 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F090573 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 108 |
| Average Sequence Length | 53 residues |
| Representative Sequence | MRVVRHYDFDGFLAAVAPMRARGEASASFFEGGAHSMKRTPPRPRERVYL |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 108 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 59.22 % |
| % of genes near scaffold ends (potentially truncated) | 92.59 % |
| % of genes from short scaffolds (< 2000 bps) | 87.96 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.58 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (50.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment (12.963 % of family members) |
| Environment Ontology (ENVO) | Unclassified (44.444 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (51.852 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.90% β-sheet: 0.00% Coil/Unstructured: 64.10% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 108 Family Scaffolds |
|---|---|---|
| PF00578 | AhpC-TSA | 75.00 |
| PF12697 | Abhydrolase_6 | 5.56 |
| PF01053 | Cys_Met_Meta_PP | 4.63 |
| PF08386 | Abhydrolase_4 | 3.70 |
| PF09955 | DUF2189 | 3.70 |
| PF00106 | adh_short | 0.93 |
| PF00535 | Glycos_transf_2 | 0.93 |
| PF08448 | PAS_4 | 0.93 |
| PF03989 | DNA_gyraseA_C | 0.93 |
| PF13193 | AMP-binding_C | 0.93 |
| PF12695 | Abhydrolase_5 | 0.93 |
| PF13683 | rve_3 | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
|---|---|---|---|
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 4.63 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 4.63 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 4.63 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 4.63 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 4.63 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 4.63 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 4.63 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 4.63 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 4.63 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 4.63 |
| COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 4.63 |
| COG0188 | DNA gyrase/topoisomerase IV, subunit A | Replication, recombination and repair [L] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 50.00 % |
| Unclassified | root | N/A | 50.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004463|Ga0063356_100242985 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2173 | Open in IMG/M |
| 3300005093|Ga0062594_102328581 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300005328|Ga0070676_11224419 | Not Available | 571 | Open in IMG/M |
| 3300005331|Ga0070670_100461891 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1126 | Open in IMG/M |
| 3300005332|Ga0066388_101439740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae | 1200 | Open in IMG/M |
| 3300005332|Ga0066388_104893784 | Not Available | 681 | Open in IMG/M |
| 3300005335|Ga0070666_11336518 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300005338|Ga0068868_101186746 | Not Available | 705 | Open in IMG/M |
| 3300005341|Ga0070691_10602030 | Not Available | 649 | Open in IMG/M |
| 3300005355|Ga0070671_100085393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2640 | Open in IMG/M |
| 3300005364|Ga0070673_101354421 | Not Available | 669 | Open in IMG/M |
| 3300005365|Ga0070688_100518447 | Not Available | 902 | Open in IMG/M |
| 3300005438|Ga0070701_10378147 | Not Available | 892 | Open in IMG/M |
| 3300005444|Ga0070694_100478345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 988 | Open in IMG/M |
| 3300005543|Ga0070672_100317058 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1325 | Open in IMG/M |
| 3300005546|Ga0070696_100941331 | Not Available | 719 | Open in IMG/M |
| 3300005548|Ga0070665_101953805 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300005615|Ga0070702_100260945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1179 | Open in IMG/M |
| 3300005841|Ga0068863_100317945 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1512 | Open in IMG/M |
| 3300006047|Ga0075024_100265837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 828 | Open in IMG/M |
| 3300006224|Ga0079037_101603506 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300006358|Ga0068871_100969855 | Not Available | 791 | Open in IMG/M |
| 3300006904|Ga0075424_100199130 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2127 | Open in IMG/M |
| 3300009177|Ga0105248_10822361 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1048 | Open in IMG/M |
| 3300009177|Ga0105248_12920059 | Not Available | 545 | Open in IMG/M |
| 3300009870|Ga0131092_10297381 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2168 | Open in IMG/M |
| 3300010366|Ga0126379_10434421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae | 1370 | Open in IMG/M |
| 3300012501|Ga0157351_1029784 | Not Available | 629 | Open in IMG/M |
| 3300012903|Ga0157289_10102142 | Not Available | 822 | Open in IMG/M |
| 3300012948|Ga0126375_11356999 | Not Available | 600 | Open in IMG/M |
| 3300012960|Ga0164301_11554025 | Not Available | 547 | Open in IMG/M |
| 3300013296|Ga0157374_10855035 | Not Available | 927 | Open in IMG/M |
| 3300013297|Ga0157378_10319909 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1507 | Open in IMG/M |
| 3300014308|Ga0075354_1094041 | Not Available | 618 | Open in IMG/M |
| 3300014319|Ga0075348_1020540 | All Organisms → cellular organisms → Bacteria | 1368 | Open in IMG/M |
| 3300014326|Ga0157380_10279865 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1526 | Open in IMG/M |
| 3300014968|Ga0157379_10181553 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1901 | Open in IMG/M |
| 3300015371|Ga0132258_11240823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1884 | Open in IMG/M |
| 3300015371|Ga0132258_11353709 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1799 | Open in IMG/M |
| 3300015372|Ga0132256_101907002 | Not Available | 701 | Open in IMG/M |
| 3300015373|Ga0132257_100632967 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1324 | Open in IMG/M |
| 3300017792|Ga0163161_10595705 | Not Available | 911 | Open in IMG/M |
| 3300017927|Ga0187824_10338020 | Not Available | 541 | Open in IMG/M |
| 3300018064|Ga0187773_11069713 | Not Available | 533 | Open in IMG/M |
| 3300018433|Ga0066667_10676452 | Not Available | 865 | Open in IMG/M |
| 3300019362|Ga0173479_10381219 | Not Available | 673 | Open in IMG/M |
| 3300021082|Ga0210380_10361419 | Not Available | 663 | Open in IMG/M |
| 3300021322|Ga0210330_1257083 | Not Available | 510 | Open in IMG/M |
| 3300025315|Ga0207697_10110440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1177 | Open in IMG/M |
| 3300025899|Ga0207642_10257360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 994 | Open in IMG/M |
| 3300025903|Ga0207680_11018706 | Not Available | 593 | Open in IMG/M |
| 3300025907|Ga0207645_10678147 | Not Available | 700 | Open in IMG/M |
| 3300025925|Ga0207650_10349047 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1217 | Open in IMG/M |
| 3300025926|Ga0207659_10498644 | Not Available | 1030 | Open in IMG/M |
| 3300025930|Ga0207701_11040203 | Not Available | 681 | Open in IMG/M |
| 3300025934|Ga0207686_10390919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae | 1057 | Open in IMG/M |
| 3300025936|Ga0207670_10014366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4699 | Open in IMG/M |
| 3300025940|Ga0207691_10370713 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1223 | Open in IMG/M |
| 3300025942|Ga0207689_10405178 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1137 | Open in IMG/M |
| 3300025942|Ga0207689_11771851 | Not Available | 510 | Open in IMG/M |
| 3300025945|Ga0207679_11421781 | Not Available | 636 | Open in IMG/M |
| 3300025986|Ga0207658_11688580 | Not Available | 579 | Open in IMG/M |
| 3300026023|Ga0207677_11201886 | Not Available | 694 | Open in IMG/M |
| 3300026035|Ga0207703_10223797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae | 1684 | Open in IMG/M |
| 3300026067|Ga0207678_12007103 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 503 | Open in IMG/M |
| 3300026088|Ga0207641_10285417 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1554 | Open in IMG/M |
| 3300026095|Ga0207676_10098195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales | 2421 | Open in IMG/M |
| 3300026116|Ga0207674_10951401 | Not Available | 827 | Open in IMG/M |
| 3300026118|Ga0207675_100031020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4978 | Open in IMG/M |
| 3300026121|Ga0207683_12014323 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300027840|Ga0209683_10193928 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 932 | Open in IMG/M |
| 3300027843|Ga0209798_10081361 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1661 | Open in IMG/M |
| 3300027900|Ga0209253_10170336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1754 | Open in IMG/M |
| 3300028380|Ga0268265_10489817 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1156 | Open in IMG/M |
| 3300028381|Ga0268264_10131742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2218 | Open in IMG/M |
| 3300028381|Ga0268264_10655789 | Not Available | 1039 | Open in IMG/M |
| 3300028861|Ga0302259_1177152 | Not Available | 533 | Open in IMG/M |
| 3300030010|Ga0302299_10418801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Ferrovales → Ferrovaceae → Ferrovum → unclassified Ferrovum → Ferrovum sp. | 682 | Open in IMG/M |
| 3300030838|Ga0311335_10468952 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300031198|Ga0307500_10292271 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300031726|Ga0302321_102335621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 623 | Open in IMG/M |
| 3300031772|Ga0315288_10779567 | Not Available | 887 | Open in IMG/M |
| 3300031834|Ga0315290_10419555 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
| 3300031834|Ga0315290_11145170 | Not Available | 648 | Open in IMG/M |
| 3300031854|Ga0310904_10844041 | Not Available | 644 | Open in IMG/M |
| 3300032067|Ga0318524_10630745 | Not Available | 565 | Open in IMG/M |
| 3300032157|Ga0315912_10694319 | Not Available | 811 | Open in IMG/M |
| 3300032164|Ga0315283_10364275 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1572 | Open in IMG/M |
| 3300032164|Ga0315283_10573542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae | 1223 | Open in IMG/M |
| 3300032164|Ga0315283_10725034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1069 | Open in IMG/M |
| 3300032256|Ga0315271_11088424 | Not Available | 691 | Open in IMG/M |
| 3300032275|Ga0315270_10437956 | Not Available | 837 | Open in IMG/M |
| 3300032275|Ga0315270_10655475 | Not Available | 685 | Open in IMG/M |
| 3300032275|Ga0315270_10763215 | Not Available | 635 | Open in IMG/M |
| 3300032397|Ga0315287_10720236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae | 1177 | Open in IMG/M |
| 3300032397|Ga0315287_12796982 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 516 | Open in IMG/M |
| 3300033408|Ga0316605_12451460 | Not Available | 507 | Open in IMG/M |
| 3300033413|Ga0316603_11401032 | Not Available | 663 | Open in IMG/M |
| 3300033480|Ga0316620_10918230 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 847 | Open in IMG/M |
| 3300033513|Ga0316628_102766569 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 645 | Open in IMG/M |
| 3300034115|Ga0364945_0291427 | Not Available | 508 | Open in IMG/M |
| 3300034178|Ga0364934_0402105 | Not Available | 518 | Open in IMG/M |
| 3300034354|Ga0364943_0157253 | Not Available | 822 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 12.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 7.41% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 7.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.63% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.63% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 4.63% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.63% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 4.63% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.70% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 2.78% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.78% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.85% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.85% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.85% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.85% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.93% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.93% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.93% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.93% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.93% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.93% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.93% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.93% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.93% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.93% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.93% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009870 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant | Engineered | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300012501 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.170610 | Environmental | Open in IMG/M |
| 3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014308 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014319 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300021322 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.298 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027840 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027843 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028861 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N3_4 | Environmental | Open in IMG/M |
| 3300030010 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_4 | Environmental | Open in IMG/M |
| 3300030838 | I_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
| 3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300034115 | Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17 | Environmental | Open in IMG/M |
| 3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
| 3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0063356_1002429854 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MRVIRHYDFDGFIAAVAPMAARGEASASFFTGGAHSMKRAPP |
| Ga0062594_1023285812 | 3300005093 | Soil | MRVVRHSDPDAFLEASMPIAERGEASASFFTGAAHTLKRTPPRGSER |
| Ga0070676_112244191 | 3300005328 | Miscanthus Rhizosphere | MRVIRHYDFDRFIDAVAPIAARGEASASFFIGSAHSMKRTPPRKGDRVYLATCSGAGVLGVALLRDQG |
| Ga0070670_1004618911 | 3300005331 | Switchgrass Rhizosphere | MRVIRHYDFDGFIAAVAPMTARGEASASFFTGGAHSMKRAPPR |
| Ga0066388_1014397403 | 3300005332 | Tropical Forest Soil | MRVTRHTDPDAFIAAAAPMAARGLASASFFAGWAHSLKRTPPE |
| Ga0066388_1048937841 | 3300005332 | Tropical Forest Soil | MPVVRHTDLDAFLEAALPMAARGEASASFFTGAAHTLKRTPPRTGER |
| Ga0070666_113365181 | 3300005335 | Switchgrass Rhizosphere | MRVVRHSDPDAFLEASMPIAERGEASASFFTGAAHTLKRTPPRGSE |
| Ga0068868_1011867461 | 3300005338 | Miscanthus Rhizosphere | MHVTRHTDLDAFLDAVAPMAARGEASASFFTGGAHAMKRTPPRASERVYLATCSGDGAFGAAMLRDAGGVLIGASD |
| Ga0070691_106020302 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVVRHYDFDGFLAAVAPMRSRGEASASFFEGGAHSMKRTPPWP |
| Ga0070671_1000853931 | 3300005355 | Switchgrass Rhizosphere | MHVTRHTDLDAFLDAVAPMAARGEASASFFTGGAHAMKRTPPRAS |
| Ga0070673_1013544211 | 3300005364 | Switchgrass Rhizosphere | MQVVRHSDPDTFLEAAMPITLRGQASASFFTGAAHSLKRTPPRA |
| Ga0070688_1005184472 | 3300005365 | Switchgrass Rhizosphere | MRVIRHYDFDGFIAAVAPMTARGEASASFFTGGAHSMKRAPPRRGERVYLATCSGAGVFG |
| Ga0070701_103781472 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MQVVRHSDPETFLEAAMPITSRGQASASFFTGAAHSLKRTPPRASDRVYLATVSGAEGF |
| Ga0070694_1004783451 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVVRHYDFDGFLAAVAPMRSRGEASASFFEGGAHSMKRTPPRPRER |
| Ga0070672_1003170581 | 3300005543 | Miscanthus Rhizosphere | MRVIRHYDFDGFIAAVAPIAARGEASASFFIGSAHSMKRSPPR |
| Ga0070696_1009413312 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MQVVRHSDPDTFLEAAMPITSRGEASASFFTGAAHSLKRTPPRASDRIYL |
| Ga0070665_1019538052 | 3300005548 | Switchgrass Rhizosphere | MRVVRHSDPDAFLEASMPIAERGEASASFFTGAAHTLKRTPP |
| Ga0070702_1002609453 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MQVVRHSDPDTFLEAAMPITLRGQASASFFTGAAHSLKRTPP |
| Ga0068863_1003179453 | 3300005841 | Switchgrass Rhizosphere | MRVVRHYDFDGFLAAVAPMRSRGEASASFFEGGAHSMKRTPPRPRERVYLAT |
| Ga0075023_1005283231 | 3300006041 | Watersheds | MRVVRHVDPDAFIAAAAPMAARGEASASPFFGWAHAMKRMPPSADERVYLATYGDCGAAIQRDDGPLFM |
| Ga0075024_1002658372 | 3300006047 | Watersheds | MQVTRHTDLDAYLDAVAPMAARGEASASFFTGGVHALKRTPPRSGERIY |
| Ga0079037_1016035061 | 3300006224 | Freshwater Wetlands | MHVVRHCDPDAFLAAAAPMAARGRASASFIAGWAHAMKRNPPKAGEHVYLATWNDGDAHGAA |
| Ga0068871_1009698551 | 3300006358 | Miscanthus Rhizosphere | MRVVRHYDFDGFLAAVAPMRSRGEASASFFEGGAHSMKRTPP |
| Ga0068871_1020493201 | 3300006358 | Miscanthus Rhizosphere | MHVIRHSDPDAFLSAVAPMSSRGEASASFFTGSAYG |
| Ga0075424_1001991304 | 3300006904 | Populus Rhizosphere | MPVVRHTDPETFLEAALPMAARGEASASFFTGAAHTLKRTPPRASERLYL |
| Ga0105248_108223611 | 3300009177 | Switchgrass Rhizosphere | MRVIRHYDFDRFIDAVAPIAARGEASASFFIGSAHSMKRSPPRKGDRVYLATCSGAGVLGVALLRDEGPV |
| Ga0105248_129200591 | 3300009177 | Switchgrass Rhizosphere | MRVIRHYDFDGFIAAVAPMTARGEASASFFTGGAHSMKRAPPRRGERVYLATCSGAGV |
| Ga0131092_102973811 | 3300009870 | Activated Sludge | MYVTRHTDPDTFIAAAAPLTARGEASASFFAGWAHSLKRVPPEPDERVY |
| Ga0126379_104344211 | 3300010366 | Tropical Forest Soil | MRVVRHLDPDAFIAAAAPMAARGAASASPFFGWAYAMKRTPPQ |
| Ga0157351_10297842 | 3300012501 | Unplanted Soil | MRVVRHYDFDGFLAAVAPMRSRGEASASFFEGGAHSMKRT |
| Ga0157289_101021423 | 3300012903 | Soil | MRVVRHYDFDGFLAAVAPMRSRGEASASFFEGGAHSMKRTPPRPRERVYLATCADKGNFGAAMLRDEGPVIIGASDPQAA |
| Ga0126375_113569992 | 3300012948 | Tropical Forest Soil | MRVTRHTDPDAFIAAAAPMSARGLASASFFEGWAHSLKRSPAEATDRVYLATFADRGAVIQRDEGPAIVGQ |
| Ga0164301_115540252 | 3300012960 | Soil | MQVVRHSDPDTFLEAAMPITSRGEASASFFTGAAHSLKR |
| Ga0157374_108550353 | 3300013296 | Miscanthus Rhizosphere | MRVIRHYDFDGFIDAVAPIAARGEASASFFIGSAHSMKRSPPRKGDRVYLATCSGKDVLG |
| Ga0157378_103199093 | 3300013297 | Miscanthus Rhizosphere | MRVVRHYDFDGFLAAVAPMRSRGEASASFFEGGAHSMKRTPPRPRERVYLATCADKGNFGAAMLRDEGPVIIGASDPQAAT |
| Ga0075354_10940412 | 3300014308 | Natural And Restored Wetlands | MHVIRHSDPDAFLAAALPMVARGQASASFFSGWAHAM* |
| Ga0075348_10205401 | 3300014319 | Natural And Restored Wetlands | MFLALVTMRVIRHSDPDTFLAAAAPMAERGQASASFFIG |
| Ga0157380_102798653 | 3300014326 | Switchgrass Rhizosphere | MHVTRHTDLDAFLDAVAPMAARGEASASFFTGGAHAMKRTPPRASERVYLA |
| Ga0157379_101815534 | 3300014968 | Switchgrass Rhizosphere | MRVVRHYDFDGFLAAVAPMRSRGEASASFFEGGAHSMKRTPPRPRERVYLATCADKGNF |
| Ga0132258_112408234 | 3300015371 | Arabidopsis Rhizosphere | MHVTRHTDLDAFLDAVAPMVARGEASASFFTGGAHALKRT |
| Ga0132258_113537091 | 3300015371 | Arabidopsis Rhizosphere | MQVVRHSDPDTFLEAAMPITSRGEASASFFTGAAHSLKRTP |
| Ga0132256_1019070022 | 3300015372 | Arabidopsis Rhizosphere | MHVVRHSDPETFLEAALPITARGEASASFFTGAAHTLKRTPPRASDRIYL |
| Ga0132257_1006329673 | 3300015373 | Arabidopsis Rhizosphere | MRVTRHTNPDVFIAAAAPMAARGLASASFFAGWAHSLKRTLPEASDRVYLATFADRGAII |
| Ga0163161_105957052 | 3300017792 | Switchgrass Rhizosphere | MRVIRHYDFDGFIAAVAPMAARGEASASFFTGGAHSMKRAPPRKGERVYLATCSG |
| Ga0187824_103380202 | 3300017927 | Freshwater Sediment | MKVVRHTDPDAFLEAALPMAARGEASASFFIGAAHTLK |
| Ga0187773_110697131 | 3300018064 | Tropical Peatland | MPVTRHADPDAFLAAAAPIAARGEASASFFIGWAHSLKRTPPPPDERVYLAT |
| Ga0066667_106764521 | 3300018433 | Grasslands Soil | VNPVRVVRHFDLDAFIAAAAPMSLRGAASASSFQGSAYAMKQSPPPPEERV |
| Ga0173479_103812191 | 3300019362 | Soil | MRVVRHYDFDGFLAAVAPMRSRGEASASFFEGGAHSMKRTPPWPRERVYLATCADKGNF |
| Ga0210380_103614192 | 3300021082 | Groundwater Sediment | MRVIRHYDFDGFIAAVAPMTARGEASASFFTGGAHSMKRAPPRRGERVYLATCSGAGVFGAAMLRDQGPVLIGESDAAASEAFAD |
| Ga0210330_12570832 | 3300021322 | Estuarine | MRVIRHSDPDTFLAAAAPMAERGQASASFFIGWAHAMKRTPPVAG |
| Ga0207697_101104404 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVVRHYDFDGFLAAVAPMRSRGEASASFFEGGAHSMKRTP |
| Ga0207642_102573603 | 3300025899 | Miscanthus Rhizosphere | MRVVRHYDFDGFLAAVAPMRSRGEASASFFEGGAHSMKRTPPWPRERVYLATCADKGNFGTAML |
| Ga0207680_110187061 | 3300025903 | Switchgrass Rhizosphere | MRVVRHSDPDAFLEASMPIAERGEASASFFTGAAHTLKRTPPRGSERIYL |
| Ga0207645_106781472 | 3300025907 | Miscanthus Rhizosphere | MRVIRHYDFDGFIDAVAPIAARGEASASFFIGSAHSMKRSPPRKGDRVYLATCSGKDVLGVALLRDEGPVLIGESDGAA |
| Ga0207650_103490473 | 3300025925 | Switchgrass Rhizosphere | MRVIRHYDFDGFIAAVAPIAARGEASASFFIGSAHSMKRSTPRRGE |
| Ga0207659_104986441 | 3300025926 | Miscanthus Rhizosphere | MRVIRHYDFDGFIAAVAPIAARGEASASFFIGSAHSMKRSPPRKGERVYLATCTGGGVLGVAMLRDEG |
| Ga0207701_110402031 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVVRHYDFDGFLAAVAPMRSRGEASASFFEGGAHSMKRTPPQPRERVYLATCAGR |
| Ga0207686_103909193 | 3300025934 | Miscanthus Rhizosphere | MRVVRHYDFDGFLAAVAPMRSRGEASASFFEGGAHSMKRTPPRPRERVYLATCADKGNFG |
| Ga0207670_100143667 | 3300025936 | Switchgrass Rhizosphere | MRVVRHYDFDGFLAAVAPMRSRGEASASFFEGGAHSMKRTPPRPRERVYLATCADKGNFGAAMLRD |
| Ga0207691_103707131 | 3300025940 | Miscanthus Rhizosphere | MQVVRHSDPDTFLEAAMPITLRGQASASFFTGAAHSLKRTPPRAANRVYLATVSGAEGFG |
| Ga0207689_104051783 | 3300025942 | Miscanthus Rhizosphere | MRVVRHSDPDAFLEASMPIAERGEASASFFTGAAHTLKRT |
| Ga0207689_117718512 | 3300025942 | Miscanthus Rhizosphere | MRVIRHYDFDGFIAAVAPMTARGEASASFFTGGAHSMKRAPPRRGERVYLATCSGAGVFGAAM |
| Ga0207679_114217812 | 3300025945 | Corn Rhizosphere | MRVIRHYDFDGFIDAVAPIAARGEASASFFIGSAHSMKRSPPRRGERVYLATCAGGGVLGVAMLRDEGP |
| Ga0207658_116885801 | 3300025986 | Switchgrass Rhizosphere | MRVIRHYDFDRFIDAVAPIAARGEASASFFIGSAHSMKRSPPRKGDRVY |
| Ga0207677_112018861 | 3300026023 | Miscanthus Rhizosphere | MRVIRHYDFDGFIAAVAPIAARGEASASFFIGSAHSMKR |
| Ga0207703_102237971 | 3300026035 | Switchgrass Rhizosphere | MRVIRHYDFDGFIAAVAPIAARGEASASFFIGSAHSMKRSPPRRGERVYLATCA |
| Ga0207678_120071032 | 3300026067 | Corn Rhizosphere | MQVVRHSDPETFLEAAMPITSRGQASASFFTGAAHSLKR |
| Ga0207641_102854173 | 3300026088 | Switchgrass Rhizosphere | MRVVRHYDFDGFLAAVAPMRSRGEASASFFEGGAHSMKRTPPRPRERVYLATCA |
| Ga0207676_100981951 | 3300026095 | Switchgrass Rhizosphere | MHVTRHTDLDAFLDAVAPMAARGEASASFFTGGAHAMKRTPPRASERVYLATCSGDG |
| Ga0207674_109514011 | 3300026116 | Corn Rhizosphere | MRVVRHSDPDAFLEASMPIAERGEASASFFTGAAHTLKRTPPRGSERIYLAT |
| Ga0207675_1000310201 | 3300026118 | Switchgrass Rhizosphere | MRVVRHYDFDGFLAAVAPMRSRGEASASFFEGGAHSMKRTPPRPRERVYLATCADKGNFGAAMLRDEGPVIIGAS |
| Ga0207683_120143233 | 3300026121 | Miscanthus Rhizosphere | MRVVRHYDFDGFLAAVAPMRSRGEASASFFEGGAHSMKRTPPWPRERVYLATCADK |
| Ga0209683_101939281 | 3300027840 | Wetland Sediment | MSVTRHSDPDAFLAAAAPMAARGQASASFFTGWAHAMKRTPPAAGERI |
| Ga0209798_100813611 | 3300027843 | Wetland Sediment | MPVTRHSDPDAFLAAAAPMAARGQASASFFTGWAHAMKRTPPAADVRIYLATVRDGATYGVAILRDDGP |
| Ga0209253_101703364 | 3300027900 | Freshwater Lake Sediment | MHVIRHSDPDVFLAAVAPMVARGEASASSFIGWVHMMK |
| Ga0268265_104898173 | 3300028380 | Switchgrass Rhizosphere | MRVVRHYDFDGFLAAVAPMRSRGEASASFFEGGAHSMKRTPPRPRERVYLA |
| Ga0268264_101317424 | 3300028381 | Switchgrass Rhizosphere | MRVIRHYDFDGFIAAVAPIAARGEASASFFIGSAHSMKRSPPRRGERVYLATCAGGGVLGVAMLRDE |
| Ga0268264_106557894 | 3300028381 | Switchgrass Rhizosphere | MRVVRHYDFDGFLAAVAPMRSRGEASASFFEGGAHSMKRTPPQPRERVYLAT |
| Ga0302259_11771521 | 3300028861 | Fen | MRVVRHSDPDAFIAAAAPMAARGEASASPFAGWAYSMKR |
| Ga0302299_104188011 | 3300030010 | Fen | MHVTRHTDPDAFLAAAAPLAARGEASASFFSGWAHALKRTPPPPQEHLYLATCA |
| Ga0311335_104689522 | 3300030838 | Fen | MELSRHTDPDAFLAAVAPMAARGEASASLFSGWAHMMKVTPLRP |
| Ga0307500_102922711 | 3300031198 | Soil | MRVVRHYDFDGFLAAVAPMRARGEASASFFEGGAHSMKRTPPRPRERVYL |
| Ga0302321_1000627985 | 3300031726 | Fen | MRVVRHSDPDAFIAAAAPMAARGEASASPFAGWAYSIKRNPPAADQRVYLATYGDCGAAIQRDEGPLFMG |
| Ga0302321_1023356211 | 3300031726 | Fen | MRVVRHSDPDAFIAAAAPMAARGEASASPFAGWAYSMKRTPPPADA |
| Ga0315288_107795671 | 3300031772 | Sediment | MPVTRHSDPDAFLAAAAPMAARGQASASFFTGWAHAMKRTPPAA |
| Ga0315290_104195553 | 3300031834 | Sediment | MHVTRHTDANAFLVAVAPMAARGEASASFFSGWAQVMKLTPANPDEHVYLARDWP |
| Ga0315290_111451701 | 3300031834 | Sediment | MPVTRHSDPDAFLAAAAPMAARGQASASFFTGWAHAMKRTPP |
| Ga0310904_108440411 | 3300031854 | Soil | MRVIRHYDFDGFIAAVAPMAARGEASASFFTGGAHSMKRAPPRKGERVYLATCSGAGVLGAAMLRDHG |
| Ga0315274_117284601 | 3300031999 | Sediment | MPVTRHSDPDAFLAAAAPMAARGQASASFFTGWAH |
| Ga0318524_106307452 | 3300032067 | Soil | MPVVRHTDLDAFLEAALPMAERGEASASFFTGAAHTLKRTPPRTGERVYLASFRSNE |
| Ga0315912_106943192 | 3300032157 | Soil | MRVIRHYDFDGFIAAVAPIAARGEASASFFVGSAHSMKRSPPRKEERVYLATCSGAGVLGVAMLRGEGPVLI |
| Ga0315283_103642751 | 3300032164 | Sediment | MHVTRHSDPDAFLAAAAPMAVRGQASASFFTGWAHAMKRTPPAAGERVYLATICDG |
| Ga0315283_105735423 | 3300032164 | Sediment | MPVTRHSDPDAFLAAAAPMAARGQASASFFTGWAHAMKRTPPAPDERIYLATVRDGATYGVAI |
| Ga0315283_107250341 | 3300032164 | Sediment | MPVTRHSDPDAFLAAAAPMAARGQASASFFTGWAHAMKRTPLAAGE |
| Ga0315271_110884242 | 3300032256 | Sediment | MHVTRHRDLDAFIAAAAPMKARGEASASFFEGGAHSMKRTPPRARERIYLATCRGRAAF |
| Ga0315270_104379562 | 3300032275 | Sediment | MHVIRHTDPDAFLAAAAPMAARGQASASFFTGWAHALKRTPPAAGER |
| Ga0315270_106554752 | 3300032275 | Sediment | MLVTRHSDPDAFLAAAAPMAARGQASASFFTGWAHAMKRTPPTPGERV |
| Ga0315270_107632151 | 3300032275 | Sediment | MHVTRHSDLDAFLAAAAPMSARGEASASFFTVWAHAMKQ |
| Ga0315287_107202361 | 3300032397 | Sediment | MPVTRHSDPDAFLAAAAPMAARGQASASFFTGWAHAMKRTPPDAGER |
| Ga0315287_127969822 | 3300032397 | Sediment | MPVTRHSDPDAFLVAAAPMAARGQASASFFTGWAH |
| Ga0334722_100871024 | 3300033233 | Sediment | MHVTRHSDLDAFLAAAAPISASGEASASFFTAERTR |
| Ga0316605_124514601 | 3300033408 | Soil | MQVIRYSDPDAFLAAVAPMRDRGEASASFFIGWVHMMKRAAPEA |
| Ga0316603_114010322 | 3300033413 | Soil | MHVTRHCDPDAVLAAAAPMAARGEASASFFSGWAHAVKRNPPASAERVYLATFRDGVS |
| Ga0316620_109182301 | 3300033480 | Soil | MHVTRHTDPDAFLADAAPIARRGEASASFFAAAAHSMKRAPPPADERVYLATCNGAGVHGVALQR |
| Ga0316628_1027665692 | 3300033513 | Soil | MRVTRHTDPDAFIAAVAPMTARGEASASFFTGWGHSLKRMPPEPDERVYLATCGKCGAAMQRGDG |
| Ga0364945_0291427_2_220 | 3300034115 | Sediment | MHVTRHRDLDAFIAAVAPMKARGEASASFFTGGAHAMKRTPPRAGERIYLATCRSRTAFGVAMLRDAGPLLIG |
| Ga0364934_0402105_1_243 | 3300034178 | Sediment | MRVTRHTDPVTFLAAVAPMQDRGEASASLFAGWAHAMKRTPPPPDEHVYLATCIESGSCGAAVQRGESPAIVGQSDATAAA |
| Ga0364943_0157253_604_822 | 3300034354 | Sediment | MHVTRHTDLDAFLDAVAPMAARGEASASFFTGGAHALKRTPPRASERVYLATCRGDGTFGAAMLRDEGQVLIG |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |