NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F090546

Metagenome Family F090546

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F090546
Family Type Metagenome
Number of Sequences 108
Average Sequence Length 47 residues
Representative Sequence RAYIRRARKKALADAKKLGEPPPQKPKGVVSTVKAIYPKKRRPK
Number of Associated Samples 91
Number of Associated Scaffolds 108

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.93 %
% of genes near scaffold ends (potentially truncated) 97.22 %
% of genes from short scaffolds (< 2000 bps) 89.81 %
Associated GOLD sequencing projects 83
AlphaFold2 3D model prediction Yes
3D model pTM-score0.35

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (90.741 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(20.370 % of family members)
Environment Ontology (ENVO) Unclassified
(39.815 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(53.704 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 36.11%    β-sheet: 0.00%    Coil/Unstructured: 63.89%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.35
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 108 Family Scaffolds
PF07676PD40 50.00
PF01625PMSR 10.19
PF02900LigB 1.85
PF00326Peptidase_S9 1.85
PF00550PP-binding 0.93
PF06971Put_DNA-bind_N 0.93
PF14158YndJ 0.93
PF13432TPR_16 0.93
PF09720Unstab_antitox 0.93
PF08530PepX_C 0.93
PF13946DUF4214 0.93
PF05163DinB 0.93
PF02661Fic 0.93
PF07719TPR_2 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 108 Family Scaffolds
COG0225Peptide methionine sulfoxide reductase MsrAPosttranslational modification, protein turnover, chaperones [O] 10.19
COG2318Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB)Secondary metabolites biosynthesis, transport and catabolism [Q] 0.93
COG2936Predicted acyl esteraseGeneral function prediction only [R] 0.93


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms90.74 %
UnclassifiedrootN/A9.26 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459010|GIO7OMY02HNGJ0All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium505Open in IMG/M
3300000033|ICChiseqgaiiDRAFT_c2383029All Organisms → cellular organisms → Bacteria → Proteobacteria4530Open in IMG/M
3300000574|JGI1357J11328_10032002All Organisms → cellular organisms → Bacteria2337Open in IMG/M
3300004782|Ga0062382_10159609All Organisms → cellular organisms → Bacteria959Open in IMG/M
3300004808|Ga0062381_10247563All Organisms → cellular organisms → Bacteria637Open in IMG/M
3300005180|Ga0066685_10559780All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium788Open in IMG/M
3300005328|Ga0070676_11206460All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium575Open in IMG/M
3300005338|Ga0068868_101498346All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium631Open in IMG/M
3300005345|Ga0070692_10717866All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium674Open in IMG/M
3300005437|Ga0070710_10410859All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium909Open in IMG/M
3300005437|Ga0070710_11082998All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium588Open in IMG/M
3300005438|Ga0070701_10855045All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium625Open in IMG/M
3300005445|Ga0070708_100095836All Organisms → cellular organisms → Bacteria2709Open in IMG/M
3300005445|Ga0070708_101895720All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300005446|Ga0066686_10142548All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1579Open in IMG/M
3300005468|Ga0070707_100391801All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1349Open in IMG/M
3300005518|Ga0070699_100749358All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium893Open in IMG/M
3300005518|Ga0070699_102026734All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300005554|Ga0066661_10377320All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium868Open in IMG/M
3300005576|Ga0066708_10923695Not Available544Open in IMG/M
3300005586|Ga0066691_10546304All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium691Open in IMG/M
3300005618|Ga0068864_101652978All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium645Open in IMG/M
3300005841|Ga0068863_101237990All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium753Open in IMG/M
3300006034|Ga0066656_11007144All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium535Open in IMG/M
3300006237|Ga0097621_100340439All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1332Open in IMG/M
3300006796|Ga0066665_10307835All Organisms → cellular organisms → Bacteria1276Open in IMG/M
3300006806|Ga0079220_11192450All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium627Open in IMG/M
3300006854|Ga0075425_100457228Not Available1470Open in IMG/M
3300006871|Ga0075434_100226298All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1890Open in IMG/M
3300006871|Ga0075434_100610969All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1109Open in IMG/M
3300006880|Ga0075429_100167965All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1922Open in IMG/M
3300007258|Ga0099793_10555362All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300009038|Ga0099829_11612233All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300009089|Ga0099828_10506915Not Available1088Open in IMG/M
3300009089|Ga0099828_11788982All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium540Open in IMG/M
3300009094|Ga0111539_10317668All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1813Open in IMG/M
3300009143|Ga0099792_10911827All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium582Open in IMG/M
3300009177|Ga0105248_10208482All Organisms → cellular organisms → Bacteria2202Open in IMG/M
3300010047|Ga0126382_11035900All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium722Open in IMG/M
3300010047|Ga0126382_11181365All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium684Open in IMG/M
3300010337|Ga0134062_10139995All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1068Open in IMG/M
3300010397|Ga0134124_10187947All Organisms → cellular organisms → Bacteria → Proteobacteria1867Open in IMG/M
3300010397|Ga0134124_11415397All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium721Open in IMG/M
3300010397|Ga0134124_11753182All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium654Open in IMG/M
3300010397|Ga0134124_11804414All Organisms → cellular organisms → Bacteria → Acidobacteria646Open in IMG/M
3300010399|Ga0134127_11407956All Organisms → cellular organisms → Bacteria768Open in IMG/M
3300010399|Ga0134127_13286115All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia529Open in IMG/M
3300010400|Ga0134122_12537173Not Available562Open in IMG/M
3300010403|Ga0134123_12845237All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium552Open in IMG/M
3300011271|Ga0137393_10885295All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium762Open in IMG/M
3300011433|Ga0137443_1161702All Organisms → cellular organisms → Bacteria665Open in IMG/M
3300012189|Ga0137388_10773312All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium891Open in IMG/M
3300012199|Ga0137383_11101756All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium575Open in IMG/M
3300012202|Ga0137363_11529206Not Available559Open in IMG/M
3300012204|Ga0137374_10408329All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1077Open in IMG/M
3300012208|Ga0137376_10770712All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium829Open in IMG/M
3300012349|Ga0137387_10054250All Organisms → cellular organisms → Bacteria2683Open in IMG/M
3300012349|Ga0137387_11041133All Organisms → cellular organisms → Bacteria → Acidobacteria585Open in IMG/M
3300012582|Ga0137358_10633675All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium716Open in IMG/M
3300012685|Ga0137397_10098355All Organisms → cellular organisms → Bacteria2143Open in IMG/M
3300012685|Ga0137397_10165951All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1638Open in IMG/M
3300012918|Ga0137396_10831058All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium679Open in IMG/M
3300012925|Ga0137419_10371452All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1111Open in IMG/M
3300012925|Ga0137419_11873276All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium514Open in IMG/M
3300012930|Ga0137407_10186706All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1853Open in IMG/M
3300012961|Ga0164302_11615446Not Available540Open in IMG/M
3300012961|Ga0164302_11716029All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300012975|Ga0134110_10527599All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium540Open in IMG/M
3300013297|Ga0157378_10405390All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1344Open in IMG/M
3300013297|Ga0157378_12002961All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium629Open in IMG/M
3300013306|Ga0163162_12299115All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium619Open in IMG/M
3300013306|Ga0163162_12428884All Organisms → cellular organisms → Bacteria → Acidobacteria603Open in IMG/M
3300013308|Ga0157375_11767972All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium733Open in IMG/M
3300014829|Ga0120104_1002620All Organisms → cellular organisms → Bacteria3251Open in IMG/M
3300015197|Ga0167638_1071840Not Available711Open in IMG/M
3300015254|Ga0180089_1005376All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2115Open in IMG/M
3300015373|Ga0132257_100284740All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1982Open in IMG/M
3300016319|Ga0182033_11872248Not Available545Open in IMG/M
3300018051|Ga0184620_10281315All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300018468|Ga0066662_10079433All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2236Open in IMG/M
3300018469|Ga0190270_12553355Not Available573Open in IMG/M
3300018482|Ga0066669_12235589All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium520Open in IMG/M
3300018920|Ga0190273_12351487All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium506Open in IMG/M
3300019458|Ga0187892_10195919All Organisms → cellular organisms → Bacteria1084Open in IMG/M
3300021073|Ga0210378_10188324All Organisms → cellular organisms → Bacteria790Open in IMG/M
3300024290|Ga0247667_1034892All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium954Open in IMG/M
3300025898|Ga0207692_10511655All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium763Open in IMG/M
3300025907|Ga0207645_10938593All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium587Open in IMG/M
3300025942|Ga0207689_10852947All Organisms → cellular organisms → Bacteria769Open in IMG/M
3300025942|Ga0207689_11430824All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium579Open in IMG/M
3300026023|Ga0207677_10093364All Organisms → cellular organisms → Bacteria2194Open in IMG/M
3300026035|Ga0207703_10308692All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1445Open in IMG/M
3300026089|Ga0207648_11634875All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium605Open in IMG/M
3300026095|Ga0207676_10334160All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1396Open in IMG/M
3300026309|Ga0209055_1222764All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium578Open in IMG/M
3300026326|Ga0209801_1241365All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium694Open in IMG/M
3300026332|Ga0209803_1326887All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium529Open in IMG/M
3300026527|Ga0209059_1276306All Organisms → cellular organisms → Bacteria → Acidobacteria566Open in IMG/M
3300026538|Ga0209056_10553319All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium585Open in IMG/M
3300027778|Ga0209464_10244664All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300027875|Ga0209283_10751612All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium604Open in IMG/M
3300027882|Ga0209590_10645053All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium680Open in IMG/M
3300031231|Ga0170824_104527602All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium603Open in IMG/M
3300031720|Ga0307469_10084799All Organisms → cellular organisms → Bacteria2161Open in IMG/M
3300031740|Ga0307468_100330066All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1126Open in IMG/M
3300032180|Ga0307471_103352888All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium567Open in IMG/M
3300032211|Ga0310896_10093450All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1330Open in IMG/M
3300034165|Ga0364942_0109194Not Available896Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil20.37%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil12.04%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere9.26%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil7.41%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere4.63%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.70%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.70%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment2.78%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.78%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.85%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.85%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.85%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.85%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.93%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater0.93%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.93%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.93%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.93%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.93%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.93%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.93%
Bio-OozeEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze0.93%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.93%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459010Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!)EnvironmentalOpen in IMG/M
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000574Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 mEnvironmentalOpen in IMG/M
3300004782Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2FreshEnvironmentalOpen in IMG/M
3300004808Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1FreshEnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300011433Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT300_2EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014829Permafrost microbial communities from Nunavut, Canada - A10_35cm_6MEnvironmentalOpen in IMG/M
3300015197Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6B, Proglacial plain, adjacent to northern proglacial tributary)EnvironmentalOpen in IMG/M
3300015254Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT860_16_10DEnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300019458Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaGEnvironmentalOpen in IMG/M
3300021073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redoEnvironmentalOpen in IMG/M
3300024290Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026309Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)EnvironmentalOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300026332Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes)EnvironmentalOpen in IMG/M
3300026527Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300027778Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300034165Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
F62_081336802170459010Grass SoilRKKSLAEAKKLGEPAKPKPQGVVSTVKAIYPKKRRPK
ICChiseqgaiiDRAFT_238302913300000033SoilIKTPSDLERSEVRAYMRRAHQLAVDDARKLGETASKVQGVVSTVKAIYPRKRRPGPESRK
JGI1357J11328_1003200213300000574GroundwaterRAYIRRARKKALADAKKLGEPPPQKPKGVVSTVKAIYPKKRRPK*
Ga0062382_1015960913300004782Wetland SedimentEVRSYIRRARKVALADARKLGETTPLLKGVVSKVKAIYPKKRRPAPKDKR*
Ga0062381_1024756323300004808Wetland SedimentVRSYIRRARKVALADARKLGETTPLLKGVVSKVKAIYPKKRRPAPKDKR*
Ga0066685_1055978013300005180SoilEIRSYIRRARKKAIADAWKTDGPPPREPDGVVSKVKAVYPKKRRPK*
Ga0070676_1120646023300005328Miscanthus RhizosphereKSESDLARPEIRAYIRRAKKKALADARKLGEKPPKKPVGVVSTVKAIYAKKRRP*
Ga0068868_10149834623300005338Miscanthus RhizospherePEIRAYIRRAKKNALAEARKLGEKPPKKPAGVISTVKAIYAKKRRP*
Ga0070692_1071786613300005345Corn, Switchgrass And Miscanthus RhizosphereTIKSESDLARPEIRAYIRRAKKKALADARKLGEKPPKKPVGVVSTVKAIYAKKRRP*
Ga0070710_1041085923300005437Corn, Switchgrass And Miscanthus RhizosphereAEDLKRPELRAYIRRAKKKAIADARKLGWAAAQNPKGVISTVKAIYKKKRRPK*
Ga0070710_1108299813300005437Corn, Switchgrass And Miscanthus RhizosphereRAYIRRAKKKARAEARKLGEKPPPKPADVISTVKAIYAKKRRP*
Ga0070701_1085504513300005438Corn, Switchgrass And Miscanthus RhizospherePEIRAYIRRAKKSALAEARKLGEKPPQEPAGVISTVKAIYAKKRRP*
Ga0070708_10009583613300005445Corn, Switchgrass And Miscanthus RhizosphereIRRARKVALAEAKKLGGAPPKKPNGVVSTVKAIYPNKRRPS*
Ga0070708_10189572023300005445Corn, Switchgrass And Miscanthus RhizosphereAYIRRARKVALAEAKKLGGAPPKKPNGVVSTVKAIYPNKRRPVKK*
Ga0066686_1014254823300005446SoilEQPELRAYIRRARKKAVADARKLGEALPKKPEGVVSTVKAVYPKKRRPKAKT*
Ga0070707_10039180113300005468Corn, Switchgrass And Miscanthus RhizosphereRRARKKALSDARKLGESAPLKPDRVISTVKAVYAKKRRPK*
Ga0070699_10074935823300005518Corn, Switchgrass And Miscanthus RhizospherePEIRAYIRRARKQALADARKLEKTPAKKPAGVISTVKAIYPKKRRPK*
Ga0070699_10202673423300005518Corn, Switchgrass And Miscanthus RhizosphereIKSSEDLARPEIRAYIRRARKKALDDARKLGEAAPRKPKGVVSTIKAIYPKKRRPK*
Ga0066661_1037732013300005554SoilRARKKALDDARRLGEPAPKKPEGVVSIVKAIYPKKRRPNRT*
Ga0066708_1092369513300005576SoilRVEDIKRPELRAYIRRAKRKAFADARKLGEPLSKQPAGVVSTVKAIYAKKRRPK*
Ga0066691_1054630423300005586SoilKRPEVRSYIRRARKKAIVEARKIGEPARQKPDRVISTVKAIYPKKRRPK*
Ga0068864_10165297823300005618Switchgrass RhizospherePEIRAYIRRAKKKALAEARKLGEPMPKKPDGVVSTVKAIYARKRRP*
Ga0068863_10123799023300005841Switchgrass RhizosphereDDLKRPEVRSYIRRARKKALADARKLGEPAPAKPKGVVSTVKAIYPKKRRPK*
Ga0066656_1100714423300006034SoilPELRAYIRRARKKAVADARKLGEAAPKKPEGVVSTVKAIYPKKRRPKAKT*
Ga0097621_10034043923300006237Miscanthus RhizosphereDLKRPEVRAYIRRARKKAIADARKLGEPALAKPKGVVSTVKAIYEKKRRPK*
Ga0066665_1030783533300006796SoilRAYIRRARKKALSDARKLGEPAPPKPAGVISTVKAVYPKKRRPKGQT*
Ga0079220_1119245023300006806Agricultural SoilRSYIRRARKRALAEARKLGERHQAPDGVVSTVKAIYPKKRRPR*
Ga0075425_10045722813300006854Populus RhizosphereELRTYIRRARKKALVEARKLGEPPAPEPDGVVSTVKAIYARKRRPSKA*
Ga0075434_10022629813300006871Populus RhizospherePELRAYIRRARKKALAEARKLGEAPKPKPNGVVSTVKAIYPKKRRPK*
Ga0075434_10061096923300006871Populus RhizosphereTAEELQRPEIRSYIRRARKQALADAKKLGEKRQPKPAGVVSTVKAIYPRKRRPK*
Ga0075429_10016796523300006880Populus RhizosphereSYIRRARKKALTEARKLGEPAPAKPKGVVSTVKAIYPKKRRPK*
Ga0099793_1055536213300007258Vadose Zone SoilDLARPEIRAYIRRALKHARSDARKLGEVMPKKPKGVVSTVKAIYPKKRRPVPAR*
Ga0099829_1161223313300009038Vadose Zone SoilKALADARKLGEPAPKKPDGVVSTVKAIYPKKRRPVK*
Ga0099828_1050691513300009089Vadose Zone SoilLARPEIRSYIRRARKKAVAEARKLGEAPTKKPKGVVSNVKAIYAKKRRPAKK*
Ga0099828_1178898223300009089Vadose Zone SoilDLKRPEIRSYLRRARKVALAESRKLGEAPAKKPKGVVSTVKAIYPKKRRPK*
Ga0111539_1031766813300009094Populus RhizosphereKKALTEARKLGEPAPAKPKGVVSTVKAIYPKKRRPK*
Ga0099792_1091182713300009143Vadose Zone SoilELRAYIRRAKKKAFADARKLGEPLSKQPAGVVSTVKAIYAKKRRPK*
Ga0105248_1020848213300009177Switchgrass RhizospherePEIRAYIRRAKKKALAEARKLGERPPQKPAGVISTVKAIYAKKRRPAATLKK*
Ga0126382_1103590023300010047Tropical Forest SoilRSYIRRARKKALADAKKLGEKTKKPDRVVSTVKAIYPKKRRPK*
Ga0126382_1118136513300010047Tropical Forest SoilYIKRARKKALADARKLGETPPRKPDGVVSTVKAIYATKRRPKSRPEVGK*
Ga0134062_1013999523300010337Grasslands SoilRKKAVADARKLGEALPKKPEGVVSTVKAVYPKKRRPKAKT*
Ga0134124_1018794733300010397Terrestrial SoilSDLERSEVRAYMRRAHQLAVDDARKSGETASKVQGVVSTVKAIYPRKRRPGLVSRK*
Ga0134124_1141539723300010397Terrestrial SoilRRARKKALAEARKLGERYQPPDGVVSTVKAIYPKKRRPT*
Ga0134124_1175318213300010397Terrestrial SoilKTIEDIKRPVIRSYIRRARKKAIADARRFCAPVLPKADGVVSTVKAVYAKKRRPA*
Ga0134124_1180441413300010397Terrestrial SoilRPELRSYIRRARKQALAEARKLGETQPKPKGVISTVKAIYPKKRRPK*
Ga0134127_1140795633300010399Terrestrial SoilALADARKLGGPRSQPPDGVISTVKKIYAKKRRPK*
Ga0134127_1328611513300010399Terrestrial SoilIRRAKRRASADARKLGEAAKKTKGVISTVKAVYPKKRRPR*
Ga0134122_1253717313300010400Terrestrial SoilERPELRTYIRRARQVAIDDARKLGETAPPVEGLISTVKAIYPKKRRPIPASLK*
Ga0134123_1284523713300010403Terrestrial SoilKKALADARKLGEPAPAKPKGVVSTVKAIYPKKRRPK*
Ga0137393_1088529513300011271Vadose Zone SoilADIKRPEIRAYIRRARKKALADARKLGEPAPPEPDGVISTVKAIYPKKRRPK*
Ga0137443_116170223300011433SoilRGYVRRARQVAIDDARKLGETAPTVAGVISTVKAIYARKRRPVPSRGSDR*
Ga0137388_1077331223300012189Vadose Zone SoilKRARKFALAEAKKLGEPPPQKPEGVVSTVKAIYPKKRRPK*
Ga0137383_1110175623300012199Vadose Zone SoilYIQRARKVALAESKKLGDAPPKKPKGVVSTVKAIYAKKRRPK*
Ga0137363_1152920613300012202Vadose Zone SoilRAREGAIADARKLGEVMPPRAKGVVSVVKAIYPKKRRPGANSKK*
Ga0137374_1040832923300012204Vadose Zone SoilAADVERPEIRAYIRRARKKALADARKLGEPAPAKRAGLISTVKAIYPKKRRPK*
Ga0137376_1077071223300012208Vadose Zone SoilPEIRSYIRRARKKAIADARKLGEPAPQKPAGVVSTVKAIYPKKRRPK*
Ga0137387_1005425013300012349Vadose Zone SoilDLRRPEIRGYIKRARKVALAEAKKLGDTPPKKPKGVVSTVKAIYAKKRRPK*
Ga0137387_1104113313300012349Vadose Zone SoilDLRRPEIRGYIKRARKVALAEAKKLGDAQPKKPKGVVSTVKAIYLKKRRPKK*
Ga0137358_1063367513300012582Vadose Zone SoilDLNRPELRTYIRRARRQALKDARRLGAPAKTKPKGVVSTVKAIYPKKRRPK*
Ga0137397_1009835523300012685Vadose Zone SoilEDIKRAEIRAYIRRARAKALADARKLGEPPPQKPAGVVSTVKAIYAKKRRPR*
Ga0137397_1016595123300012685Vadose Zone SoilRKKALADARKLGEPAPKKPAGVVSAVKAIYPKKRRPKSYPG*
Ga0137396_1083105823300012918Vadose Zone SoilRKKAMADARKLGEPPPKKPKGVVSTVKAIYPKKRRPKTKT*
Ga0137419_1037145223300012925Vadose Zone SoilAYIRRARAKALADARKLGEPPPQKPAGVVSTVKAIYAKKRRPK*
Ga0137419_1187327613300012925Vadose Zone SoilRPEIRAYIRRARKKAVAEAKKLGGAPTTKPKGVVSTVKAIYPKKRRPK*
Ga0137407_1018670633300012930Vadose Zone SoilIRRAKKKAFADARKLGEPLTKEPGGVVSTVKAIYAKKRRPK*
Ga0164302_1161544623300012961SoilRRAKKNALAETRKLGEKPPQKPAGVISTVKAIYAKKRRP*
Ga0164302_1171602913300012961SoilIKIRTPADLVRPEIRAYVRRARQVAIDDARKLGETVSKVEGVVSTVKAIYPKKRRPVPNP
Ga0134110_1052759923300012975Grasslands SoilLFRPEIRAYIQRARKVALAESKKLGDAPPKKPKGVVSTVKAIYAKKRRPK*
Ga0157378_1040539023300013297Miscanthus RhizosphereELRAYIRRARKQAVADAKKMGEPTPVKPKGVVSTVKAIYPKKRRPAGSG*
Ga0157378_1200296113300013297Miscanthus RhizosphereMRADIRRAKKNALAEARKLGEKPPKKPAGVISTVKAIYAKKRRP*
Ga0163162_1229911513300013306Switchgrass RhizospherePEIRAYIRRAKKKALAEARKLGEPASPKRVGVVSTVKAVYAKKRRPGATLKK*
Ga0163162_1242888413300013306Switchgrass RhizosphereRKQAIADAKKMGEPTPVKPKGVVSTVKAIYPKKRRPAGSG*
Ga0157375_1176797213300013308Miscanthus RhizosphereAKKKALADARRLGEAPTKKPAGVVSTVKAIYAKKRRP*
Ga0120104_100262043300014829PermafrostTITGVEDIKRPELRTYIRRAKKKAFADARKLGEPLPKQADGVVSTVKAIYAKKRRPT*
Ga0167638_107184013300015197Glacier Forefield SoilAADIKRPELRSYIRRARKKALADARMLGEPTLQKPAGVVSTVKAIYKKKRRPA*
Ga0180089_100537613300015254SoilRRARQVAIDDARKLGETAPTVAGVISTVKAIYARKRRPVPSRGSDR*
Ga0132257_10028474013300015373Arabidopsis RhizosphereKPEDLKRPELRAYIRRARKKALTEARRLGERPVAPTDVVSTVKAIYPKKRRPN*
Ga0182033_1187224813300016319SoilHIRFKTETDLTRPDVRAYIRRAKKQALAETRKLGEPPPKKPAGVISTVKAIYAKKRRP
Ga0184620_1028131513300018051Groundwater SedimentRARKVAIDEARKLGETAPPVKGVISTVKAIYPKKRRPSPK
Ga0066662_1007943333300018468Grasslands SoilMKASEDLERPELRAYIRRARKKALSDARKLGEPAPEKPEGVVSTVKAIYPKKRRPK
Ga0190270_1255335513300018469SoilRKAALADARKLGGPKSPKPEGVISTVKAIYPKNRRPK
Ga0066669_1223558923300018482Grasslands SoilPDDLKRREIRSYIRRARKKAIADARKLGEPLLRKPDGVVSTVKAVYPKKRRPKLVKRQR
Ga0190273_1235148713300018920SoilRPEIRAYLRRAHQSAIDDARKLGDGRAKSMKGVVSTVKAIYPKKRRPNLNS
Ga0187892_1019591913300019458Bio-OozeRKAALRDAGKLGEPTKKPKGVVSTVKAIYPKKRRPKKVK
Ga0210378_1018832423300021073Groundwater SedimentRRARKRATDDARKLGEPAPKTLNGVVSTVKAIYPKKRRPR
Ga0247667_103489223300024290SoilADLERPVLRSYIRRAQKTALADMKMLGETPPPKPDGVISTVKAIYPRKRRPK
Ga0207692_1051165513300025898Corn, Switchgrass And Miscanthus RhizosphereAEDLKRPELRAYIRRAKKKAIADARKLGWAAAQNPKGVISTVKAIYKKKRRPK
Ga0207645_1093859323300025907Miscanthus RhizosphereKSESDLARPEIRAYIRRAKKKALADARKLGEKPPKKPVGVVSTVKAIYAKKRRP
Ga0207689_1085294723300025942Miscanthus RhizosphereLERPEVRAYVRRARRLAIDDARKLGETASKVKGVVSTVKAIYPKKRRPIVDGKVRKSD
Ga0207689_1143082413300025942Miscanthus RhizosphereVDLKRPELRSYIRRARKAALADARKLGGPKSPKPDGVISTVKAIYPKKRRPK
Ga0207677_1009336423300026023Miscanthus RhizosphereAYIRRAKKNALAEARKLGEKPPKKPAGVISTVKAIYAKKRRP
Ga0207703_1030869213300026035Switchgrass RhizosphereIRRARKKALADARKLGEPAPAKPKGVVSTVKAIYPKKRRPK
Ga0207648_1163487513300026089Miscanthus RhizosphereRAYIRRARKKALAEARKLGEAPKQKPNGVVSTVKAIYPKKRRPK
Ga0207676_1033416023300026095Switchgrass RhizosphereAYIRRAKKKAVAEARKLGEQPPRKPAGVVSTVKAIYPKKRRPK
Ga0209055_122276423300026309SoilRARKKALDDARRLGEPAPKKPEGVVSIVKAIYPKKRRPNRT
Ga0209801_124136513300026326SoilIARPELRAYIRHARKKALADAKKLGEAAPDKPDGVISTVKAIYPKKRRPIKK
Ga0209803_132688713300026332SoilAYIRRARKKALADARKLGEALPKKPEGVVSTVKAVYPKKRRPKAKT
Ga0209059_127630613300026527SoilRARKKALSDARKLGEPPPEKPEGVVSTVKAIYPKKRRPKTKT
Ga0209056_1055331923300026538SoilALSDARKLGEPAPEKPEGVVSTVKAIYPKKRRPKTKT
Ga0209464_1024466423300027778Wetland SedimentVRSYIRRARKVALADARKLGETTPLLKGVVSKVKAIYPKKRRPAPKDKR
Ga0209283_1075161223300027875Vadose Zone SoilRKKAVAEARKLGEAPTKKPKGVVSNVKAIYAKKRRPAKK
Ga0209590_1064505323300027882Vadose Zone SoilLRAYIRRARKKALADARKLGEPAPKKPEGVVSTVKAIYPKKRRPKAKT
Ga0170824_10452760223300031231Forest SoilREIRAYIRRAKKKALADARKLGERPPKKPTGVVSTVKAIYAKKRRP
Ga0307469_1008479913300031720Hardwood Forest SoilAPEDLERRQIRSYIARARKKAFADARKLGEQLPPKPDDVVSTVKAIYPKKRRPKLVKKRQ
Ga0307468_10033006623300031740Hardwood Forest SoilKKALADARKLGEPTAEKPAGVISTVKAIYPKKRRPK
Ga0307471_10335288823300032180Hardwood Forest SoilCIRRARKKALADARKLGEPAPKKPENVVSTVKAIYPKKRRPK
Ga0310896_1009345013300032211SoilRRARKKALADARKLGEPAPAMPKGVVSTVKAIYPKKRRPK
Ga0364942_0109194_740_8953300034165SedimentRLEIRSYVRRARKVAIDDARKLGETRPKNIAGVVSTVKAIYPKRCRPISKS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.