Basic Information | |
---|---|
Family ID | F090546 |
Family Type | Metagenome |
Number of Sequences | 108 |
Average Sequence Length | 47 residues |
Representative Sequence | RAYIRRARKKALADAKKLGEPPPQKPKGVVSTVKAIYPKKRRPK |
Number of Associated Samples | 91 |
Number of Associated Scaffolds | 108 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.93 % |
% of genes near scaffold ends (potentially truncated) | 97.22 % |
% of genes from short scaffolds (< 2000 bps) | 89.81 % |
Associated GOLD sequencing projects | 83 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.35 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (90.741 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (20.370 % of family members) |
Environment Ontology (ENVO) | Unclassified (39.815 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (53.704 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.11% β-sheet: 0.00% Coil/Unstructured: 63.89% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 108 Family Scaffolds |
---|---|---|
PF07676 | PD40 | 50.00 |
PF01625 | PMSR | 10.19 |
PF02900 | LigB | 1.85 |
PF00326 | Peptidase_S9 | 1.85 |
PF00550 | PP-binding | 0.93 |
PF06971 | Put_DNA-bind_N | 0.93 |
PF14158 | YndJ | 0.93 |
PF13432 | TPR_16 | 0.93 |
PF09720 | Unstab_antitox | 0.93 |
PF08530 | PepX_C | 0.93 |
PF13946 | DUF4214 | 0.93 |
PF05163 | DinB | 0.93 |
PF02661 | Fic | 0.93 |
PF07719 | TPR_2 | 0.93 |
COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
---|---|---|---|
COG0225 | Peptide methionine sulfoxide reductase MsrA | Posttranslational modification, protein turnover, chaperones [O] | 10.19 |
COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.93 |
COG2936 | Predicted acyl esterase | General function prediction only [R] | 0.93 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 90.74 % |
Unclassified | root | N/A | 9.26 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459010|GIO7OMY02HNGJ0 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
3300000033|ICChiseqgaiiDRAFT_c2383029 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4530 | Open in IMG/M |
3300000574|JGI1357J11328_10032002 | All Organisms → cellular organisms → Bacteria | 2337 | Open in IMG/M |
3300004782|Ga0062382_10159609 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
3300004808|Ga0062381_10247563 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
3300005180|Ga0066685_10559780 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 788 | Open in IMG/M |
3300005328|Ga0070676_11206460 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
3300005338|Ga0068868_101498346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 631 | Open in IMG/M |
3300005345|Ga0070692_10717866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 674 | Open in IMG/M |
3300005437|Ga0070710_10410859 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 909 | Open in IMG/M |
3300005437|Ga0070710_11082998 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
3300005438|Ga0070701_10855045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 625 | Open in IMG/M |
3300005445|Ga0070708_100095836 | All Organisms → cellular organisms → Bacteria | 2709 | Open in IMG/M |
3300005445|Ga0070708_101895720 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300005446|Ga0066686_10142548 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1579 | Open in IMG/M |
3300005468|Ga0070707_100391801 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1349 | Open in IMG/M |
3300005518|Ga0070699_100749358 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 893 | Open in IMG/M |
3300005518|Ga0070699_102026734 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300005554|Ga0066661_10377320 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 868 | Open in IMG/M |
3300005576|Ga0066708_10923695 | Not Available | 544 | Open in IMG/M |
3300005586|Ga0066691_10546304 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 691 | Open in IMG/M |
3300005618|Ga0068864_101652978 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 645 | Open in IMG/M |
3300005841|Ga0068863_101237990 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 753 | Open in IMG/M |
3300006034|Ga0066656_11007144 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
3300006237|Ga0097621_100340439 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1332 | Open in IMG/M |
3300006796|Ga0066665_10307835 | All Organisms → cellular organisms → Bacteria | 1276 | Open in IMG/M |
3300006806|Ga0079220_11192450 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 627 | Open in IMG/M |
3300006854|Ga0075425_100457228 | Not Available | 1470 | Open in IMG/M |
3300006871|Ga0075434_100226298 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1890 | Open in IMG/M |
3300006871|Ga0075434_100610969 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1109 | Open in IMG/M |
3300006880|Ga0075429_100167965 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1922 | Open in IMG/M |
3300007258|Ga0099793_10555362 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300009038|Ga0099829_11612233 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300009089|Ga0099828_10506915 | Not Available | 1088 | Open in IMG/M |
3300009089|Ga0099828_11788982 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
3300009094|Ga0111539_10317668 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1813 | Open in IMG/M |
3300009143|Ga0099792_10911827 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
3300009177|Ga0105248_10208482 | All Organisms → cellular organisms → Bacteria | 2202 | Open in IMG/M |
3300010047|Ga0126382_11035900 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 722 | Open in IMG/M |
3300010047|Ga0126382_11181365 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 684 | Open in IMG/M |
3300010337|Ga0134062_10139995 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1068 | Open in IMG/M |
3300010397|Ga0134124_10187947 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1867 | Open in IMG/M |
3300010397|Ga0134124_11415397 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 721 | Open in IMG/M |
3300010397|Ga0134124_11753182 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 654 | Open in IMG/M |
3300010397|Ga0134124_11804414 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 646 | Open in IMG/M |
3300010399|Ga0134127_11407956 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
3300010399|Ga0134127_13286115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 529 | Open in IMG/M |
3300010400|Ga0134122_12537173 | Not Available | 562 | Open in IMG/M |
3300010403|Ga0134123_12845237 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
3300011271|Ga0137393_10885295 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 762 | Open in IMG/M |
3300011433|Ga0137443_1161702 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
3300012189|Ga0137388_10773312 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 891 | Open in IMG/M |
3300012199|Ga0137383_11101756 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
3300012202|Ga0137363_11529206 | Not Available | 559 | Open in IMG/M |
3300012204|Ga0137374_10408329 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1077 | Open in IMG/M |
3300012208|Ga0137376_10770712 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 829 | Open in IMG/M |
3300012349|Ga0137387_10054250 | All Organisms → cellular organisms → Bacteria | 2683 | Open in IMG/M |
3300012349|Ga0137387_11041133 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
3300012582|Ga0137358_10633675 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 716 | Open in IMG/M |
3300012685|Ga0137397_10098355 | All Organisms → cellular organisms → Bacteria | 2143 | Open in IMG/M |
3300012685|Ga0137397_10165951 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1638 | Open in IMG/M |
3300012918|Ga0137396_10831058 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 679 | Open in IMG/M |
3300012925|Ga0137419_10371452 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1111 | Open in IMG/M |
3300012925|Ga0137419_11873276 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
3300012930|Ga0137407_10186706 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1853 | Open in IMG/M |
3300012961|Ga0164302_11615446 | Not Available | 540 | Open in IMG/M |
3300012961|Ga0164302_11716029 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300012975|Ga0134110_10527599 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
3300013297|Ga0157378_10405390 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1344 | Open in IMG/M |
3300013297|Ga0157378_12002961 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
3300013306|Ga0163162_12299115 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
3300013306|Ga0163162_12428884 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
3300013308|Ga0157375_11767972 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 733 | Open in IMG/M |
3300014829|Ga0120104_1002620 | All Organisms → cellular organisms → Bacteria | 3251 | Open in IMG/M |
3300015197|Ga0167638_1071840 | Not Available | 711 | Open in IMG/M |
3300015254|Ga0180089_1005376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2115 | Open in IMG/M |
3300015373|Ga0132257_100284740 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1982 | Open in IMG/M |
3300016319|Ga0182033_11872248 | Not Available | 545 | Open in IMG/M |
3300018051|Ga0184620_10281315 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300018468|Ga0066662_10079433 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2236 | Open in IMG/M |
3300018469|Ga0190270_12553355 | Not Available | 573 | Open in IMG/M |
3300018482|Ga0066669_12235589 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
3300018920|Ga0190273_12351487 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 506 | Open in IMG/M |
3300019458|Ga0187892_10195919 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
3300021073|Ga0210378_10188324 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
3300024290|Ga0247667_1034892 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 954 | Open in IMG/M |
3300025898|Ga0207692_10511655 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 763 | Open in IMG/M |
3300025907|Ga0207645_10938593 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
3300025942|Ga0207689_10852947 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
3300025942|Ga0207689_11430824 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
3300026023|Ga0207677_10093364 | All Organisms → cellular organisms → Bacteria | 2194 | Open in IMG/M |
3300026035|Ga0207703_10308692 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1445 | Open in IMG/M |
3300026089|Ga0207648_11634875 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
3300026095|Ga0207676_10334160 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1396 | Open in IMG/M |
3300026309|Ga0209055_1222764 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
3300026326|Ga0209801_1241365 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 694 | Open in IMG/M |
3300026332|Ga0209803_1326887 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
3300026527|Ga0209059_1276306 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
3300026538|Ga0209056_10553319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
3300027778|Ga0209464_10244664 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
3300027875|Ga0209283_10751612 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 604 | Open in IMG/M |
3300027882|Ga0209590_10645053 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 680 | Open in IMG/M |
3300031231|Ga0170824_104527602 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
3300031720|Ga0307469_10084799 | All Organisms → cellular organisms → Bacteria | 2161 | Open in IMG/M |
3300031740|Ga0307468_100330066 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1126 | Open in IMG/M |
3300032180|Ga0307471_103352888 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
3300032211|Ga0310896_10093450 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1330 | Open in IMG/M |
3300034165|Ga0364942_0109194 | Not Available | 896 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 20.37% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 12.04% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.26% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 7.41% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.63% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.63% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.70% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.70% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 2.78% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.78% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.78% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.85% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.85% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.85% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.85% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.85% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.85% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.93% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.93% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.93% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.93% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.93% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.93% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.93% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.93% |
Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 0.93% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.93% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.93% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.93% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000574 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m | Environmental | Open in IMG/M |
3300004782 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh | Environmental | Open in IMG/M |
3300004808 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300011433 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT300_2 | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014829 | Permafrost microbial communities from Nunavut, Canada - A10_35cm_6M | Environmental | Open in IMG/M |
3300015197 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6B, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
3300015254 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT860_16_10D | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300027778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
3300034165 | Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
F62_08133680 | 2170459010 | Grass Soil | RKKSLAEAKKLGEPAKPKPQGVVSTVKAIYPKKRRPK |
ICChiseqgaiiDRAFT_23830291 | 3300000033 | Soil | IKTPSDLERSEVRAYMRRAHQLAVDDARKLGETASKVQGVVSTVKAIYPRKRRPGPESRK |
JGI1357J11328_100320021 | 3300000574 | Groundwater | RAYIRRARKKALADAKKLGEPPPQKPKGVVSTVKAIYPKKRRPK* |
Ga0062382_101596091 | 3300004782 | Wetland Sediment | EVRSYIRRARKVALADARKLGETTPLLKGVVSKVKAIYPKKRRPAPKDKR* |
Ga0062381_102475632 | 3300004808 | Wetland Sediment | VRSYIRRARKVALADARKLGETTPLLKGVVSKVKAIYPKKRRPAPKDKR* |
Ga0066685_105597801 | 3300005180 | Soil | EIRSYIRRARKKAIADAWKTDGPPPREPDGVVSKVKAVYPKKRRPK* |
Ga0070676_112064602 | 3300005328 | Miscanthus Rhizosphere | KSESDLARPEIRAYIRRAKKKALADARKLGEKPPKKPVGVVSTVKAIYAKKRRP* |
Ga0068868_1014983462 | 3300005338 | Miscanthus Rhizosphere | PEIRAYIRRAKKNALAEARKLGEKPPKKPAGVISTVKAIYAKKRRP* |
Ga0070692_107178661 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | TIKSESDLARPEIRAYIRRAKKKALADARKLGEKPPKKPVGVVSTVKAIYAKKRRP* |
Ga0070710_104108592 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | AEDLKRPELRAYIRRAKKKAIADARKLGWAAAQNPKGVISTVKAIYKKKRRPK* |
Ga0070710_110829981 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | RAYIRRAKKKARAEARKLGEKPPPKPADVISTVKAIYAKKRRP* |
Ga0070701_108550451 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | PEIRAYIRRAKKSALAEARKLGEKPPQEPAGVISTVKAIYAKKRRP* |
Ga0070708_1000958361 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | IRRARKVALAEAKKLGGAPPKKPNGVVSTVKAIYPNKRRPS* |
Ga0070708_1018957202 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | AYIRRARKVALAEAKKLGGAPPKKPNGVVSTVKAIYPNKRRPVKK* |
Ga0066686_101425482 | 3300005446 | Soil | EQPELRAYIRRARKKAVADARKLGEALPKKPEGVVSTVKAVYPKKRRPKAKT* |
Ga0070707_1003918011 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | RRARKKALSDARKLGESAPLKPDRVISTVKAVYAKKRRPK* |
Ga0070699_1007493582 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | PEIRAYIRRARKQALADARKLEKTPAKKPAGVISTVKAIYPKKRRPK* |
Ga0070699_1020267342 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | IKSSEDLARPEIRAYIRRARKKALDDARKLGEAAPRKPKGVVSTIKAIYPKKRRPK* |
Ga0066661_103773201 | 3300005554 | Soil | RARKKALDDARRLGEPAPKKPEGVVSIVKAIYPKKRRPNRT* |
Ga0066708_109236951 | 3300005576 | Soil | RVEDIKRPELRAYIRRAKRKAFADARKLGEPLSKQPAGVVSTVKAIYAKKRRPK* |
Ga0066691_105463042 | 3300005586 | Soil | KRPEVRSYIRRARKKAIVEARKIGEPARQKPDRVISTVKAIYPKKRRPK* |
Ga0068864_1016529782 | 3300005618 | Switchgrass Rhizosphere | PEIRAYIRRAKKKALAEARKLGEPMPKKPDGVVSTVKAIYARKRRP* |
Ga0068863_1012379902 | 3300005841 | Switchgrass Rhizosphere | DDLKRPEVRSYIRRARKKALADARKLGEPAPAKPKGVVSTVKAIYPKKRRPK* |
Ga0066656_110071442 | 3300006034 | Soil | PELRAYIRRARKKAVADARKLGEAAPKKPEGVVSTVKAIYPKKRRPKAKT* |
Ga0097621_1003404392 | 3300006237 | Miscanthus Rhizosphere | DLKRPEVRAYIRRARKKAIADARKLGEPALAKPKGVVSTVKAIYEKKRRPK* |
Ga0066665_103078353 | 3300006796 | Soil | RAYIRRARKKALSDARKLGEPAPPKPAGVISTVKAVYPKKRRPKGQT* |
Ga0079220_111924502 | 3300006806 | Agricultural Soil | RSYIRRARKRALAEARKLGERHQAPDGVVSTVKAIYPKKRRPR* |
Ga0075425_1004572281 | 3300006854 | Populus Rhizosphere | ELRTYIRRARKKALVEARKLGEPPAPEPDGVVSTVKAIYARKRRPSKA* |
Ga0075434_1002262981 | 3300006871 | Populus Rhizosphere | PELRAYIRRARKKALAEARKLGEAPKPKPNGVVSTVKAIYPKKRRPK* |
Ga0075434_1006109692 | 3300006871 | Populus Rhizosphere | TAEELQRPEIRSYIRRARKQALADAKKLGEKRQPKPAGVVSTVKAIYPRKRRPK* |
Ga0075429_1001679652 | 3300006880 | Populus Rhizosphere | SYIRRARKKALTEARKLGEPAPAKPKGVVSTVKAIYPKKRRPK* |
Ga0099793_105553621 | 3300007258 | Vadose Zone Soil | DLARPEIRAYIRRALKHARSDARKLGEVMPKKPKGVVSTVKAIYPKKRRPVPAR* |
Ga0099829_116122331 | 3300009038 | Vadose Zone Soil | KALADARKLGEPAPKKPDGVVSTVKAIYPKKRRPVK* |
Ga0099828_105069151 | 3300009089 | Vadose Zone Soil | LARPEIRSYIRRARKKAVAEARKLGEAPTKKPKGVVSNVKAIYAKKRRPAKK* |
Ga0099828_117889822 | 3300009089 | Vadose Zone Soil | DLKRPEIRSYLRRARKVALAESRKLGEAPAKKPKGVVSTVKAIYPKKRRPK* |
Ga0111539_103176681 | 3300009094 | Populus Rhizosphere | KKALTEARKLGEPAPAKPKGVVSTVKAIYPKKRRPK* |
Ga0099792_109118271 | 3300009143 | Vadose Zone Soil | ELRAYIRRAKKKAFADARKLGEPLSKQPAGVVSTVKAIYAKKRRPK* |
Ga0105248_102084821 | 3300009177 | Switchgrass Rhizosphere | PEIRAYIRRAKKKALAEARKLGERPPQKPAGVISTVKAIYAKKRRPAATLKK* |
Ga0126382_110359002 | 3300010047 | Tropical Forest Soil | RSYIRRARKKALADAKKLGEKTKKPDRVVSTVKAIYPKKRRPK* |
Ga0126382_111813651 | 3300010047 | Tropical Forest Soil | YIKRARKKALADARKLGETPPRKPDGVVSTVKAIYATKRRPKSRPEVGK* |
Ga0134062_101399952 | 3300010337 | Grasslands Soil | RKKAVADARKLGEALPKKPEGVVSTVKAVYPKKRRPKAKT* |
Ga0134124_101879473 | 3300010397 | Terrestrial Soil | SDLERSEVRAYMRRAHQLAVDDARKSGETASKVQGVVSTVKAIYPRKRRPGLVSRK* |
Ga0134124_114153972 | 3300010397 | Terrestrial Soil | RRARKKALAEARKLGERYQPPDGVVSTVKAIYPKKRRPT* |
Ga0134124_117531821 | 3300010397 | Terrestrial Soil | KTIEDIKRPVIRSYIRRARKKAIADARRFCAPVLPKADGVVSTVKAVYAKKRRPA* |
Ga0134124_118044141 | 3300010397 | Terrestrial Soil | RPELRSYIRRARKQALAEARKLGETQPKPKGVISTVKAIYPKKRRPK* |
Ga0134127_114079563 | 3300010399 | Terrestrial Soil | ALADARKLGGPRSQPPDGVISTVKKIYAKKRRPK* |
Ga0134127_132861151 | 3300010399 | Terrestrial Soil | IRRAKRRASADARKLGEAAKKTKGVISTVKAVYPKKRRPR* |
Ga0134122_125371731 | 3300010400 | Terrestrial Soil | ERPELRTYIRRARQVAIDDARKLGETAPPVEGLISTVKAIYPKKRRPIPASLK* |
Ga0134123_128452371 | 3300010403 | Terrestrial Soil | KKALADARKLGEPAPAKPKGVVSTVKAIYPKKRRPK* |
Ga0137393_108852951 | 3300011271 | Vadose Zone Soil | ADIKRPEIRAYIRRARKKALADARKLGEPAPPEPDGVISTVKAIYPKKRRPK* |
Ga0137443_11617022 | 3300011433 | Soil | RGYVRRARQVAIDDARKLGETAPTVAGVISTVKAIYARKRRPVPSRGSDR* |
Ga0137388_107733122 | 3300012189 | Vadose Zone Soil | KRARKFALAEAKKLGEPPPQKPEGVVSTVKAIYPKKRRPK* |
Ga0137383_111017562 | 3300012199 | Vadose Zone Soil | YIQRARKVALAESKKLGDAPPKKPKGVVSTVKAIYAKKRRPK* |
Ga0137363_115292061 | 3300012202 | Vadose Zone Soil | RAREGAIADARKLGEVMPPRAKGVVSVVKAIYPKKRRPGANSKK* |
Ga0137374_104083292 | 3300012204 | Vadose Zone Soil | AADVERPEIRAYIRRARKKALADARKLGEPAPAKRAGLISTVKAIYPKKRRPK* |
Ga0137376_107707122 | 3300012208 | Vadose Zone Soil | PEIRSYIRRARKKAIADARKLGEPAPQKPAGVVSTVKAIYPKKRRPK* |
Ga0137387_100542501 | 3300012349 | Vadose Zone Soil | DLRRPEIRGYIKRARKVALAEAKKLGDTPPKKPKGVVSTVKAIYAKKRRPK* |
Ga0137387_110411331 | 3300012349 | Vadose Zone Soil | DLRRPEIRGYIKRARKVALAEAKKLGDAQPKKPKGVVSTVKAIYLKKRRPKK* |
Ga0137358_106336751 | 3300012582 | Vadose Zone Soil | DLNRPELRTYIRRARRQALKDARRLGAPAKTKPKGVVSTVKAIYPKKRRPK* |
Ga0137397_100983552 | 3300012685 | Vadose Zone Soil | EDIKRAEIRAYIRRARAKALADARKLGEPPPQKPAGVVSTVKAIYAKKRRPR* |
Ga0137397_101659512 | 3300012685 | Vadose Zone Soil | RKKALADARKLGEPAPKKPAGVVSAVKAIYPKKRRPKSYPG* |
Ga0137396_108310582 | 3300012918 | Vadose Zone Soil | RKKAMADARKLGEPPPKKPKGVVSTVKAIYPKKRRPKTKT* |
Ga0137419_103714522 | 3300012925 | Vadose Zone Soil | AYIRRARAKALADARKLGEPPPQKPAGVVSTVKAIYAKKRRPK* |
Ga0137419_118732761 | 3300012925 | Vadose Zone Soil | RPEIRAYIRRARKKAVAEAKKLGGAPTTKPKGVVSTVKAIYPKKRRPK* |
Ga0137407_101867063 | 3300012930 | Vadose Zone Soil | IRRAKKKAFADARKLGEPLTKEPGGVVSTVKAIYAKKRRPK* |
Ga0164302_116154462 | 3300012961 | Soil | RRAKKNALAETRKLGEKPPQKPAGVISTVKAIYAKKRRP* |
Ga0164302_117160291 | 3300012961 | Soil | IKIRTPADLVRPEIRAYVRRARQVAIDDARKLGETVSKVEGVVSTVKAIYPKKRRPVPNP |
Ga0134110_105275992 | 3300012975 | Grasslands Soil | LFRPEIRAYIQRARKVALAESKKLGDAPPKKPKGVVSTVKAIYAKKRRPK* |
Ga0157378_104053902 | 3300013297 | Miscanthus Rhizosphere | ELRAYIRRARKQAVADAKKMGEPTPVKPKGVVSTVKAIYPKKRRPAGSG* |
Ga0157378_120029611 | 3300013297 | Miscanthus Rhizosphere | MRADIRRAKKNALAEARKLGEKPPKKPAGVISTVKAIYAKKRRP* |
Ga0163162_122991151 | 3300013306 | Switchgrass Rhizosphere | PEIRAYIRRAKKKALAEARKLGEPASPKRVGVVSTVKAVYAKKRRPGATLKK* |
Ga0163162_124288841 | 3300013306 | Switchgrass Rhizosphere | RKQAIADAKKMGEPTPVKPKGVVSTVKAIYPKKRRPAGSG* |
Ga0157375_117679721 | 3300013308 | Miscanthus Rhizosphere | AKKKALADARRLGEAPTKKPAGVVSTVKAIYAKKRRP* |
Ga0120104_10026204 | 3300014829 | Permafrost | TITGVEDIKRPELRTYIRRAKKKAFADARKLGEPLPKQADGVVSTVKAIYAKKRRPT* |
Ga0167638_10718401 | 3300015197 | Glacier Forefield Soil | AADIKRPELRSYIRRARKKALADARMLGEPTLQKPAGVVSTVKAIYKKKRRPA* |
Ga0180089_10053761 | 3300015254 | Soil | RRARQVAIDDARKLGETAPTVAGVISTVKAIYARKRRPVPSRGSDR* |
Ga0132257_1002847401 | 3300015373 | Arabidopsis Rhizosphere | KPEDLKRPELRAYIRRARKKALTEARRLGERPVAPTDVVSTVKAIYPKKRRPN* |
Ga0182033_118722481 | 3300016319 | Soil | HIRFKTETDLTRPDVRAYIRRAKKQALAETRKLGEPPPKKPAGVISTVKAIYAKKRRP |
Ga0184620_102813151 | 3300018051 | Groundwater Sediment | RARKVAIDEARKLGETAPPVKGVISTVKAIYPKKRRPSPK |
Ga0066662_100794333 | 3300018468 | Grasslands Soil | MKASEDLERPELRAYIRRARKKALSDARKLGEPAPEKPEGVVSTVKAIYPKKRRPK |
Ga0190270_125533551 | 3300018469 | Soil | RKAALADARKLGGPKSPKPEGVISTVKAIYPKNRRPK |
Ga0066669_122355892 | 3300018482 | Grasslands Soil | PDDLKRREIRSYIRRARKKAIADARKLGEPLLRKPDGVVSTVKAVYPKKRRPKLVKRQR |
Ga0190273_123514871 | 3300018920 | Soil | RPEIRAYLRRAHQSAIDDARKLGDGRAKSMKGVVSTVKAIYPKKRRPNLNS |
Ga0187892_101959191 | 3300019458 | Bio-Ooze | RKAALRDAGKLGEPTKKPKGVVSTVKAIYPKKRRPKKVK |
Ga0210378_101883242 | 3300021073 | Groundwater Sediment | RRARKRATDDARKLGEPAPKTLNGVVSTVKAIYPKKRRPR |
Ga0247667_10348922 | 3300024290 | Soil | ADLERPVLRSYIRRAQKTALADMKMLGETPPPKPDGVISTVKAIYPRKRRPK |
Ga0207692_105116551 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | AEDLKRPELRAYIRRAKKKAIADARKLGWAAAQNPKGVISTVKAIYKKKRRPK |
Ga0207645_109385932 | 3300025907 | Miscanthus Rhizosphere | KSESDLARPEIRAYIRRAKKKALADARKLGEKPPKKPVGVVSTVKAIYAKKRRP |
Ga0207689_108529472 | 3300025942 | Miscanthus Rhizosphere | LERPEVRAYVRRARRLAIDDARKLGETASKVKGVVSTVKAIYPKKRRPIVDGKVRKSD |
Ga0207689_114308241 | 3300025942 | Miscanthus Rhizosphere | VDLKRPELRSYIRRARKAALADARKLGGPKSPKPDGVISTVKAIYPKKRRPK |
Ga0207677_100933642 | 3300026023 | Miscanthus Rhizosphere | AYIRRAKKNALAEARKLGEKPPKKPAGVISTVKAIYAKKRRP |
Ga0207703_103086921 | 3300026035 | Switchgrass Rhizosphere | IRRARKKALADARKLGEPAPAKPKGVVSTVKAIYPKKRRPK |
Ga0207648_116348751 | 3300026089 | Miscanthus Rhizosphere | RAYIRRARKKALAEARKLGEAPKQKPNGVVSTVKAIYPKKRRPK |
Ga0207676_103341602 | 3300026095 | Switchgrass Rhizosphere | AYIRRAKKKAVAEARKLGEQPPRKPAGVVSTVKAIYPKKRRPK |
Ga0209055_12227642 | 3300026309 | Soil | RARKKALDDARRLGEPAPKKPEGVVSIVKAIYPKKRRPNRT |
Ga0209801_12413651 | 3300026326 | Soil | IARPELRAYIRHARKKALADAKKLGEAAPDKPDGVISTVKAIYPKKRRPIKK |
Ga0209803_13268871 | 3300026332 | Soil | AYIRRARKKALADARKLGEALPKKPEGVVSTVKAVYPKKRRPKAKT |
Ga0209059_12763061 | 3300026527 | Soil | RARKKALSDARKLGEPPPEKPEGVVSTVKAIYPKKRRPKTKT |
Ga0209056_105533192 | 3300026538 | Soil | ALSDARKLGEPAPEKPEGVVSTVKAIYPKKRRPKTKT |
Ga0209464_102446642 | 3300027778 | Wetland Sediment | VRSYIRRARKVALADARKLGETTPLLKGVVSKVKAIYPKKRRPAPKDKR |
Ga0209283_107516122 | 3300027875 | Vadose Zone Soil | RKKAVAEARKLGEAPTKKPKGVVSNVKAIYAKKRRPAKK |
Ga0209590_106450532 | 3300027882 | Vadose Zone Soil | LRAYIRRARKKALADARKLGEPAPKKPEGVVSTVKAIYPKKRRPKAKT |
Ga0170824_1045276022 | 3300031231 | Forest Soil | REIRAYIRRAKKKALADARKLGERPPKKPTGVVSTVKAIYAKKRRP |
Ga0307469_100847991 | 3300031720 | Hardwood Forest Soil | APEDLERRQIRSYIARARKKAFADARKLGEQLPPKPDDVVSTVKAIYPKKRRPKLVKKRQ |
Ga0307468_1003300662 | 3300031740 | Hardwood Forest Soil | KKALADARKLGEPTAEKPAGVISTVKAIYPKKRRPK |
Ga0307471_1033528882 | 3300032180 | Hardwood Forest Soil | CIRRARKKALADARKLGEPAPKKPENVVSTVKAIYPKKRRPK |
Ga0310896_100934501 | 3300032211 | Soil | RRARKKALADARKLGEPAPAMPKGVVSTVKAIYPKKRRPK |
Ga0364942_0109194_740_895 | 3300034165 | Sediment | RLEIRSYVRRARKVAIDDARKLGETRPKNIAGVVSTVKAIYPKRCRPISKS |
⦗Top⦘ |