in IMG/M |
3300010046|Ga0126384_11551904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 622 | Open in IMG/M |
3300010047|Ga0126382_10372703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1103 | Open in IMG/M |
3300010047|Ga0126382_11529939 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300010359|Ga0126376_10051881 | All Organisms → cellular organisms → Bacteria | 2906 | Open in IMG/M |
3300010359|Ga0126376_11260343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 757 | Open in IMG/M |
3300010359|Ga0126376_13077500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 516 | Open in IMG/M |
3300010373|Ga0134128_11552847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 729 | Open in IMG/M |
3300010376|Ga0126381_103611506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 606 | Open in IMG/M |
3300010398|Ga0126383_10603278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1169 | Open in IMG/M |
3300010403|Ga0134123_11762677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 672 | Open in IMG/M |
3300011119|Ga0105246_10516947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1017 | Open in IMG/M |
3300011397|Ga0137444_1063455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 577 | Open in IMG/M |
3300011412|Ga0137424_1052940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 747 | Open in IMG/M |
3300011422|Ga0137425_1177788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 532 | Open in IMG/M |
3300011444|Ga0137463_1302326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 585 | Open in IMG/M |
3300011445|Ga0137427_10166368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 911 | Open in IMG/M |
3300012041|Ga0137430_1030330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1424 | Open in IMG/M |
3300012355|Ga0137369_10674182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 713 | Open in IMG/M |
3300012360|Ga0137375_11187465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 585 | Open in IMG/M |
3300012532|Ga0137373_10727107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 738 | Open in IMG/M |
3300012915|Ga0157302_10059360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1105 | Open in IMG/M |
3300012925|Ga0137419_10258918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1314 | Open in IMG/M |
3300013296|Ga0157374_12385455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 556 | Open in IMG/M |
3300014154|Ga0134075_10142394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1023 | Open in IMG/M |
3300014300|Ga0075321_1054633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 718 | Open in IMG/M |
3300015256|Ga0180073_1047350 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
3300016404|Ga0182037_10178891 | All Organisms → cellular organisms → Bacteria | 1626 | Open in IMG/M |
3300018063|Ga0184637_10465919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 741 | Open in IMG/M |
3300018072|Ga0184635_10291844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 641 | Open in IMG/M |
3300018075|Ga0184632_10344957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 638 | Open in IMG/M |
3300018422|Ga0190265_11230754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 867 | Open in IMG/M |
3300018422|Ga0190265_13212300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 545 | Open in IMG/M |
3300018429|Ga0190272_10039606 | All Organisms → cellular organisms → Bacteria | 2637 | Open in IMG/M |
3300019228|Ga0180119_1283288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1175 | Open in IMG/M |
3300019377|Ga0190264_10705566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 746 | Open in IMG/M |
3300021080|Ga0210382_10367454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 636 | Open in IMG/M |
3300021344|Ga0193719_10248048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 753 | Open in IMG/M |
3300021560|Ga0126371_13312125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 544 | Open in IMG/M |
3300022563|Ga0212128_10818901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 552 | Open in IMG/M |
3300023064|Ga0247801_1063185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 583 | Open in IMG/M |
3300025903|Ga0207680_10528603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 841 | Open in IMG/M |
3300025920|Ga0207649_11265098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 583 | Open in IMG/M |
3300025959|Ga0210116_1015583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1395 | Open in IMG/M |
3300025988|Ga0208141_1028238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 536 | Open in IMG/M |
3300026089|Ga0207648_11559942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 621 | Open in IMG/M |
3300026118|Ga0207675_102265064 | Not Available | 557 | Open in IMG/M |
3300026324|Ga0209470_1178404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 919 | Open in IMG/M |
3300027006|Ga0209896_1037730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 555 | Open in IMG/M |
3300027873|Ga0209814_10300537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 699 | Open in IMG/M |
3300027874|Ga0209465_10028660 | All Organisms → cellular organisms → Bacteria | 2612 | Open in IMG/M |
3300028381|Ga0268264_11253508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 751 | Open in IMG/M |
3300028803|Ga0307281_10125526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 883 | Open in IMG/M |
3300030606|Ga0299906_11097094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 578 | Open in IMG/M |
3300031455|Ga0307505_10395899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 657 | Open in IMG/M |
3300031740|Ga0307468_100015065 | All Organisms → cellular organisms → Bacteria | 3207 | Open in IMG/M |
3300031854|Ga0310904_10891216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 628 | Open in IMG/M |
3300031965|Ga0326597_11099567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 794 | Open in IMG/M |
3300032001|Ga0306922_10381118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1512 | Open in IMG/M |
3300032005|Ga0307411_10612915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 937 | Open in IMG/M |
3300032163|Ga0315281_10698963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1056 | Open in IMG/M |
3300033487|Ga0316630_10186872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1507 | Open in IMG/M |
3300034115|Ga0364945_0264627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 532 | Open in IMG/M |
3300034177|Ga0364932_0045723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1648 | Open in IMG/M |
3300034178|Ga0364934_0239133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 688 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 13.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.26% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.26% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 7.41% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.48% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.63% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.78% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.78% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 2.78% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.85% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.85% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.85% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.85% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.85% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.85% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.85% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.85% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.85% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.85% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.93% |
Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.93% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.93% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.93% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.93% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.93% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.93% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.93% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.93% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.93% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.93% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.93% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2140918013 | Soil microbial communities from Great Prairies - Iowa soil (MSU Assemblies) | Environmental | Open in IMG/M |
2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
3300000881 | Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soil | Environmental | Open in IMG/M |
3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
3300003999 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 | Environmental | Open in IMG/M |
3300004070 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2 | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
3300009816 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300011397 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT319_2 | Environmental | Open in IMG/M |
3300011412 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT620_2 | Environmental | Open in IMG/M |
3300011422 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT640_2 | Environmental | Open in IMG/M |
3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
3300011445 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2 | Environmental | Open in IMG/M |
3300012041 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT754_2 | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300014300 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D1 | Environmental | Open in IMG/M |
3300015256 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT333_16_10D | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300019228 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT790_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022563 | OV2_combined assembly | Environmental | Open in IMG/M |
3300023064 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S001-104B-6 | Environmental | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025959 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025988 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_101 (SPAdes) | Environmental | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
3300027006 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 (SPAdes) | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
3300030606 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 | Environmental | Open in IMG/M |
3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
3300033487 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A | Environmental | Open in IMG/M |
3300034115 | Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17 | Environmental | Open in IMG/M |
3300034177 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17 | Environmental | Open in IMG/M |
3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Iowa-Corn-GraphCirc_02819360 | 2140918013 | Soil | MFKLDHKLAPDEFIGTFFEANRQDHQRPPHPWEAIFREGKATRDQLHGWGKER |
SwRhRL2b_0607.00001970 | 2162886007 | Switchgrass Rhizosphere | MYKLDHILSPDEFIQTFSEVNKSDHQRPPHPWETLFREGKCSRE |
F62_06149260 | 2170459010 | Grass Soil | MFKIDHKLSPDEFIQTFFEANKSDHQTPPHPWEILFRGGNC |
deepsgr_01145150 | 2199352025 | Soil | MFKIDHKLSPDGFIQTFFEANKSDHQRPPHPWEILFRRELLG |
AF_2010_repII_A001DRAFT_100939551 | 3300000793 | Forest Soil | VFKLDRKLDPDEFIQTFSEVNKNDHQRPPHPWETLF |
JGI10215J12807_15642761 | 3300000881 | Soil | MFSLDRKLKPDEFIETFFAVNKQDHQRPPHPWEAIFREG |
JGI11643J12802_111693132 | 3300000890 | Soil | MFKLDHKLAPDEFIGTFFEANRQDHQRPPHPWEAIFREG |
JGI10214J12806_120800482 | 3300000891 | Soil | MFKLDRKLLPDEFIQTFFEANRQDHHRPPHPWEAIFRE |
F14TB_1000447832 | 3300001431 | Soil | MYKLDHILSPDEFIQTFSEVNKSDHQRPPHPWETLFRGGKCTRDQLQGWAKERYYF |
Ga0055469_101226802 | 3300003999 | Natural And Restored Wetlands | MFKLDHKLAPDEFIQTFFEVNRQDHQRPPHPWEALFREGKCTREQLQGWAKE |
Ga0055488_100268251 | 3300004070 | Natural And Restored Wetlands | MFTLSHKLNADEFIQTFFEVNRQDHQRPAHPWEEIFRNGKCTKEQLQGWGKERYYFTK |
Ga0062592_1004105442 | 3300004480 | Soil | MFKLDHKLAPDEFIGTFFEANRQDHQRPPHPWEAIFREGKATRDQLHGW |
Ga0062591_1003461831 | 3300004643 | Soil | MFTLSQKLNPDEFIKTFFEANRQDHQRPAHPWDEIFRNGKCSRE |
Ga0066676_102753312 | 3300005186 | Soil | MFKIDHKLGPDEFIQTFFEANKSDHQRPPHPWEILFRGGNC* |
Ga0070680_1011622952 | 3300005336 | Corn Rhizosphere | MFKLDRKLLPDEFIQTFFEANRQDHQRPPHPWEAIFREGKATREQLHGWGKERYYFTKQVPI |
Ga0070660_1000989443 | 3300005339 | Corn Rhizosphere | MFSLDRKLKPDEFIETFFAVNKQDHQRPPHPWEAIFREGKCTREQLQ |
Ga0070674_1003409952 | 3300005356 | Miscanthus Rhizosphere | MFTLDQKLGPDEFIKTFYEANRQDHQRPPHPWEALFREGKCTREQLQGWGKERY |
Ga0070708_1006962451 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MYKLDQKLSPDDFIQTFFAVNKSDHQRPPHPWETLFRGGKCTKEQLQGWAKERFYF |
Ga0066686_106199802 | 3300005446 | Soil | MYKLAQKLSPAEFKETFARVNKEDHQRPPHPWDLLFRDGKCTK |
Ga0070697_1019094582 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MFKLEQKLRPNEFIETFFQVNKNDHQRSPHPWETLFREGKCT |
Ga0066905_1005649772 | 3300005713 | Tropical Forest Soil | MYKLDHILSPDEFIQTFSEVNKSDHQRPPHPWETLFRGGKCTREQLQGWAK |
Ga0075417_103658621 | 3300006049 | Populus Rhizosphere | MFKLESKLGPDEFIKTFYEANRQDHQRPPHPWEALFR |
Ga0075422_102507811 | 3300006196 | Populus Rhizosphere | MFKLDHKLAPEEFIQTFFEANRQDHQRSPHPWEALFRDGKCTRE |
Ga0079221_100448351 | 3300006804 | Agricultural Soil | MFSLDRKLTPDEFIETFFAVNKQDHQRPPHPWEAIFREGK |
Ga0075430_1010118811 | 3300006846 | Populus Rhizosphere | MFTLSQKLNPDEFIKTFFEANRQDHQRPAHPWDEIFRNGKCSREQLQGWG |
Ga0075430_1014767752 | 3300006846 | Populus Rhizosphere | MFTLTQKLNPDEFIKTFFDANRQDHQRPAHPWDEIFRNGKCSREQLQG |
Ga0075430_1017460312 | 3300006846 | Populus Rhizosphere | MFNLTDRLSPDEFIDTFFEVNKRDHQRSPHPWDALFRDGRCTKEQLQGW |
Ga0075431_1014361901 | 3300006847 | Populus Rhizosphere | MFKLESKLGPDEFIKTFYEANRQDHQRLPHPWEALFREGKCTQEQLQGWGK |
Ga0075420_1017378752 | 3300006853 | Populus Rhizosphere | MFTLSQKLNPDEFIKTFFEANRQDHQRPAHPWDEIFRNGKCSREQLQ |
Ga0075425_1007274471 | 3300006854 | Populus Rhizosphere | MYILERKLNPDEFIDIFFAVNKNDHQRPPHPWETLFRGGKC |
Ga0075425_1014147102 | 3300006854 | Populus Rhizosphere | MYKLDQKLSPDDFIQTFFAVNKSDHQRPPHPWETLFRGGKCTKEQL |
Ga0075434_1025598291 | 3300006871 | Populus Rhizosphere | MFKLEQKLSPEEFIRTFFEVNRNDHQRPPHPWEALFQEG |
Ga0068865_1003158092 | 3300006881 | Miscanthus Rhizosphere | MFSLDRKLTPDEFIETFFAVNKQDHQRPPHPWEAIFREGKCTKEQLQGWGKERYYFTKQV |
Ga0075435_1017597641 | 3300007076 | Populus Rhizosphere | MFKLDHKLAPDDFIKTFFEVNKNDHQRPPHPWETLFRGGKCTKEQLQGWGKERYYFV |
Ga0099791_105963352 | 3300007255 | Vadose Zone Soil | MFKLDHKLAPDEFIQIFFDANRQDHQRPPHPWEAIFR |
Ga0111539_101500473 | 3300009094 | Populus Rhizosphere | MFKLDHKLAPEEFIQTFFEANRQDHQRSPHPWEALF |
Ga0105091_107046541 | 3300009146 | Freshwater Sediment | VRVIKGAATVYKLEGKLEPDEFIEMFFQVNKNDHQRPPHPWDALFGEVKCTKAQLQGWAKERYYF |
Ga0114129_108251281 | 3300009147 | Populus Rhizosphere | MFKLDQKLGPDEFIKTFYEANRQDHQRPPHPWEALFREGKCTQEQLQGWGKERYYF |
Ga0105243_106280811 | 3300009148 | Miscanthus Rhizosphere | MFKLDRKLAADEFIQTFFDANRQDHQRPPHPWEAIFRDGKCTKEQLQGWGK |
Ga0111538_109825732 | 3300009156 | Populus Rhizosphere | MLRPCIVTSSKGITFMFTLDRKLGPDEFIKTFYEANRQDHQRPPHPWEALFRDGKCTREQLQGWGKERYYFTKQVPI |
Ga0105104_103559372 | 3300009168 | Freshwater Sediment | MYKLDHVLSPDEFIQTFSDVNKNDHQRPPHPWEVLFREGKC |
Ga0105252_102984261 | 3300009678 | Soil | MFTLAHKLNPDEFIKTFFEVNRHDHQRPAHPWEEIFRNGKCTKEQLQGWGKERYYFTKQV |
Ga0105076_11179851 | 3300009816 | Groundwater Sand | MFTLAQKLTPDEFIKTFFEANRQDHQRPAHPWEDIFRNGKCTKEQLQGWGKERYY |
Ga0126380_104875332 | 3300010043 | Tropical Forest Soil | MYKLDHRLSPDEFIQTFSEVNKNDHQRPPHPWETL |
Ga0126384_115519042 | 3300010046 | Tropical Forest Soil | MFKLERKLSPDEFISTFFDVNRKDHQRPPHPWETLFRTGQCSRGQLQGWA |
Ga0126382_103727031 | 3300010047 | Tropical Forest Soil | VFKLERKLDPDEFGQTFSEVNKNDHQRPPHPWETLFREGKCTREQLQGWAKER |
Ga0126382_115299392 | 3300010047 | Tropical Forest Soil | RLSPDEFIQTFSEVNKNDHQRPPHPWETLFRGGKCTREQLQGWAKERYYVS* |
Ga0126376_100518811 | 3300010359 | Tropical Forest Soil | MYKLDQKLSPDDFIQTFFEVNKDDHQRPPHPWETLFRGGKCTKEQLQGWAKE |
Ga0126376_112603432 | 3300010359 | Tropical Forest Soil | PDEFIQTFSEVNKNDHQRPPHPWETLFRGGKCTREQLQGWAKERYYVS* |
Ga0126376_130775001 | 3300010359 | Tropical Forest Soil | VFKLDRKLDPDEFIQTFSEVNKNDHQRRPHPWETLFREGKCTREQLQGWAKERYYVS* |
Ga0134128_115528472 | 3300010373 | Terrestrial Soil | MFKLDRKLAADEFIQTFFDANRQDHQRQPTHPWEDLFRNGKCTREQLQGWGKERYYFTKQVPI |
Ga0126381_1036115062 | 3300010376 | Tropical Forest Soil | MYKLDQKLSPDDFIQTFFEVNKDDHQRPPHPWETLFRGGKCTKEQLQGWAK |
Ga0126383_106032782 | 3300010398 | Tropical Forest Soil | VFKLDRKLDPDEFIQTFSEVNKNDHQRPPHPWETLFREGKCTREQLQGWAKERYYVS* |
Ga0134123_117626772 | 3300010403 | Terrestrial Soil | MFKLDRKLLPDEFIQTFFEANRQDHQRPPHPWEAIFREGKATREQLHGWGKERYYFTKQVPIKEYS |
Ga0105246_105169472 | 3300011119 | Miscanthus Rhizosphere | MFKLDRKLAADEFIQTFFDANRQDHQRPPHPWEAIFREGKCTREQLQGWAKERY |
Ga0137444_10634551 | 3300011397 | Soil | MFTLDQKLSPDEFIKTFFEANRQDHQRPPHPWEEI |
Ga0137424_10529402 | 3300011412 | Soil | MFTLSQKLNPDEFIKTFFEANRQDHQRPAHPWDEIFRNGKCSREQLQGWGKERYYFT |
Ga0137425_11777882 | 3300011422 | Soil | MFTLDQKLSPDEFIKTFFEANRQDHQRPPHPWEEIFRNGKCTKEQLQGWGKERY* |
Ga0137463_13023262 | 3300011444 | Soil | MFTLDQKLGPDEFIKTFYEANRQDHQRPPHPWEALFRDGKCTREQLQGWGKERYYFTKQV |
Ga0137427_101663681 | 3300011445 | Soil | MFTLDQKLSPDEFIKTFFEANRQDHQRPPHPWEELFRNGKCTKEQLQGWGKERYYFTKQV |
Ga0137430_10303303 | 3300012041 | Soil | MFTLSQKLNPDEFINTFFEANRQDHQRPAHPWEKIFRNGKCTKEQLQGWGKERYYFT |
Ga0137369_106741821 | 3300012355 | Vadose Zone Soil | MFLLDHKLSPDEFIATFFETNRQDHQRPPHPWEAMFREGKCSKEQLQGW |
Ga0137375_111874652 | 3300012360 | Vadose Zone Soil | MFTLDRKLSPDEFIATFFETNRQDHQRPPHPWEAMFREGKCSKE |
Ga0137373_107271072 | 3300012532 | Vadose Zone Soil | MFKVDHKLSPDEFIQTFSEANKSDHQRPPHPWESLFRGGKCTKDQLQ |
Ga0157302_100593602 | 3300012915 | Soil | MFSLDRKLTPDEFIETFFAVNKQDHQRPPHPWEAIFREGKCTREQLQGWAK |
Ga0137419_102589181 | 3300012925 | Vadose Zone Soil | MFTLDQKLGPDEFIKTFYEANRQDHQRPPHPWEAIFREGKCTQEQLQ |
Ga0157374_123854552 | 3300013296 | Miscanthus Rhizosphere | MFSLDRKLTPDEFIETFFAVNKQDHQRPPHPWEAIFREGKCTRE |
Ga0134075_101423941 | 3300014154 | Grasslands Soil | MFTLDRKLSPDEFITTFFEANRQDHQRLPHPWEAIFREGKCSKEQLQG |
Ga0075321_10546332 | 3300014300 | Natural And Restored Wetlands | MFKLDRKLAPDEFIQTFFEANRQDHQCPPHPWEAIFRNGKATQDQLQGWAKER |
Ga0180073_10473501 | 3300015256 | Soil | MFKLEHKLNPDAFIDTFIEVNRNDHQRPPHPWETLFRDGKCTKEQLQGWAKERYY |
Ga0182037_101788911 | 3300016404 | Soil | MFSLDHKLTPDEFIETFFAVNKQDHQRPPHPWETIFREGKCT |
Ga0184637_104659191 | 3300018063 | Groundwater Sediment | MFKLDHKLSPDEFINTFFEANRQDHQRPPHPWEAIFREGKCTTEQLQGWAKERYY |
Ga0184635_102918441 | 3300018072 | Groundwater Sediment | VVKLERKLDPDEFIQTFSEVNKSDHQRPPHPWETLFREGKCSREQLQGW |
Ga0184632_103449572 | 3300018075 | Groundwater Sediment | MFKLDHKLSPDEFIDTFLEANRQDHQRPPHPWEAIFRE |
Ga0190265_112307541 | 3300018422 | Soil | MFTLDHKLSPDAFITTFFEVNRQDHQRPAHPWEEIFRNGKCTKEQLQGW |
Ga0190265_132123002 | 3300018422 | Soil | MFKLDRKLSPDEFIATFYETNKKDHERPPHPWDLLFRTGKCTPEQLQ |
Ga0190272_100396061 | 3300018429 | Soil | MFTLDHKLSPDEFIKTFFDVNRQDHQRPPHPWEELFRNGKC |
Ga0180119_12832881 | 3300019228 | Groundwater Sediment | VFKLERKLAPDEFIKTFFEVNRNDHQRPPHPWETLFREGKCTKEQLRGWAKE |
Ga0190264_107055662 | 3300019377 | Soil | VFKLDHKLTPDEFIKTFFEVNKQDHQRPPHPWDALFREGKCTKEQL |
Ga0210382_103674542 | 3300021080 | Groundwater Sediment | MFKLDHKLNPDEFITKFFEAKRQDHQRAPHPWETLFR |
Ga0193719_102480482 | 3300021344 | Soil | MFTLDQKLGPDEFIKTFYEANRQDHQRPPHPWEAIFREGKCTQEQLQGWG |
Ga0126371_133121252 | 3300021560 | Tropical Forest Soil | VFKLDRKLDPDEFIQTFSEVNKNDHQRPPHPWETLFREGKCTREQLQGWAKERYYVS |
Ga0212128_108189012 | 3300022563 | Thermal Springs | MHKLERTLSPDEFIQTFFEVNKKDHQRPLHPWDAL |
Ga0247801_10631852 | 3300023064 | Soil | MFSLDRKLTPDEFIETFFAVNKQDHQRPPHPWEAIFREGKCTREQL |
Ga0207680_105286032 | 3300025903 | Switchgrass Rhizosphere | MFSLDRKLTPDEFIETFFAVNKQDHQRPPHPWEAIFREGKCTREQLQGWAKE |
Ga0207649_112650982 | 3300025920 | Corn Rhizosphere | MFSLDRKLTPDEFVETFFAVNKQDHQRPPHPWEAIFRA |
Ga0210116_10155832 | 3300025959 | Natural And Restored Wetlands | MFTLSHKLNADEFIQTFFEVNRQDHQRPAHPWEEIFRNGKCTKEQLQGWGK |
Ga0208141_10282382 | 3300025988 | Rice Paddy Soil | MFKLDGKLGPDEFIRTFFEANRQDHQRPPHPWEAIFRQGKCTREQLQGWAKERYY |
Ga0207648_115599421 | 3300026089 | Miscanthus Rhizosphere | MFSLDRKLSPDDFINTFFDVNRKDHQGSPHPWESLFREGKCTKEQ |
Ga0207675_1022650641 | 3300026118 | Switchgrass Rhizosphere | MFTLSQKLDPDEFIKTFFEANRQDHQRPAHPWDEIFRSGKCTKEQ |
Ga0209470_11784042 | 3300026324 | Soil | MFTLDRKLSPDEFITTFFEATRQDHQRPPHPWEAIFREGKC |
Ga0209896_10377301 | 3300027006 | Groundwater Sand | MFKLDHKLSPDEFIQTFFEANKSDHQRPPHPWETLFRGGKCTKDQLQGWAKE |
Ga0209814_103005372 | 3300027873 | Populus Rhizosphere | MFKLDHKLNPDEFISTFFEANRQDHQRPAHPWEALFREGKCSKEQLQG |
Ga0209465_100286601 | 3300027874 | Tropical Forest Soil | VFKLDRKLDPDEFIQTFSEVNKNDHQRPPHPWETLFREG |
Ga0268264_112535081 | 3300028381 | Switchgrass Rhizosphere | MFKLDHQLAPEEFIQTFFEANRQDHQRSPHPWEALFRDGKCTREQL |
Ga0307281_101255262 | 3300028803 | Soil | MFTLARKLNSDEFISTFFEANRQDHQRPAHPWEEIFRNGKCTKEQLQGWGK |
Ga0299906_110970941 | 3300030606 | Soil | MFKLDRKLGPDEFIATFFEANKRDHQRPPHPWESIFRSGKCTKEQLQGWAK |
Ga0307505_103958991 | 3300031455 | Soil | MFTLDHKLSPDAFITTFFAVNRQDHQRPPHPWEELFRNGKCSNEQL |
Ga0307468_1000150653 | 3300031740 | Hardwood Forest Soil | MFKIDHKLGPDEFIQTFFEANKSDHQRPPHPWEILFRGGNC |
Ga0310904_108912161 | 3300031854 | Soil | MFKLDRKLLPDEFIQTFFEANRQDHQRPPHPWEAIFREGKATREQL |
Ga0326597_110995672 | 3300031965 | Soil | MFKLDRKLGPDEFIATFFEANKRDHQRPPHPWESIFRAGKCTKEQLQ |
Ga0306922_103811181 | 3300032001 | Soil | MFSLDHKLTPDEFIETFFAVNKQDHQRPPHPWETIFR |
Ga0307411_106129152 | 3300032005 | Rhizosphere | MFTLSHKLNPDEFIKTFFEVNRLDHQRPAHPWEEIFR |
Ga0315281_106989632 | 3300032163 | Sediment | MFTLAQKLNPDEFIKTFFETNRQDHQRQPHPWDELFHNGKC |
Ga0316630_101868721 | 3300033487 | Soil | MFTLSHKLNPDEFIKTFFEVNRQDHQRPAHPWEEI |
Ga0364945_0264627_408_530 | 3300034115 | Sediment | MFKLDRKLAPGEFIQTFFDANRQDHQRPPHPWEAIFREGKC |
Ga0364932_0045723_2_106 | 3300034177 | Sediment | MFTLRQKLSPDEFIKTFFEANRQDHQRPPHPWEEI |
Ga0364934_0239133_1_162 | 3300034178 | Sediment | MFKLENKLGPDAFIDTFLEVNRNDHQRPPHPWETLFREGRCTREQLQGWAKERY |
⦗Top⦘ |