Basic Information | |
---|---|
Family ID | F090214 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 108 |
Average Sequence Length | 42 residues |
Representative Sequence | MIEINLLPGKKKKAAPGAGFKLALPDFRGLIASIKNPWLLAAS |
Number of Associated Samples | 91 |
Number of Associated Scaffolds | 108 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 100.00 % |
% of genes near scaffold ends (potentially truncated) | 94.44 % |
% of genes from short scaffolds (< 2000 bps) | 81.48 % |
Associated GOLD sequencing projects | 87 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.23 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (95.370 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (25.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (50.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (63.889 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 12.68% β-sheet: 0.00% Coil/Unstructured: 87.32% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.23 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 108 Family Scaffolds |
---|---|---|
PF11104 | PilM_2 | 90.74 |
PF07963 | N_methyl | 0.93 |
PF02589 | LUD_dom | 0.93 |
PF12019 | GspH | 0.93 |
PF04350 | PilO | 0.93 |
PF00326 | Peptidase_S9 | 0.93 |
COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
---|---|---|---|
COG3167 | Type IV pilus assembly protein PilO | Cell motility [N] | 1.85 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 95.37 % |
Unclassified | root | N/A | 4.63 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002561|JGI25384J37096_10198236 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 592 | Open in IMG/M |
3300002908|JGI25382J43887_10170523 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
3300002908|JGI25382J43887_10295958 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 712 | Open in IMG/M |
3300004480|Ga0062592_100076336 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 1964 | Open in IMG/M |
3300005175|Ga0066673_10342744 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 872 | Open in IMG/M |
3300005179|Ga0066684_10900930 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 577 | Open in IMG/M |
3300005538|Ga0070731_10947120 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 570 | Open in IMG/M |
3300005546|Ga0070696_100719054 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 815 | Open in IMG/M |
3300005552|Ga0066701_10345715 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 922 | Open in IMG/M |
3300005554|Ga0066661_10542371 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 697 | Open in IMG/M |
3300005555|Ga0066692_10140435 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1475 | Open in IMG/M |
3300005559|Ga0066700_10926045 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 577 | Open in IMG/M |
3300005569|Ga0066705_10393070 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 869 | Open in IMG/M |
3300005586|Ga0066691_10177953 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1232 | Open in IMG/M |
3300005586|Ga0066691_10618809 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 643 | Open in IMG/M |
3300005598|Ga0066706_10307772 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 1248 | Open in IMG/M |
3300006034|Ga0066656_10003882 | All Organisms → cellular organisms → Bacteria | 6955 | Open in IMG/M |
3300006046|Ga0066652_100118213 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 2170 | Open in IMG/M |
3300006796|Ga0066665_10713913 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 793 | Open in IMG/M |
3300006800|Ga0066660_10169530 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1636 | Open in IMG/M |
3300006800|Ga0066660_10887044 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 726 | Open in IMG/M |
3300006800|Ga0066660_11029807 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 659 | Open in IMG/M |
3300006806|Ga0079220_10205214 | All Organisms → cellular organisms → Bacteria | 1141 | Open in IMG/M |
3300006903|Ga0075426_10324993 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
3300007004|Ga0079218_12045920 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 657 | Open in IMG/M |
3300009137|Ga0066709_100875352 | All Organisms → cellular organisms → Bacteria | 1307 | Open in IMG/M |
3300009808|Ga0105071_1029162 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 825 | Open in IMG/M |
3300010159|Ga0099796_10082062 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1184 | Open in IMG/M |
3300010304|Ga0134088_10481558 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 610 | Open in IMG/M |
3300010326|Ga0134065_10208693 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 710 | Open in IMG/M |
3300010333|Ga0134080_10185223 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales | 896 | Open in IMG/M |
3300010333|Ga0134080_10517565 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 569 | Open in IMG/M |
3300010336|Ga0134071_10172239 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
3300010336|Ga0134071_10376354 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 721 | Open in IMG/M |
3300010336|Ga0134071_10408709 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 692 | Open in IMG/M |
3300010362|Ga0126377_10560247 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1183 | Open in IMG/M |
3300010396|Ga0134126_10607048 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1251 | Open in IMG/M |
3300010400|Ga0134122_12539111 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 562 | Open in IMG/M |
3300011120|Ga0150983_14887883 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
3300011430|Ga0137423_1044735 | All Organisms → cellular organisms → Bacteria | 1328 | Open in IMG/M |
3300012201|Ga0137365_10017453 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 5609 | Open in IMG/M |
3300012201|Ga0137365_10531022 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales | 864 | Open in IMG/M |
3300012203|Ga0137399_10106302 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 2181 | Open in IMG/M |
3300012209|Ga0137379_10056092 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3791 | Open in IMG/M |
3300012210|Ga0137378_10079111 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2994 | Open in IMG/M |
3300012349|Ga0137387_10036459 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3208 | Open in IMG/M |
3300012356|Ga0137371_11046628 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 616 | Open in IMG/M |
3300012357|Ga0137384_10141304 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2015 | Open in IMG/M |
3300012359|Ga0137385_11049677 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 671 | Open in IMG/M |
3300012360|Ga0137375_11072145 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 628 | Open in IMG/M |
3300012361|Ga0137360_10365533 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1211 | Open in IMG/M |
3300012361|Ga0137360_10721494 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 856 | Open in IMG/M |
3300012362|Ga0137361_10592358 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1016 | Open in IMG/M |
3300012379|Ga0134058_1134104 | All Organisms → cellular organisms → Bacteria | 1165 | Open in IMG/M |
3300012917|Ga0137395_10635870 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 772 | Open in IMG/M |
3300012922|Ga0137394_11416125 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 556 | Open in IMG/M |
3300012944|Ga0137410_12082754 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 506 | Open in IMG/M |
3300014154|Ga0134075_10023809 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2454 | Open in IMG/M |
3300014154|Ga0134075_10350903 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 647 | Open in IMG/M |
3300014880|Ga0180082_1003741 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2972 | Open in IMG/M |
3300015356|Ga0134073_10001239 | All Organisms → cellular organisms → Bacteria | 4901 | Open in IMG/M |
3300015358|Ga0134089_10155880 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales | 903 | Open in IMG/M |
3300015358|Ga0134089_10416242 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 576 | Open in IMG/M |
3300015359|Ga0134085_10299120 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 707 | Open in IMG/M |
3300017656|Ga0134112_10300682 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 645 | Open in IMG/M |
3300017997|Ga0184610_1067137 | All Organisms → cellular organisms → Bacteria | 1089 | Open in IMG/M |
3300018076|Ga0184609_10176652 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 990 | Open in IMG/M |
3300018433|Ga0066667_10599073 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales | 919 | Open in IMG/M |
3300018468|Ga0066662_12670238 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 528 | Open in IMG/M |
3300019789|Ga0137408_1145123 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 858 | Open in IMG/M |
3300024219|Ga0247665_1040384 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 631 | Open in IMG/M |
3300025906|Ga0207699_10287804 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1144 | Open in IMG/M |
3300025915|Ga0207693_10271779 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1328 | Open in IMG/M |
3300026296|Ga0209235_1012322 | All Organisms → cellular organisms → Bacteria | 4715 | Open in IMG/M |
3300026296|Ga0209235_1253065 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 544 | Open in IMG/M |
3300026296|Ga0209235_1284475 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 505 | Open in IMG/M |
3300026301|Ga0209238_1174579 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 634 | Open in IMG/M |
3300026319|Ga0209647_1281389 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 557 | Open in IMG/M |
3300026325|Ga0209152_10213427 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 724 | Open in IMG/M |
3300026326|Ga0209801_1010059 | All Organisms → cellular organisms → Bacteria | 4920 | Open in IMG/M |
3300026327|Ga0209266_1150802 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 941 | Open in IMG/M |
3300026327|Ga0209266_1265477 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 545 | Open in IMG/M |
3300026329|Ga0209375_1275573 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 553 | Open in IMG/M |
3300026329|Ga0209375_1289720 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 536 | Open in IMG/M |
3300026523|Ga0209808_1178492 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 760 | Open in IMG/M |
3300026527|Ga0209059_1242203 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 605 | Open in IMG/M |
3300026529|Ga0209806_1101272 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1228 | Open in IMG/M |
3300026538|Ga0209056_10559808 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 581 | Open in IMG/M |
3300027546|Ga0208984_1008399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1926 | Open in IMG/M |
3300027725|Ga0209178_1045913 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1395 | Open in IMG/M |
3300027748|Ga0209689_1161674 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
3300027787|Ga0209074_10424254 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 562 | Open in IMG/M |
3300027882|Ga0209590_10629931 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 689 | Open in IMG/M |
3300031720|Ga0307469_10108651 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1971 | Open in IMG/M |
3300031720|Ga0307469_11544964 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 636 | Open in IMG/M |
3300031820|Ga0307473_10024630 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2521 | Open in IMG/M |
3300031962|Ga0307479_10288791 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1621 | Open in IMG/M |
3300032205|Ga0307472_100367495 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1189 | Open in IMG/M |
3300032783|Ga0335079_12081695 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 545 | Open in IMG/M |
3300032893|Ga0335069_10429273 | All Organisms → cellular organisms → Bacteria | 1545 | Open in IMG/M |
3300033004|Ga0335084_12224645 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 531 | Open in IMG/M |
3300033811|Ga0364924_080934 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 721 | Open in IMG/M |
3300033814|Ga0364930_0017140 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2420 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 25.00% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.52% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 13.89% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 11.11% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 5.56% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.63% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.78% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.78% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.85% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.85% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.85% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.85% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.85% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.93% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.93% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.93% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.93% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009808 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011430 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2 | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012379 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300014880 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_16_10D | Environmental | Open in IMG/M |
3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300024219 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK06 | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033811 | Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17 | Environmental | Open in IMG/M |
3300033814 | Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI25384J37096_101982362 | 3300002561 | Grasslands Soil | MIEINLLPGTKKKAAPGAGFKLKLALPDFRALLANVKDPWLIA |
JGI25382J43887_101705232 | 3300002908 | Grasslands Soil | MIEVNLLPGKKRKAAAGGAGFKLALPDFRGLLASIKNPWLLAA |
JGI25382J43887_102959581 | 3300002908 | Grasslands Soil | MIEINLLPGGKRKAAPGAGFKLRLALPDFRALLANVKDPWLI |
Ga0062592_1000763361 | 3300004480 | Soil | MIEINLLPGKKRAAKGTGMSVAMPDFKAILAQVKDPWLIG |
Ga0066673_103427442 | 3300005175 | Soil | MIEINLLPGKKKRAAPGGGFKLALPDFRGLIATIKNPWLIAASATSAVVIVG |
Ga0066684_109009302 | 3300005179 | Soil | MIEINLLPGKKGKKAAAGGAGFKLALPDFRGLLASIKNPWLLV |
Ga0070731_109471202 | 3300005538 | Surface Soil | VITINLLPGKKKPAAGGRFKFRVPDFSGLIANITNPWLLAASG |
Ga0070696_1007190541 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MIEINLLPGKKKKAAGGGAGFKFALPDFRGLLASIKNPWLL |
Ga0066701_103457152 | 3300005552 | Soil | MIEINLLPGKKRAAPAGAGFKLGLKLPDFRAILANITNPWLLAAS |
Ga0066661_105423711 | 3300005554 | Soil | MIEINLLPGKKKKAAPGAGFKLALPDFQGLLASIKNPWLLVAS |
Ga0066692_101404353 | 3300005555 | Soil | MIEINLLPGKKKRAAAGGGFRLALPDFRGLIASVKNPWLIAASATSAVVIT |
Ga0066700_109260452 | 3300005559 | Soil | MIEINLLPGGKKKAAPGAGFKLKLALPDFRALLANVKD |
Ga0066705_103930702 | 3300005569 | Soil | MIEINLLPGKKRTAPAGGGFKLGLKLPDFRAIIANITNPWLLAAS |
Ga0066691_101779531 | 3300005586 | Soil | MIEINLLPGKKKAAKGAGFQLALPDFKGLIAQVKDP |
Ga0066691_106188092 | 3300005586 | Soil | MIEINLLPGKKKKATPGGAGFKLALPDFRGLLASIKNPWLLVASATSLVVVG |
Ga0066706_103077722 | 3300005598 | Soil | MIEINLLPGKKKKAPGAGMKISMPDFKGLIAQVKDPWLIGAIGA |
Ga0066651_106677972 | 3300006031 | Soil | MIEINLLPGKKKKAAPGAGFKLALPDFQGLLASIKNPWLLVASAASVIVIGGGLL |
Ga0066656_100038828 | 3300006034 | Soil | MIEINLLPGKKRKAAAGGAGFKLALPDFRGLLASIKN |
Ga0066652_1001182131 | 3300006046 | Soil | MIEINLLPGKKKRAAPGAGFKFALPDFRGLIATIQNPWLI |
Ga0079222_120296821 | 3300006755 | Agricultural Soil | MIEINLLPGKKKKAAPGAGFKLALPDFQGLLASIKNPWLLVASAASVIVIGGGL |
Ga0066665_107139132 | 3300006796 | Soil | MIEINLLPGKKKRAAPGGGFKLALPDFRGLIATIKNPWLIAASATS |
Ga0066660_101695303 | 3300006800 | Soil | MIEINLLPGKKKKAAGAGAGFRLALPDFQGLLASIKNPWLLTASAA |
Ga0066660_108870441 | 3300006800 | Soil | MIEINLLPGKKKKAAGAGAGFKLALPDLQGLLASIKNT |
Ga0066660_110298072 | 3300006800 | Soil | MIEINLLPGKKKRGAPGGGFKFALPDFRGLIASVK |
Ga0079221_106943392 | 3300006804 | Agricultural Soil | MIEINLLPGKKKKAATGAGFKLALPDFQGLLATIKNPWLFVVSAAAIIVIGGGLL |
Ga0079220_102052141 | 3300006806 | Agricultural Soil | MIEINLLPGKKKKAATGAGFRLALPDFQGLIATIKNPWLFVVS |
Ga0075426_103249931 | 3300006903 | Populus Rhizosphere | MIEINLIPGKKKAVKGAGMKLSLPDFKALIAQVKD |
Ga0079218_120459201 | 3300007004 | Agricultural Soil | MIEINLLPGKKRRAAAGAGFKFGLPDFRGLMASITNPWLLA |
Ga0066709_1008753521 | 3300009137 | Grasslands Soil | MIEINLLPGTKKKAAPGAGFKLKLALPDFRALLANVKDPW |
Ga0105071_10291622 | 3300009808 | Groundwater Sand | MIEINLLPGKRKKTAGGGGGRGFKLPDFKAFLAQVKD |
Ga0099796_100820622 | 3300010159 | Vadose Zone Soil | MIEINLLPGKKRKAPGGGGAGFKLALPDFRGLLASIK |
Ga0134088_104815581 | 3300010304 | Grasslands Soil | MIEINLLPGGKKKAAPGAGFKLKLALPDFRALLANVKDPW |
Ga0134065_102086931 | 3300010326 | Grasslands Soil | MIEINLLPGKKKRAAPGAGFKFALPDFRGLIATIQNHWLIAASATSAVV |
Ga0134080_101852231 | 3300010333 | Grasslands Soil | MIEINLLPGKKRAAPGAGFKLALPDFRGLLASIKNPWLLAASATT |
Ga0134080_105175652 | 3300010333 | Grasslands Soil | MIEINLIPGQKKKGKKAGGARFKLALPDFRALLATIKDPYLIAAVA |
Ga0134071_101722391 | 3300010336 | Grasslands Soil | MIEINLLPGGKKKAAPGAGFKLKLALPDFRALLANVK |
Ga0134071_103763541 | 3300010336 | Grasslands Soil | MIEINLLPGTKKKAAPGAGFKLKLALPDFRALLANVK |
Ga0134071_104087091 | 3300010336 | Grasslands Soil | MIEINLLPGKKKKAAPGAGFKLALPDFQGLLASIKNPWLLVASAASVI |
Ga0126377_105602472 | 3300010362 | Tropical Forest Soil | MIEINLLPGKKKAVKGAGMKLSMPDFKGLFAQVKDPWLIAA |
Ga0134126_106070481 | 3300010396 | Terrestrial Soil | MIEINLLPGKKKAAKGAGMQLRMPDFRAFFAQVKDPW |
Ga0134122_125391111 | 3300010400 | Terrestrial Soil | MIEINLLPGKKKAAQGGAGFKLKLPDFRGLISSVTNPWLLAASLA |
Ga0150983_148878831 | 3300011120 | Forest Soil | MIQINLLPGKKKPAGEGRFKVPLPDLRALLASVTNPWLLAAS |
Ga0137423_10447351 | 3300011430 | Soil | MIEINLLPGKRKVAKGGGIRFSMPDFKAIIAQVKDPWLIGA |
Ga0137365_100174536 | 3300012201 | Vadose Zone Soil | MIEINLLPGKKRAAKGAGMKLSLPDFKGLIAQVKDP* |
Ga0137365_105310222 | 3300012201 | Vadose Zone Soil | MIEINLLPGKKKKAAGGGAGFKLALPDFRGLLASIKN |
Ga0137399_101063023 | 3300012203 | Vadose Zone Soil | MIEINLLPGKKKKAAAGGAGFKLALPDFRGLLASIKNPWL |
Ga0137379_100560925 | 3300012209 | Vadose Zone Soil | MIEINLLPGKKKRAAAGGGFKLALPDFRGLIASVKNPWLIAASA |
Ga0137378_100791111 | 3300012210 | Vadose Zone Soil | MIEINLLPGKKKVSKGAGMKLSMPDFKGLIAQVKDPW |
Ga0137387_100364594 | 3300012349 | Vadose Zone Soil | MIEINLLPGKKGTKKAAAGAGFKLRLALPDLRGLIASIKNPWLLA |
Ga0137371_110466281 | 3300012356 | Vadose Zone Soil | MIEINLLPGKKKKAAVGGAGFKLALPDFRALLASIKNPWLLVASA |
Ga0137384_101413043 | 3300012357 | Vadose Zone Soil | MIEVNLLPGKKGTKKAAAGAGFKLRLALPDLRGLIASIKNPWLLAASVAS |
Ga0137385_110496771 | 3300012359 | Vadose Zone Soil | MIEVNLLPGKKGTKKAAAGAGFKLRLALPDLRGLIASIKNPWLLAASVASVVV |
Ga0137375_110721451 | 3300012360 | Vadose Zone Soil | MIEINLLPGKKKKAAAGGAGFKLALPDFRGLLASIKNPWLLVA |
Ga0137360_103655331 | 3300012361 | Vadose Zone Soil | MIEINLLPGKKRKAPGGGGAGFKLALPDFRGLLASIKNPWLLAASATS |
Ga0137360_107214941 | 3300012361 | Vadose Zone Soil | MIEINLLPGKKKKAAPGGAGFKLALPDFRGLLASIKNPWLLVAS |
Ga0137361_105923582 | 3300012362 | Vadose Zone Soil | MIEINLVPGKKKAAKGAGFQLALPDFKGLIAQVKDPFLIGAI |
Ga0134058_11341042 | 3300012379 | Grasslands Soil | MIEINLLPGKKKAAKGAGMKLSMPDFRGLIAQVKDP |
Ga0137395_106358701 | 3300012917 | Vadose Zone Soil | MIEINLLPGKKRKAPGGGGAGFKLALPDFRGLLASIKNPWLLAASATSL |
Ga0137394_114161252 | 3300012922 | Vadose Zone Soil | MIEINLLPGKKRKAAAGGAGFKLALPDFRGLLASIKNPWLLAA |
Ga0137410_120827542 | 3300012944 | Vadose Zone Soil | MIEINLLPGKKKATKGAGMKLSMPDFKGLIAQVKDPWLIG |
Ga0134075_100238091 | 3300014154 | Grasslands Soil | MIEINLIPGKKQKAARGKGLGLKLSLPDFRGLIASIKNPWLIAASASAVVVIGG |
Ga0134075_103509031 | 3300014154 | Grasslands Soil | MIEINLLPGKKKRAAAGGGFRLALPDFRGLIASVKNPWLIAASATSAVVITGV |
Ga0180082_10037411 | 3300014880 | Soil | MIEINLLPGKKRASPGAGFKFRIPDFRALLASVTNPWLLAASG |
Ga0134073_100012391 | 3300015356 | Grasslands Soil | MIEINLLPGKKKRAAPGAGFKFALPDFGGLIATIRNPWLIAASATSAVVI |
Ga0134089_101558801 | 3300015358 | Grasslands Soil | MIEINLLPGTKKKAAPGAGFKLKLALPDFRALLANVKD |
Ga0134089_104162422 | 3300015358 | Grasslands Soil | MIEINLLPGKKKAAKGAGFQLAMPDFKGLLAQVKDPWL |
Ga0134085_102991201 | 3300015359 | Grasslands Soil | MIEINLLPGKKRAAPGAGFKLALPDFRGLIASIKNPWLLV |
Ga0134112_103006821 | 3300017656 | Grasslands Soil | MIEINLLPGKKKKAAPGAGFKLALPDFRGLIASIKNPWLLAAS |
Ga0184610_10671371 | 3300017997 | Groundwater Sediment | MIEINLLPGKKKKAAGGAGLKLSMPDFRAIISQIKDPWL |
Ga0184609_101766521 | 3300018076 | Groundwater Sediment | MIEINLLPGKKKKAGAGGAGFKLSMPDFRAIFAQVK |
Ga0066667_105990731 | 3300018433 | Grasslands Soil | MIEINLIPGQKKKGKKAGGARFKLALPDFRALLATIKD |
Ga0066662_126702382 | 3300018468 | Grasslands Soil | MIEINLLPGKKRAAKGAGMKLSLPDFKGLIAQVKDPR |
Ga0137408_11451231 | 3300019789 | Vadose Zone Soil | MIEINLLPGKKKKAAGGGAGFKFALPDFRLPGSACE |
Ga0247665_10403841 | 3300024219 | Soil | MIEINLLPGKKKKAATGAGFKLALPDFQGLIATIKNPWLFVVSAAAIIV |
Ga0207699_102878041 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MIEINLLPGKKKKPSGGAGFKLALPDFQGLLASVKNPW |
Ga0207693_102717792 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MIEINLLPGKKKKAATGAGFRLALPDFQGLIATIKNPWLFVVSAAAIIVI |
Ga0209234_12585391 | 3300026295 | Grasslands Soil | INLLPGKKRKATGGGGAGFKFALPDFRGLLASIKNPWLLAASATSLVVVGGGLG |
Ga0209235_10123227 | 3300026296 | Grasslands Soil | MIEINLLPGKRRKAAAGGAGFKLALPDFRGLLASIKNPWLLA |
Ga0209235_12530651 | 3300026296 | Grasslands Soil | MIEINLLPGKKKAAAAGGRFKLSLGLKLPDFRGIIANITNPWLLA |
Ga0209235_12844751 | 3300026296 | Grasslands Soil | MIEINLLPGKKKKAAPGGAGFKLALPDFRGLLASIKNPWLLVASAT |
Ga0209238_11745792 | 3300026301 | Grasslands Soil | MIEINLLPGKKKKAAGGGAGFKLALPDFQGLLASIK |
Ga0209647_12813892 | 3300026319 | Grasslands Soil | MIEINLLPGKKKAAKGAGMKLSMPDFKGLIAQVKDPW |
Ga0209152_102134272 | 3300026325 | Soil | MIEINLLPGKKKRAAPGGGFKLALPDFRGLIASVKNPWLIA |
Ga0209801_10100591 | 3300026326 | Soil | MIEINLLPGKKKRAGAAGAGFKLALPDFRGLIATIKNPWLIAATVTSA |
Ga0209266_11508022 | 3300026327 | Soil | MIEINLIPGQKKKGKKAGGARFKLALPDFRALLATIKDPYLIA |
Ga0209266_12654772 | 3300026327 | Soil | MIEINLLPGKKRAAPGTGFKLALPDFRGLIASIKNPW |
Ga0209375_12755732 | 3300026329 | Soil | MIEINLLPGKKKKAAPGAGFKLALPDFQGLLASIKNPWLLVASAA |
Ga0209375_12897202 | 3300026329 | Soil | MIEINLLPGKKKRAAPGGGFKLALPDFRGLIASVKNPWLIAA |
Ga0209808_11784922 | 3300026523 | Soil | MIEVNLLPGKKKAAKGTGVSLAMPDFRALIAQVKDPWLL |
Ga0209059_12422032 | 3300026527 | Soil | MIEINLLPGKKKRAAPGGGFKLALPDFRGLIATIKNPWLIAASATSAVVIVGVVLL |
Ga0209806_11012722 | 3300026529 | Soil | MIEINLLPGKKKKPSGGAGFKLALPDFQGLLASIKNP |
Ga0209056_105598081 | 3300026538 | Soil | MIEINLLPGKKRAAPGAGFKLALPDFRGLIASIKNPWLLVASATTALVVGGG |
Ga0208984_10083994 | 3300027546 | Forest Soil | MIEINLLPGKKKKTPGAGMKLSMPDFRSIIAQVKDPWLI |
Ga0209178_10459131 | 3300027725 | Agricultural Soil | MIEINLLPGKKGKRAAGGGGGFRLALPDFGALLASIKN |
Ga0209689_11616741 | 3300027748 | Soil | MIEINLLPGKKRAAPAGAGFKLGLKLPDFRAILAN |
Ga0209074_104242541 | 3300027787 | Agricultural Soil | MIEINLLPGKKKKAAGGGGGGFKLALPDFQGLLASIKNPWLLAASAASVIVVGGGL |
Ga0209590_102103041 | 3300027882 | Vadose Zone Soil | MIEINLLPGKKKAAPAGAGFKLGLKLPDFRAIIANVTNPWLLAASGAWVIVLGG |
Ga0209590_106299312 | 3300027882 | Vadose Zone Soil | MIEINLLPGKKKRAGAAGAGFKLALPDFRGLIATIKNPWLIA |
Ga0307469_101086511 | 3300031720 | Hardwood Forest Soil | MIEINLLPGKKKKAATGAGFRLALPDFQGLIATIKNPWLFVVSAAAIIVIG |
Ga0307469_115449641 | 3300031720 | Hardwood Forest Soil | MIEINLLPGKKKKAAGGGAGFKLALPDSQGLLASVK |
Ga0307473_100246303 | 3300031820 | Hardwood Forest Soil | MIEINLLPGKKRKAPGGGGAGFKLALPDFRGLLASI |
Ga0307479_102887911 | 3300031962 | Hardwood Forest Soil | MIEINLLPGKKKAARVPGAGFKLALPDLRGLIASI |
Ga0307472_1003674952 | 3300032205 | Hardwood Forest Soil | MIEINLLPGKKKKAATGAGFKLALPDFQGLLATIKNPW |
Ga0335079_120816952 | 3300032783 | Soil | MIEINLLPGRKVKAAAGSKFALRLPDFRGLVANVTNPWLLAAS |
Ga0335069_104292732 | 3300032893 | Soil | MIEINLLPGRKVKAAGGKKFALRLPDFRALVANITNPWLLAASAAWVVV |
Ga0335084_122246451 | 3300033004 | Soil | VIEINLLPTKRKKKKSAPGAGFQFRLESLKGLIAGIKNPWLLTASGA |
Ga0364924_080934_604_720 | 3300033811 | Sediment | MIEINLLPGKKKSAKGAGFQLAMPDFKGLIAQVKDPWLI |
Ga0364930_0017140_2305_2418 | 3300033814 | Sediment | MIEINLLPGQKRKAPGGGKLRMPDFRAVLANVKDPWLL |
⦗Top⦘ |