NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F090465

Metagenome / Metatranscriptome Family F090465

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F090465
Family Type Metagenome / Metatranscriptome
Number of Sequences 108
Average Sequence Length 40 residues
Representative Sequence MSSKITNQLVLDCIKQMREKTKERKFKQTVELQVALKDYDP
Number of Associated Samples 93
Number of Associated Scaffolds 108

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 93.52 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 90
AlphaFold2 3D model prediction Yes
3D model pTM-score0.49

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (98.148 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(35.185 % of family members)
Environment Ontology (ENVO) Unclassified
(42.593 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(66.667 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 43.48%    β-sheet: 0.00%    Coil/Unstructured: 56.52%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.49
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 108 Family Scaffolds
PF00687Ribosomal_L1 83.33

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 108 Family Scaffolds
COG0081Ribosomal protein L1Translation, ribosomal structure and biogenesis [J] 83.33

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.07 %
UnclassifiedrootN/A0.93 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002835|B570J40625_101093921All Organisms → cellular organisms → Eukaryota674Open in IMG/M
3300004764|Ga0007754_1402923All Organisms → cellular organisms → Bacteria → Proteobacteria773Open in IMG/M
3300004769|Ga0007748_10111544All Organisms → cellular organisms → Eukaryota881Open in IMG/M
3300004789|Ga0007752_10040956All Organisms → cellular organisms → Eukaryota747Open in IMG/M
3300004790|Ga0007758_10033401All Organisms → cellular organisms → Eukaryota820Open in IMG/M
3300006356|Ga0075487_1442235All Organisms → cellular organisms → Eukaryota793Open in IMG/M
3300006379|Ga0075513_1304567All Organisms → cellular organisms → Eukaryota593Open in IMG/M
3300006397|Ga0075488_1625571All Organisms → cellular organisms → Eukaryota845Open in IMG/M
3300006415|Ga0099654_10551731All Organisms → cellular organisms → Eukaryota815Open in IMG/M
3300008108|Ga0114341_10243066All Organisms → cellular organisms → Eukaryota975Open in IMG/M
3300008993|Ga0104258_1042053All Organisms → cellular organisms → Eukaryota856Open in IMG/M
3300009441|Ga0115007_10263510All Organisms → cellular organisms → Eukaryota1116Open in IMG/M
3300009543|Ga0115099_10126042All Organisms → cellular organisms → Eukaryota518Open in IMG/M
3300009599|Ga0115103_1169288All Organisms → cellular organisms → Eukaryota827Open in IMG/M
3300009608|Ga0115100_10939481All Organisms → cellular organisms → Eukaryota821Open in IMG/M
3300009677|Ga0115104_11015294All Organisms → cellular organisms → Eukaryota637Open in IMG/M
3300010306|Ga0129322_1081858All Organisms → cellular organisms → Eukaryota904Open in IMG/M
3300010404|Ga0129323_1086899All Organisms → cellular organisms → Eukaryota721Open in IMG/M
3300010981|Ga0138316_11273863All Organisms → cellular organisms → Eukaryota647Open in IMG/M
3300010981|Ga0138316_11295364All Organisms → cellular organisms → Eukaryota648Open in IMG/M
3300010985|Ga0138326_11367807All Organisms → cellular organisms → Eukaryota557Open in IMG/M
3300012518|Ga0129349_1344797All Organisms → cellular organisms → Eukaryota801Open in IMG/M
3300012713|Ga0157544_1097097All Organisms → cellular organisms → Eukaryota528Open in IMG/M
3300012715|Ga0157599_1082325All Organisms → cellular organisms → Eukaryota780Open in IMG/M
3300012756|Ga0138272_1100290All Organisms → cellular organisms → Eukaryota720Open in IMG/M
3300012771|Ga0138270_1053962All Organisms → cellular organisms → Eukaryota700Open in IMG/M
3300012778|Ga0138269_1296606All Organisms → cellular organisms → Eukaryota755Open in IMG/M
3300012968|Ga0129337_1221896All Organisms → cellular organisms → Eukaryota755Open in IMG/M
3300012969|Ga0129332_1067852All Organisms → cellular organisms → Eukaryota914Open in IMG/M
3300012970|Ga0129338_1311469All Organisms → cellular organisms → Eukaryota759Open in IMG/M
3300013295|Ga0170791_13127293All Organisms → cellular organisms → Eukaryota646Open in IMG/M
3300013295|Ga0170791_16302568All Organisms → cellular organisms → Eukaryota749Open in IMG/M
3300018622|Ga0188862_1011358All Organisms → cellular organisms → Eukaryota798Open in IMG/M
3300018739|Ga0192974_1032662All Organisms → cellular organisms → Eukaryota902Open in IMG/M
3300018871|Ga0192978_1037180All Organisms → cellular organisms → Eukaryota915Open in IMG/M
3300018871|Ga0192978_1046054All Organisms → cellular organisms → Eukaryota819Open in IMG/M
3300018989|Ga0193030_10125243All Organisms → cellular organisms → Eukaryota815Open in IMG/M
3300019017|Ga0193569_10171205All Organisms → cellular organisms → Eukaryota976Open in IMG/M
3300019031|Ga0193516_10102241All Organisms → cellular organisms → Eukaryota976Open in IMG/M
3300019031|Ga0193516_10171015All Organisms → cellular organisms → Eukaryota729Open in IMG/M
3300019048|Ga0192981_10162564All Organisms → cellular organisms → Eukaryota881Open in IMG/M
3300019108|Ga0192972_1043156All Organisms → cellular organisms → Eukaryota881Open in IMG/M
3300019149|Ga0188870_10078422All Organisms → cellular organisms → Eukaryota804Open in IMG/M
3300019149|Ga0188870_10093275All Organisms → cellular organisms → Eukaryota727Open in IMG/M
3300021169|Ga0206687_1400533All Organisms → cellular organisms → Eukaryota815Open in IMG/M
3300021345|Ga0206688_10038940All Organisms → cellular organisms → Eukaryota519Open in IMG/M
3300021345|Ga0206688_10101396All Organisms → cellular organisms → Eukaryota644Open in IMG/M
3300021350|Ga0206692_1327536All Organisms → cellular organisms → Eukaryota705Open in IMG/M
3300021350|Ga0206692_1707071All Organisms → cellular organisms → Eukaryota524Open in IMG/M
3300021353|Ga0206693_1618103All Organisms → cellular organisms → Eukaryota625Open in IMG/M
3300021359|Ga0206689_10367704All Organisms → cellular organisms → Eukaryota823Open in IMG/M
3300021424|Ga0194117_10493108All Organisms → cellular organisms → Eukaryota548Open in IMG/M
3300021869|Ga0063107_100083All Organisms → cellular organisms → Eukaryota520Open in IMG/M
3300021872|Ga0063132_105335All Organisms → cellular organisms → Eukaryota799Open in IMG/M
3300021879|Ga0063113_118685All Organisms → cellular organisms → Eukaryota834Open in IMG/M
3300021885|Ga0063125_1007358All Organisms → cellular organisms → Eukaryota700Open in IMG/M
3300021885|Ga0063125_1015041All Organisms → cellular organisms → Eukaryota865Open in IMG/M
3300021887|Ga0063105_1001369All Organisms → cellular organisms → Eukaryota772Open in IMG/M
3300021889|Ga0063089_1022062All Organisms → cellular organisms → Eukaryota758Open in IMG/M
3300021899|Ga0063144_1152801All Organisms → cellular organisms → Eukaryota549Open in IMG/M
3300021902|Ga0063086_1017899All Organisms → cellular organisms → Eukaryota566Open in IMG/M
3300021906|Ga0063087_1045664All Organisms → cellular organisms → Eukaryota700Open in IMG/M
3300021910|Ga0063100_1001260All Organisms → cellular organisms → Eukaryota660Open in IMG/M
3300021913|Ga0063104_1001103All Organisms → cellular organisms → Eukaryota804Open in IMG/M
3300021922|Ga0063869_1034759All Organisms → cellular organisms → Eukaryota719Open in IMG/M
3300021927|Ga0063103_1004425All Organisms → cellular organisms → Eukaryota709Open in IMG/M
3300021927|Ga0063103_1096690All Organisms → cellular organisms → Eukaryota559Open in IMG/M
3300021928|Ga0063134_1176801All Organisms → cellular organisms → Eukaryota589Open in IMG/M
3300021941|Ga0063102_1014584All Organisms → cellular organisms → Eukaryota708Open in IMG/M
3300021943|Ga0063094_1000873All Organisms → cellular organisms → Eukaryota810Open in IMG/M
3300021954|Ga0063755_1082222All Organisms → cellular organisms → Eukaryota769Open in IMG/M
3300023567|Ga0228694_115399All Organisms → cellular organisms → Eukaryota803Open in IMG/M
3300023683|Ga0228681_1016475All Organisms → cellular organisms → Eukaryota842Open in IMG/M
3300023704|Ga0228684_1055951All Organisms → cellular organisms → Eukaryota614Open in IMG/M
3300026434|Ga0247591_1071723All Organisms → cellular organisms → Eukaryota653Open in IMG/M
3300026448|Ga0247594_1041007All Organisms → cellular organisms → Eukaryota790Open in IMG/M
3300026461|Ga0247600_1033568All Organisms → cellular organisms → Eukaryota989Open in IMG/M
3300026465|Ga0247588_1100430All Organisms → cellular organisms → Eukaryota579Open in IMG/M
3300026468|Ga0247603_1034594All Organisms → cellular organisms → Eukaryota993Open in IMG/M
3300026470|Ga0247599_1123566All Organisms → cellular organisms → Eukaryota539Open in IMG/M
3300026495|Ga0247571_1066854All Organisms → cellular organisms → Eukaryota822Open in IMG/M
3300026495|Ga0247571_1158534All Organisms → cellular organisms → Eukaryota535Open in IMG/M
3300026500|Ga0247592_1075299All Organisms → cellular organisms → Eukaryota820Open in IMG/M
3300026503|Ga0247605_1078904All Organisms → cellular organisms → Eukaryota811Open in IMG/M
3300027712|Ga0209499_1144308Not Available873Open in IMG/M
3300028109|Ga0247582_1086526All Organisms → cellular organisms → Eukaryota819Open in IMG/M
3300028282|Ga0256413_1172777All Organisms → cellular organisms → Eukaryota780Open in IMG/M
3300028575|Ga0304731_11671971All Organisms → cellular organisms → Eukaryota647Open in IMG/M
3300030670|Ga0307401_10174373All Organisms → cellular organisms → Eukaryota965Open in IMG/M
3300030670|Ga0307401_10182344All Organisms → cellular organisms → Eukaryota944Open in IMG/M
3300030670|Ga0307401_10251624All Organisms → cellular organisms → Eukaryota801Open in IMG/M
3300030699|Ga0307398_10276751All Organisms → cellular organisms → Eukaryota907Open in IMG/M
3300030702|Ga0307399_10258183All Organisms → cellular organisms → Eukaryota821Open in IMG/M
3300031522|Ga0307388_10688398All Organisms → cellular organisms → Eukaryota682Open in IMG/M
3300031710|Ga0307386_10502889All Organisms → cellular organisms → Eukaryota634Open in IMG/M
3300031725|Ga0307381_10116317All Organisms → cellular organisms → Eukaryota892Open in IMG/M
3300031734|Ga0307397_10179068All Organisms → cellular organisms → Eukaryota929Open in IMG/M
3300031739|Ga0307383_10183811All Organisms → cellular organisms → Eukaryota979Open in IMG/M
3300031739|Ga0307383_10281112All Organisms → cellular organisms → Eukaryota802Open in IMG/M
3300031739|Ga0307383_10415188All Organisms → cellular organisms → Eukaryota663Open in IMG/M
3300031742|Ga0307395_10170088All Organisms → cellular organisms → Eukaryota918Open in IMG/M
3300031742|Ga0307395_10371856All Organisms → cellular organisms → Eukaryota620Open in IMG/M
3300032150|Ga0314779_1012472All Organisms → cellular organisms → Eukaryota794Open in IMG/M
3300032518|Ga0314689_10469838All Organisms → cellular organisms → Eukaryota659Open in IMG/M
3300032521|Ga0314680_10343240All Organisms → cellular organisms → Eukaryota917Open in IMG/M
3300032651|Ga0314685_10499461All Organisms → cellular organisms → Eukaryota669Open in IMG/M
3300032714|Ga0314686_10365838All Organisms → cellular organisms → Eukaryota718Open in IMG/M
3300032746|Ga0314701_10328245All Organisms → cellular organisms → Eukaryota694Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine35.19%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater13.89%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine12.04%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous8.33%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake6.48%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater6.48%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater4.63%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake3.70%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.85%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.85%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater0.93%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton0.93%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.93%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.93%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.93%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300004764Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004769Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004789Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004790Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006356Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006379Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006397Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006415Algae and Fungi communities from freshwater lake (pre-blooming) in Auvergne, France - collected by filtering lake water, a 'reference genome' of the lake communityEnvironmentalOpen in IMG/M
3300008108Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NAEnvironmentalOpen in IMG/M
3300008993Marine microbial communities from eastern North Pacific Ocean - P1 free-livingEnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010306Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010404Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010981Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 4)EnvironmentalOpen in IMG/M
3300010985Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 8)EnvironmentalOpen in IMG/M
3300012518Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012713Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES033 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012715Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES122 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012756Freshwater microbial communities from Lake Croche, Canada - C_130709_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012771Freshwater microbial communities from Lake Croche, Canada - C_130625_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012778Freshwater microbial communities from Lake Croche, Canada - C_130208_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012968Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012969Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012970Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300018622Metatranscriptome of marine microbial communities from Baltic Sea - GS684_3p0_dTEnvironmentalOpen in IMG/M
3300018739Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789514-ERR1719246)EnvironmentalOpen in IMG/M
3300018871Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001026 (ERX1789475-ERR1719345)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019017Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002781EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019108Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001017 (ERX1809742-ERR1740135)EnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021345Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021353Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021359Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021424Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surfaceEnvironmentalOpen in IMG/M
3300021869Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-135M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021872Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021879Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-5 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021885Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-19 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021887Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-132M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021889Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-3S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021899Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S27 C1 B23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021902Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021906Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-2M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021910Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-87M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021913Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-130M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021922Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 10m ARK-5M ARK-5-2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021927Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-122M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021928Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S9 C1 B7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021941Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-120M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021943Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-27M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021954Marine eukaryotic phytoplankton communities from the Norwegian Sea - 10m ARK-5M Euk ARK-5-1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300023567Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 80R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023683Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 22R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023704Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 35R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026434Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 53R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026448Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 57R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026461Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 75R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026465Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 48R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026468Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 79R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026470Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 73R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026500Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026503Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027712Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300028109Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 41R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028575Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030670Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030702Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031522Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031742Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032150Metatranscriptome of sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB 2018 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300032518Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032521Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032651Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032714Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032746Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
B570J40625_10109392113300002835FreshwaterMTSKITNQLVLDSIKQMREKTKERKFKQTVELQVALKDYDP*
Ga0007754_140292333300004764Freshwater LakeHLIMASKINNALVLSCVKEMREKSKARKFQQTVELQVALKDYDP*
Ga0007748_1011154443300004769Freshwater LakeTHLIMASKINNALVLQCVKEMREKSKARKFQQTVELQVALKDYDP*
Ga0007752_1004095613300004789Freshwater LakeMASKINNALVLQCVKEMREKSKARKFQQTVELQVALKDYDP*
Ga0007758_1003340113300004790Freshwater LakeSKINNALVLQCVKEMREKSKARKFQQTVELQVALKDYDP*
Ga0075487_144223513300006356AqueousMSSKITNAQTLECIKQMKDNTKERKFKQTVELQVGIKDYDP*
Ga0075513_130456723300006379AqueousTNAQTLECIKQMKDNTKERKFKQTVELQVGIKDYDP*
Ga0075488_162557113300006397AqueousKVMSSKITNAQTLECIKQMKDNTKERKFKQTVELQVGIKDYDP*
Ga0099654_1055173113300006415LakeKTHLIMASKINNALVLSCVKEMREKSKARKFQQTVELQVALKDYDP*
Ga0114341_1024306623300008108Freshwater, PlanktonMSSKITNQLVLDCIKQMRENTKERKFKQTVELQVALKDYDP*
Ga0104258_104205313300008993Ocean WaterKITNALVLECIKEMKKGSKDRKFTQTVELQVGLKDYDP*
Ga0115007_1026351013300009441MarineMSSKITNALVLECITTMREGAKKRKFTQTVELQVGIKDYDP*
Ga0115099_1012604223300009543MarineSKITNAFTLECIDKMRKDTKERKFRQTVELQVAIKDYDP*
Ga0115103_116928813300009599MarineRAMTSKITNAHTLECIAKMREGTKARKFTQTAELQVAIKDYDP*
Ga0115100_1093948123300009608MarineLRAMTSKITNAHTLECIAKMREGTKARKFTQTAELQVAIKDYDP*
Ga0115104_1101529423300009677MarineAGVLDNIATLRETHKARKFKQTVELQVGIKDYDP*
Ga0129322_108185823300010306AqueousFRMSKITNALVLSCIKEMREKSKERKFMQTVELQVALKDYDP*
Ga0129323_108689923300010404AqueousKITNALVLSCIKEMREKSKERKFMQTVELQVALKDYDP*
Ga0138316_1127386333300010981MarineSKITNALVLECIDDMRKKTKERKFAQTVELQVALKDYDP*
Ga0138316_1129536413300010981MarineALVLECIKKMREGTKKRGFTQTVELQVALKDYDP*
Ga0138326_1136780713300010985MarineTNALVLECIDDMRKKTKERKFAQTVELQVALKDYDP*
Ga0129349_134479723300012518AqueousSKITNALVLDSIKEMREKSKKERKFQETVELQIALKDYDP*
Ga0157544_109709723300012713FreshwaterTNQLVLDSIKQMREKTKERKFKQTVELQVALKDYDP*
Ga0157599_108232523300012715FreshwaterKITNQLVLDCIKQMRENTKERKFKQTVELQVALKDYDP*
Ga0138272_110029013300012756Freshwater LakeHKVMSSKINNALVLNCIKEMRENSKARKFKQTVELQVSLKDYDP*
Ga0138270_105396223300012771Freshwater LakeKINNALVLNCIKEMRENSKARKFKQTVELQVSLKDYDP*
Ga0138269_129660613300012778Freshwater LakeLIMASKINNALVLSCVKEMREKSKARKFQQTVELQVALKDYDP*
Ga0129337_122189613300012968AqueousMQSKISNALVLQCIKEMREKSKKRKFTQTVELQIALKDYDP*
Ga0129332_106785223300012969AqueousFRMSKITNALVISCIKEMREKSKERKFMQTVELQVALKDYDP*
Ga0129338_131146913300012970AqueousITNQLVLDCIKQMREKTKERKFKQTVELQVALKDYDP*
Ga0170791_1312729313300013295FreshwaterKINNALVLQCVKEMREKSKARKFQQTVELQVALKDYDP*
Ga0170791_1630256833300013295FreshwaterMASKINNALVLSCVKEMREKSKARKFQQTVELQVALKDYDP*
Ga0188862_101135833300018622Freshwater LakeMSKITNAQTLECIKEMKDKTKERKFKQTVELQVGIKDYDP
Ga0192974_103266213300018739MarineMTTQKITNQLVLDCIGEMRGKTKERKFLQTVELQVALKDYDP
Ga0192978_103718013300018871MarineIQMTSKITNALVMECIKKMKEGTKKRNFTQTIELQVALKDYDP
Ga0192978_104605413300018871MarineSSKITNALVLECIADMKDGCKKRKFTQTVELQVGIKDYDP
Ga0193030_1012524313300018989MarineHGIFILNMSSKITNALVLDCIKEMREGAKKRKAGIVQTIELQVALKDYDP
Ga0193569_1017120513300019017MarineMTSKITNQLVLDCISEMKGKSKERKFMQTVELQVALKDYDP
Ga0193516_1010224123300019031MarineMSSKITAALLKECIEEMRQKTKDRKFKQTVELQVALKDYDP
Ga0193516_1017101513300019031MarineHGDLLFDIKLRMTSKISNDLVRECIADMREKTKERKFKQTVELQVALKDYDP
Ga0192981_1016256413300019048MarineMGINNLNRMSSKITNALVLECIADMKDGCKKRKFTQTVELQVGIKDYDP
Ga0192972_104315623300019108MarineQKITNQLVLDCIGEMRGKTKERKFLQTVELQVALKDYDP
Ga0188870_1007842233300019149Freshwater LakeKVMSKITNAQTLECIKEMKDKTKERKFKQTVELQVGIKDYDP
Ga0188870_1009327533300019149Freshwater LakeRMSSKITNAQILDAIKAIKEGKKKRGFTETFELQVGLKDYDP
Ga0206687_140053313300021169SeawaterAMSSKITNAFTLECIDKMRKDTKERKFRQTVELQVAIKDYDP
Ga0206688_1003894013300021345SeawaterSKITNALVLDCIKRMRDGTKKRGFTQTVELQVALKDYDP
Ga0206688_1010139613300021345SeawaterMSSKITNAFTLECIDKMRKDTKERKFRQTVELQVAIKDYDP
Ga0206692_132753623300021350SeawaterFFKAMSSKITNAFTLECIDKMRKDTKERKFRQTVELQVAIKDYDP
Ga0206692_170707113300021350SeawaterRMSKITNQLALDCIKTMKDKTKERKFKQTVELQVGIKDYDP
Ga0206693_161810313300021353SeawaterKITNALVLECIKKMKEGTKKRNFTQTVELQVALKDYDP
Ga0206689_1036770433300021359SeawaterSSKITNALVLDCIKRMRDGTKKRGFTQTVELQVALKDYDP
Ga0194117_1049310823300021424Freshwater LakeMSSKITNQLVLDCIKQMREKTKERKFKQTVELQVALKDYDP
Ga0063107_10008313300021869MarineMSSKITNALVLECITTMREGAKKRKFTQTVELQVGIKDYDP
Ga0063132_10533513300021872MarineSKITNALVLECIKQMREGAKKRKFTQTVELQVGIKDYDP
Ga0063113_11868513300021879MarineMSSKITNALVLECIKDMRAGTKDRKFAQTVELQVALKDYDP
Ga0063125_100735813300021885MarineSKITNAGVLDCIKNMREKTKARKFKQTVELQVGIKDYDP
Ga0063125_101504113300021885MarineQMSSKITNKIVLEAIENMKEATKKRKFTQTVELQVAIKDYDP
Ga0063105_100136913300021887MarineSSKITNAIVLECIKTMRDGAKKRKFTQTVELQVGIKDYDP
Ga0063089_102206213300021889MarineAMSSKITNALVLDCIKTMREGAKKRKFTQTVELQVGIKDYDP
Ga0063144_115280113300021899MarineKITAALLKECIEEMRTKTKDRKFKQTVELQVALKDYDP
Ga0063086_101789913300021902MarineSKITNTLVLECVKTMREGAKKRKFTQTVELQVGIKDYDP
Ga0063087_104566413300021906MarineSKITNALVLDCIKTMREGAKKRKFTQTVELQVGIKDYDP
Ga0063100_100126013300021910MarineDMSSKITNAIVLECIKTMRDGAKKRKFTQTVELQVGIKDYDP
Ga0063104_100110313300021913MarineKDMSSKITNAIVLECIKTMRDGAKKRKFTQTVELQVGIKDYDP
Ga0063869_103475913300021922MarineKITNALVLESIKDMREGSKVRKFTQTVELQVALKDYDP
Ga0063103_100442513300021927MarineMSSKITNQLVLDCIKTMREGAKKRKFTQTVELQVGIKDYDP
Ga0063103_109669013300021927MarineSSKISNNLVLECITQMREGTKKRNFTQTVELQVAIKDYDP
Ga0063134_117680113300021928MarineNALVLDCIKEMREGAKKRKAGIVQTIELQVALKDYDP
Ga0063102_101458413300021941MarineSSKITNQLVLDCIKTMREGAKKRKFTQTVELQVGIKDYDP
Ga0063094_100087313300021943MarineSSKITNALVLECITTMREGAKKRKFTQTVELQVGIKDYDP
Ga0063755_108222213300021954MarineITNALVLDCIKTMREGAKKRKFTQTVELQVGIKDYDP
Ga0228694_11539913300023567SeawaterMSSKITNTGVVENIKNMREKSKARKFKQTVELQVGIKDYDP
Ga0228681_101647513300023683SeawaterKMSKISNALVLECIADMREKSKERKFKQTVELQVSLKDYDP
Ga0228684_105595113300023704SeawaterNALVLDCIKEMREKSKKERKFKETVELQIALKDYDP
Ga0247591_107172323300026434SeawaterKITNALVLDCIKEMREKSKKERKFKETVELQIALKDYDP
Ga0247594_104100723300026448SeawaterSSKITNTGVVENIKNMREKSKARKFKQTVELQVGIKDYDP
Ga0247600_103356813300026461SeawaterISNALVLECIADMREKSKERKFKQTVELQVSLKDYDP
Ga0247588_110043013300026465SeawaterTNSHTLECIAQMRERTKERKFRQTVELQVAIKDYDP
Ga0247603_103459413300026468SeawaterKISNALVLECIADMREKSKERKFKQTVELQVSLKDYDP
Ga0247599_112356613300026470SeawaterITNALVLDCIKEMREKSKKERKFKETVELQIALKDYDP
Ga0247571_106685423300026495SeawaterMSSKITNSHTLECIAQMRERTKERKFRQTVELQVAIKDYDP
Ga0247571_115853423300026495SeawaterDKMSKISNALVLECIADMREKSKERKFKQTVELQVSLKDYDP
Ga0247592_107529913300026500SeawaterMSSKIANSHTLECIAQMRERTKERKFRQTVELQVAIKDYDP
Ga0247605_107890413300026503SeawaterSMSSKITNSHTLECIAQMRERTKERKFRQTVELQVAIKDYDP
Ga0209499_114430813300027712Freshwater LakeMASKINNALVLSCVKEMREKSKARKFQQTVELQVALKDYDP
Ga0247582_108652613300028109SeawaterESMSSKITNSHTLECIAQMRERTKERKFRQTVELQVAIKDYDP
Ga0256413_117277723300028282SeawaterSSKITNTHTLQCIEAMRKKTKERKFKQTIELQVGIKDYDP
Ga0304731_1167197123300028575MarineSKITNALVLECIDDMRKKTKERKFAQTVELQVALKDYDP
Ga0307401_1017437323300030670MarineTSKITNALVMECIKKMKEGTKKRNFTQTIELQVALKDYDP
Ga0307401_1018234413300030670MarineNMTTQKITNQLVLDCIGEMRGKTKERKFLQTVELQVALKDYDP
Ga0307401_1025162413300030670MarineKITNALVLECIADMKDGCKKRKFTQTVELQVGIKDYDP
Ga0307398_1027675113300030699MarineGMSSKITNALVLECIKKMKEGTKKRNFTQTVELQVALKDYDP
Ga0307399_1025818313300030702MarineRMSSKITNALVLECIADMKDGCKKRKFTQTVELQVGIKDYDP
Ga0307388_1068839813300031522MarineTQKITNQLVLDCIGEMRGKTKERKFLQTVELQVALKDYDP
Ga0307386_1050288913300031710MarineVMSSKITNTQTLDCITAMRKKTKERKFKQTVELQVGIKDYDP
Ga0307381_1011631713300031725MarineKITNQLVLDSIADMRGKTKERKFLQTVELQVALKDYDP
Ga0307397_1017906823300031734MarineFCFKIQMTSKITNALVMECIKKMKEGTKKRNFTQTIELQVALKDYDP
Ga0307383_1018381133300031739MarineTTQKITNQLVLDSIADMRGKTKERKFLQTVELQVALKDYDP
Ga0307383_1028111213300031739MarineKITNTQTLDCITAMRKKTKERKFKQTVELQVGIKDYDP
Ga0307383_1041518813300031739MarineMSSKITNKIVLEAIESMKEATKKRKFTQTVELQVAIKDYDP
Ga0307395_1017008813300031742MarineMTSKITNALVMECIKKMKEGTKKRNFTQTIELQVALKDYDP
Ga0307395_1037185613300031742MarineSKITNALVLECIADMKDGCKKRKFTQTVELQVGIKDYDP
Ga0314779_101247233300032150SedimentATSSKITNAQVLECIKEMREGTKARKFQQTVELQISLKDYDP
Ga0314689_1046983823300032518SeawaterSKITNSQTLECIKEMKDKTKERKFKQTVELQVGIKDYDP
Ga0314680_1034324023300032521SeawaterVMSKITNSQTLECIKEMKDKTKERKFKQTVELQVGIKDYDP
Ga0314685_1049946113300032651SeawaterKVMSKITNSQTLECIKEMKDKTKERKFKQTVELQVGIKDYDP
Ga0314686_1036583813300032714SeawaterNSQTLECIKEMKDKTKERKFKQTVELQVGIKDYDP
Ga0314701_1032824513300032746SeawaterMSKITNSQTLECIKEMKDKTKERKFKQTVELQVGIKDYDP

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.