NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F090176

Metagenome / Metatranscriptome Family F090176

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F090176
Family Type Metagenome / Metatranscriptome
Number of Sequences 108
Average Sequence Length 161 residues
Representative Sequence VLKGYLGIEDKDPDVVVLEDEALRLRRSTPPARPAGRTGPLPGGGLSYREIGAALGRSERWASLAVAAAERREHGQTSGRGDLDFDGSILALRKFTSSELLDAGFNVSVVAQRQGHGPQVLTRHYSKSRASSDKRAAEHLGRVVHGKGQ
Number of Associated Samples 99
Number of Associated Scaffolds 108

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.94 %
% of genes near scaffold ends (potentially truncated) 94.44 %
% of genes from short scaffolds (< 2000 bps) 94.44 %
Associated GOLD sequencing projects 96
AlphaFold2 3D model prediction Yes
3D model pTM-score0.53

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.148 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa
(21.296 % of family members)
Environment Ontology (ENVO) Unclassified
(25.926 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(39.815 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 51.41%    β-sheet: 0.00%    Coil/Unstructured: 48.59%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.53
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 108 Family Scaffolds
PF12728HTH_17 3.70
PF02653BPD_transp_2 2.78
PF01565FAD_binding_4 1.85
PF00563EAL 1.85
PF00487FA_desaturase 0.93
PF00848Ring_hydroxyl_A 0.93
PF00990GGDEF 0.93
PF01026TatD_DNase 0.93
PF07804HipA_C 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 108 Family Scaffolds
COG2200EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant)Signal transduction mechanisms [T] 1.85
COG3434c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domainsSignal transduction mechanisms [T] 1.85
COG4638Phenylpropionate dioxygenase or related ring-hydroxylating dioxygenase, large terminal subunitInorganic ion transport and metabolism [P] 1.85
COG4943Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domainsSignal transduction mechanisms [T] 1.85
COG5001Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domainSignal transduction mechanisms [T] 1.85
COG1398Fatty-acid desaturaseLipid transport and metabolism [I] 0.93
COG3239Fatty acid desaturaseLipid transport and metabolism [I] 0.93
COG3550Serine/threonine protein kinase HipA, toxin component of the HipAB toxin-antitoxin moduleSignal transduction mechanisms [T] 0.93


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.15 %
UnclassifiedrootN/A1.85 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000863|JGI12412J12824_103237All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium620Open in IMG/M
3300004080|Ga0062385_10083881All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium1495Open in IMG/M
3300004080|Ga0062385_11061139All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium547Open in IMG/M
3300005591|Ga0070761_10463074All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia779Open in IMG/M
3300005618|Ga0068864_101846743All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium610Open in IMG/M
3300005660|Ga0073904_10195089All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium1184Open in IMG/M
3300005712|Ga0070764_10610935All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium665Open in IMG/M
3300005937|Ga0081455_10137824All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1899Open in IMG/M
3300005981|Ga0081538_10190308All Organisms → cellular organisms → Bacteria862Open in IMG/M
3300006792|Ga0075530_1134594All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium791Open in IMG/M
3300006800|Ga0066660_10928211All Organisms → cellular organisms → Bacteria707Open in IMG/M
3300006847|Ga0075431_101662932All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia asaccharolytica596Open in IMG/M
3300006876|Ga0079217_11672663All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes friuliensis511Open in IMG/M
3300009012|Ga0066710_100021766All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae7138Open in IMG/M
3300009100|Ga0075418_10096722All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3137Open in IMG/M
3300009700|Ga0116217_11006383All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium510Open in IMG/M
3300009810|Ga0105088_1055366All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium677Open in IMG/M
3300009815|Ga0105070_1117870All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium533Open in IMG/M
3300009816|Ga0105076_1091262All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium583Open in IMG/M
3300009821|Ga0105064_1075750All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium669Open in IMG/M
3300009826|Ga0123355_11337606All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium715Open in IMG/M
3300010348|Ga0116255_10408997All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium912Open in IMG/M
3300010379|Ga0136449_101045008All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium1308Open in IMG/M
3300010379|Ga0136449_102527926All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium735Open in IMG/M
3300010379|Ga0136449_104121863All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium540Open in IMG/M
3300012212|Ga0150985_115385920All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium765Open in IMG/M
3300012355|Ga0137369_10498701All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium861Open in IMG/M
3300012682|Ga0136611_10944313All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium511Open in IMG/M
3300012973|Ga0123351_1006918All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6910Open in IMG/M
3300014156|Ga0181518_10320713All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium766Open in IMG/M
3300014165|Ga0181523_10695103All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium556Open in IMG/M
3300014166|Ga0134079_10704183All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium515Open in IMG/M
3300014489|Ga0182018_10098981All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium1711Open in IMG/M
3300014501|Ga0182024_10408505All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1753Open in IMG/M
3300014501|Ga0182024_11436337All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium791Open in IMG/M
3300015372|Ga0132256_101861262All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium709Open in IMG/M
3300016294|Ga0182041_10716859All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium888Open in IMG/M
3300016357|Ga0182032_11081394All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium687Open in IMG/M
3300016371|Ga0182034_10543201All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium974Open in IMG/M
3300016422|Ga0182039_11038433All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium736Open in IMG/M
3300017973|Ga0187780_11103137All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium580Open in IMG/M
3300018040|Ga0187862_10611339All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium644Open in IMG/M
3300018422|Ga0190265_11324045All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium837Open in IMG/M
3300018468|Ga0066662_11816713All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium638Open in IMG/M
3300019487|Ga0187893_10424542All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium892Open in IMG/M
3300020021|Ga0193726_1075525All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium1560Open in IMG/M
3300021402|Ga0210385_10478358All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium943Open in IMG/M
3300021420|Ga0210394_11862379All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium500Open in IMG/M
3300026095|Ga0207676_12296985All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium537Open in IMG/M
3300026535|Ga0256867_10280475All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium594Open in IMG/M
3300026879|Ga0207763_1021769All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium624Open in IMG/M
3300027636|Ga0214469_1130292All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium719Open in IMG/M
3300028566|Ga0302147_10224680All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium629Open in IMG/M
3300028742|Ga0302220_10304618All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium579Open in IMG/M
3300028748|Ga0302156_10228965All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium860Open in IMG/M
3300028775|Ga0302231_10065713All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium1519Open in IMG/M
3300028808|Ga0302228_10030141All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium2715Open in IMG/M
3300028828|Ga0307312_10458469All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium840Open in IMG/M
3300028877|Ga0302235_10128854All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium1138Open in IMG/M
3300028906|Ga0308309_11042167All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium708Open in IMG/M
3300029908|Ga0311341_10612874All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium613Open in IMG/M
3300029943|Ga0311340_11212204All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium607Open in IMG/M
3300029944|Ga0311352_10484157All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium1002Open in IMG/M
3300029999|Ga0311339_11722997All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium548Open in IMG/M
3300030007|Ga0311338_11860432All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium540Open in IMG/M
3300030045|Ga0302282_1257549All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium642Open in IMG/M
3300030053|Ga0302177_10112651All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium1564Open in IMG/M
3300030057|Ga0302176_10408610All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium547Open in IMG/M
3300030490|Ga0302184_10143947All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium1039Open in IMG/M
3300030496|Ga0268240_10166504All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium550Open in IMG/M
3300030503|Ga0311370_12445157All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium504Open in IMG/M
3300030518|Ga0302275_10268113All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium959Open in IMG/M
3300030519|Ga0302193_10402312All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium694Open in IMG/M
3300030520|Ga0311372_12049534All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium667Open in IMG/M
3300030520|Ga0311372_12445769All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium589Open in IMG/M
3300030606|Ga0299906_11252556All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium532Open in IMG/M
3300030617|Ga0311356_11236727All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium686Open in IMG/M
3300030739|Ga0302311_11018188All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium522Open in IMG/M
3300030977|Ga0265721_1000462All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium1130Open in IMG/M
3300031233|Ga0302307_10588490All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium561Open in IMG/M
3300031234|Ga0302325_12689005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium587Open in IMG/M
3300031236|Ga0302324_101968003All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium735Open in IMG/M
3300031236|Ga0302324_102222330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium680Open in IMG/M
3300031258|Ga0302318_10502264All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium614Open in IMG/M
3300031261|Ga0302140_10913396All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium613Open in IMG/M
3300031524|Ga0302320_11260001All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium751Open in IMG/M
3300031525|Ga0302326_12057936All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium735Open in IMG/M
3300031525|Ga0302326_12815490All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium600Open in IMG/M
3300031525|Ga0302326_13291006All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium543Open in IMG/M
3300031549|Ga0318571_10253850All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium647Open in IMG/M
3300031561|Ga0318528_10068176All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium1828Open in IMG/M
3300031708|Ga0310686_119453860All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium636Open in IMG/M
3300031736|Ga0318501_10299610All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium858Open in IMG/M
3300031748|Ga0318492_10090896All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia symbiont of Coriaria ruscifolia1490Open in IMG/M
3300031765|Ga0318554_10159550All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia symbiont of Coriaria ruscifolia1281Open in IMG/M
3300031777|Ga0318543_10258814All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium776Open in IMG/M
3300031788|Ga0302319_11246575All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium683Open in IMG/M
3300031788|Ga0302319_11610009All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium572Open in IMG/M
3300031852|Ga0307410_11458162All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium602Open in IMG/M
3300031941|Ga0310912_10213959All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia symbiont of Coriaria ruscifolia1476Open in IMG/M
3300032054|Ga0318570_10414882All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium614Open in IMG/M
3300032055|Ga0318575_10661321All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium529Open in IMG/M
3300032089|Ga0318525_10171484All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium1115Open in IMG/M
3300032160|Ga0311301_11208257All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium968Open in IMG/M
3300032892|Ga0335081_11165685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium882Open in IMG/M
3300033289|Ga0310914_10347779All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium1341Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa21.30%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil12.04%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog9.26%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.48%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.70%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand3.70%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.78%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.78%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.85%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.85%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost1.85%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.85%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.85%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.93%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.93%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.93%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.93%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.93%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.93%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.93%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.93%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.93%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.93%
Microbial Mat On RocksEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks0.93%
Termite GutHost-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut0.93%
FecalHost-Associated → Mammals → Digestive System → Large Intestine → Fecal → Fecal0.93%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.93%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.93%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere0.93%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.93%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.93%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge0.93%
Anaerobic Digestor SludgeEngineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000863Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 30EnvironmentalOpen in IMG/M
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005660Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_precipitateEngineeredOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300005981Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1Host-AssociatedOpen in IMG/M
3300006792Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL1-DEnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009810Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30EnvironmentalOpen in IMG/M
3300009815Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10EnvironmentalOpen in IMG/M
3300009816Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10EnvironmentalOpen in IMG/M
3300009821Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30EnvironmentalOpen in IMG/M
3300009826Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1Host-AssociatedOpen in IMG/M
3300010348AD_HKYLcaEngineeredOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012682Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ223 (23.06)EnvironmentalOpen in IMG/M
3300012973Fecal eukaryotic communites from dung pellets of Tule Elk in California, USA - Elk Dung E36 Day 36 MetagenomeHost-AssociatedOpen in IMG/M
3300014156Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaGEnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015209Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G3B, Proglacial river margin, by glacier terminus)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019487White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaGEnvironmentalOpen in IMG/M
3300020021Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1EnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026535Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq)EnvironmentalOpen in IMG/M
3300026879Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 50 (SPAdes)EnvironmentalOpen in IMG/M
3300027636Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 HiSeqEnvironmentalOpen in IMG/M
3300028566Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_2EnvironmentalOpen in IMG/M
3300028742Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3EnvironmentalOpen in IMG/M
3300028748Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2EnvironmentalOpen in IMG/M
3300028775Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2EnvironmentalOpen in IMG/M
3300028808Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028877Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029908II_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029944II_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030045Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_3EnvironmentalOpen in IMG/M
3300030053Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2EnvironmentalOpen in IMG/M
3300030057Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1EnvironmentalOpen in IMG/M
3300030490Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3EnvironmentalOpen in IMG/M
3300030496Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2)EnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030518Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2EnvironmentalOpen in IMG/M
3300030519Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_3EnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030606Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125EnvironmentalOpen in IMG/M
3300030617II_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030739Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3EnvironmentalOpen in IMG/M
3300030977Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLI2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031233Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031258Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1EnvironmentalOpen in IMG/M
3300031261Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1EnvironmentalOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2EnvironmentalOpen in IMG/M
3300031852Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3Host-AssociatedOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12412J12824_10323713300000863Tropical Forest SoilSAPLAPDLLTKQVAVLKGYLGIESKDPGVVDLENEALRLRRSAPSPRLAGRPGPDPQGGMSFREIGEVLGRSERWASLAVASAQRREAANAGGRAQLNFDGSILGLRKFTSSELLDAGFNVSVVAERQGHGPQVLTRHYSKLRASSDQRAAEHLGRVIHGD*
Ga0062385_1008388113300004080Bog Forest SoilKDPDVVVLEDEALRLRRSTPPARPAGRTGPLPGGGLSYREIGAALGRSERWASLAVAAAERREHGQTSGRGDLDFDGSILALRKFTSSELLDAGFNVSVVAQRQGHGPQVLTRHYSKSRASSDKRAAEHLGRVVHGKGQ*
Ga0062385_1106113913300004080Bog Forest SoilAVLKGYLGIEEKDPEVEALEDEALRLRRATPPARPTGRPGPLPIGGMSYGEIGAALGRSSRWASLAVAAAKRREDARASGRGDLDFDGSILALRKFTSSELLDAGFNVSVVAQRQGHGPQVLSRHYSKSRASSDKRAAEHLGRVVHGKT*
Ga0070761_1046307423300005591SoilCGQMAQAANDAGTELAADAFLFSLAPDCSTPMPPDHLTKRVAVLKGCLGIENKNPDVVALEDEALRLRRAAPPPRPAGKSGPLPTGGMSYRDIGIAVGRSERWASLAVAAAERRERAHASGLADLDFDASILALRKFTSSELLDAGFNVSMVAQRQGHGPQVLTRHYAKSRASSDRRAAEHLGRIVHGT*
Ga0068864_10184674313300005618Switchgrass RhizosphereMDDRAATTGVDLVNDPFVFSHSPDCSEPMPPDYVTRRVAVLKEHLGIADKRPETIAAEDEALRLFRQRPVARIAGRTGPAPKGGMSFSEIGRQLGRSDRWAAAAIASAQRREEAMSNGLGHAFDGSILALRKFTSTELLDVGFNISKVAQRQGHGPAVLVKHYAKARQSADRKAADHLGRVVHGTRNDTPSTSDPSAI*
Ga0073904_1019508923300005660Activated SludgeLFLATQAPRPAGRRGPAPVGGRSYADIGAALGRSDRWAAMAVQSAQRRVAARSAGRGLDFDGSVLALRKFTSTELLDAGFNIAMVAQRQGHGTQVLAKHYAKSRRSADRKAASHLGRVVHQR*
Ga0070764_1061093513300005712SoilKRVAVLKGYLGTEDKHADTVALEDEALRLRRSAPPSRPAAKPGPLPRGGMSYREIGVTLGRSERWASLAVAAAERRELAQASARGNLTFDGSILALRKFTSSELLDAGFNVSMVAQRQGHGPQILTRHYSKSRASSDKRAAEHLGRVVHGK*
Ga0081455_1013782423300005937Tabebuia Heterophylla RhizosphereVHLEHLGISNKQPGTVKLEDEALRLFRQPPAPRRPGQTGPAPKGGMSFPEIGRRLGRSRRWAELAVRSAQRREVAAAAGEVDYFDGSILALRKFTSSELLDAGFNISMVAQRQGHGPQVLVKHYAKARPSADRKAADHLGRVVHGGWR*
Ga0081538_1019030813300005981Tabebuia Heterophylla RhizosphereVLKEYLGTANKRPEVMAREDEALRLFRQPGKRRPKGKTGPELRGGMSYEEIGRRLGRSTRWALEAVAAAERREAAARRGAVDFFDGSIVALRKFTSSELLDAGFNISMVAQRQGHGPQVLVKHYARSRPSADRKAAEHLGQVVHRLDRRANEPPAVS*
Ga0075530_113459413300006792Arctic Peat SoilQDQLAAAADTPLVADPFVFSLAINGSRPMPPDFVTKRVAVLKEHLGIDQKSVAVIEREDEALRLFRLPAAPPPPGQTGPRPTGSMTYREIGAQLGRSERWASLAVASAERREQARARGDHLDFDGSIVALRKFTSSELLDAGFSISMVAQRQDHGPQVLAKHYAKGRQSADRKAAEHLGRAIHGQTTS*
Ga0066660_1092821123300006800SoilDYITKRVATLKQHLGIEDKRPDTIEREDEALRLFRQTVPTLPRDKPGPSPRGGMSYREIGARLGRSERWASLAVASAERREAALRRGQHLDFDGSILALRRFTSSELLDAGFNISMVAQRQGHGPQVLAKHYAKSRRSADQKAAEHLGRVIHGGTRAS*
Ga0075431_10166293213300006847Populus RhizosphereKERKVAVDPETMDMLLRHCAQMDERAGLCGLTVAPDAFVFSLALDCSAPMPPDYVTKRVALLKEHLGIANKRPETIAREDEALRLYRQPPKPLRAGQAGRSPVGGVSYEAIGRQLGRSERWATLAVASAKRREAVQAQGDRSHTMFDGSILALRKFTSSELLDAGFDISMVAQRQGHGPQVLAKHYAKARRSADRKAA
Ga0079217_1167266313300006876Agricultural SoilALEDEALRLYRLRAKPRPAGSKGPPPTGGLPLAEIGRRLGRSERWAGLAVQAAQLREAAGKQRTRLNFDGSVLALRKFTSSELLDAGFNISMVAQRQGHGPQVLVQHYSKSRRSADRRAAEHLGRVVHGSPKQARVQDSER*
Ga0066710_10002176613300009012Grasslands SoilKRAETIALEDEALRLYRKPRAPRPRGKTGPAPKGGLAYHEIGQLLGRSERWAALAVEAAHRREQATVVLPSERFDASIIALRKFTSSELLDAGFNVSMVAQRQGHGPQVLVKHYAKSRKSADRRAAEHLGSVIHRKNDAPGERESLVGL
Ga0075418_1009672253300009100Populus RhizosphereLKEHLGIANKAPETMAREDEALRLYRQAPEVRRRNRTGPSPDGGLSYKEIGRRLDRSERWAQLAVASALRREDVAARPVQVKMFDGSVVALRKFTSSELLDAGFNISAVAQRQGHGPQVLIKHYAKARPSADRRAAEHLGRLVYRRSSETMAGRPAS*
Ga0066709_10170726713300009137Grasslands SoilVKGTKTRQERGVHVDAGTIDMLRRHLEMMDARAVEFGTGVDTDGFVFSLEPDCCKPMPPDYVTKRVAVLKDHLGIATKKPETIYLEDEALELYRRPSRARPAGVTGPAPKGGMSFREIGKQLGRSEKWAMLAVASAERREAAIERGLDLDFDGSILALRKFTSSELLDAGFNISMVAQRQGHGPQVLIKHYSKSRRSADRKAAEHLGRVVHGSSA*
Ga0116217_1100638313300009700Peatlands SoilSTPMPPGYLTKRVAALKDHLGIAEKAPATLALEEQAVRLYRQAPAARPQGRTGPAPKGSLSYREIGERLHRSDRWVALAVQAAERRDAAAERGLNLDFDGSVLALRKFTSSELLDSGFNISMVAQRQGHGPQVLMKHYSKARRSADRKAAEHLGRVVHSGSTKAVPARTP
Ga0105088_105536613300009810Groundwater SandDMLLRHCAHMDERAELCGLKVAPDAFVFSLALDCSAPMPPDYVTKRVALLKEHLGIANKRAETIALEDEALRLYQQPPKQQRTGHPGRSPAGGMSYQAIGRQLGRSERWATLAVASAKRREAAQARSDRSHTMFDGSILALRKFTSSELLDTGFNISMVAQRQGHGPQVLAKHYAKARRSADRKAAAHLGRVVHGR*
Ga0105070_111787013300009815Groundwater SandEDEALRMYRQPPKQRRAGQAGRSPAGGMSYEAIGQQLGRSERWATLAVASAKRREAVRARGDRSHTMFDGSILALRKFTSSELLDAGFNISMVAQRQGHGPQVLAKHYAKSRQSADRKAAEHLGRVVHGR*
Ga0105076_109126213300009816Groundwater SandGIANKRAETIALEDEALRMYRQPPKQRRAGQAGRSPAGGISYEAIGQQLGRSERWATLAVASAKRRDTFQARGDRTHTMFDGSILALRKFTSSELLDAGFNISMVAQRQGHGPQVLAKHYAKARRSADRKAAEHLGRVVHGR*
Ga0105064_107575013300009821Groundwater SandKRVALLKEHLGIANKRPETIALEDEALRMFRQPHEQRRAGQAGRSPAGGISYGAIGRQLGRSERWATLAVASAKRREAAQARSDRSHTMFDGSILALRKFTSSELLDTGFNISMVAQRQGHGPQVLAKHYAKARRSADRKAAEHLGRVVHGR*
Ga0123355_1133760613300009826Termite GutLAPDLLTKQVAILKGHLGIENKDPAVVELEDEALRLRRSAPAARLAGTPGPEPHGGMSFREIGAALGRSERWASLAVASAERREAAKDSGGSRLNFDGSILGLRKFTSSELLDAGFNISVVAERQGHGPQVLTRHYSKSRASSDQRAAEHLGRAIHGRASRKG*
Ga0116255_1040899713300010348Anaerobic Digestor SludgeIADKQPGTMKLEDEALRLFRSEPAARPNGKTGPAPRGGLSYVQIGERLGRSDHWVAKAIRSAERREQAKASGTANHFDGSILALRKFTSTELLDAGFNLSMVAQRQGHGPAVLIKHYAKARESADRKAAEHLGAIVHQR*
Ga0136449_10104500813300010379Peatlands SoilGIEDKHPDVVALENEALRLRRSTPLPRSPGKPGPQPAGGMSFRDIGAALGRSERWANLAVAAAERREQVRAAGHGDLDFDGSILALRKFTSSELLDAGFNVSVVAQRQGHGPQVLTRHYSKSRASSDKQAAEHLGRVVHGKR*
Ga0136449_10252792613300010379Peatlands SoilSTPMPPGYLTKRVAALKDHLGIAEKAPATLALEEQAVRLYRQAPAARPQGRTGPAPKGSLSYREIGERLHRSDRWVALAVQAAERRDAAAERGLNLDFDGSVLALRKFTSSELLDSGFNISMVAQRQGHGPQVLMKHYSKARRSADRKAAEHLGRVVHSGSTKAVPARTPRRSS*
Ga0136449_10412186313300010379Peatlands SoilLKGHLGIEDKRPETIELEDEALRLRRQPPLPRPAGVTGPAPRGGMSFREIGERLGRSERWSSLAVEAAVRREKATAAGLGTGGFDGSILALRKFTSSELLDAGFNISMVAQRQGHGPQVLTRHYSKSRASSDRKAAEHLGRVVHTQRPASAPG*
Ga0150985_11538592023300012212Avena Fatua RhizosphereADLVNDPFVFSHSPDCSEPMPPDYVTRRVAVLKEHLGIADKRPETIAAEDEALRLFRQRPVARIAGRTGPAPKGGMPFGEIGRQLGRSDRWAAAAIASAQRREEAMSNGLGHAFDGSILALRKFTSTELLDVGFNISMVAQRQGHGPAVLVKHYAKARQSADRKAADHLGRVVHGTRNDRPSTSDPSAI*
Ga0137369_1049870113300012355Vadose Zone SoilFVFSRELDCLKPMPPDDVTKRVALLKEHLGIADKRPATIALEDEALRLYRQAPIPRPPGTTGPAPAGGVSFAEIGRQLDRSERWAMLAVRSAERCEAAEARGRRLSFDGSILALRKFTSSELLDAGFNISMVAQRQGHGPQVLMKHYSKRRESADRKAAEHLGRVVHRTPTG*
Ga0136611_1094431313300012682Polar Desert SandDHLGVADTRPDTIGREDEALRLFRKAATPRAAGKTGPASKGGLSYRDIGSRLGRSERWAAMAVASALRREEASSLTLGRFDASILALRKFTSSELLDAGFNISMVAQRQGHGPAVLMKHYAKSRGSADRRAAEHLGSVVHQGRGGEQADEPSGS*
Ga0123351_100691893300012973FecalAVCGVEVPEDGFVFSLEPDCSRPMEADYVTKQVARLKDHLGIADKRPTTIALEDKALALYRSKPAPRPEGRSGPEPAGAMSYKEIGRRLGRSARWAQLAVVSAERREAAAKAGRAEMFDGSILALRKFTSSELLDAGFNVSAVAQRQGHGPQVLVKHYAKRRASADRKAADHLGRVIHRRASAAEQPTG*
Ga0181518_1032071313300014156BogHLDERARTAGVELASDPFLFSLAADCSKPMPPDYFTKRVGVLKGYLGIEDKRPEVVALEDEALRLRTSPPPPRPRGKTGPLPDGGMSFRDIGHQLGRSERWANLAVSAAQRRMQANSSGRGDLDFDGSILALRKFTSSELLDAGFNVSMVAQRQGHGPQVLTRHYSKSRASSDRRAAEHLGRVVHGGDS*
Ga0181523_1069510313300014165BogKGCLGIENKALEVVTLEDEALRLRRSSPPSRPAGRPGPLPTSGLSYREIGRTLGRSERWASLAVAAAERRETVQGSGRGDLDFDGSILALRKFTSSELLDAGFNISVVAQRQGHGPQVLTRHYSKSRASSDKRAAEHLGRVVHGKS*
Ga0134079_1070418313300014166Grasslands SoilMIGFLFSNAADCSAPMPPEFVTKRMAIVKDHLGIAAKRRQTIDLEDEALQLFRQQRNDQRRVTSGPAPKGGLSYREIGERLQRSERWVALAIASATRREAAHARGDALDFDGSILALRKFTSSELLDAGFNISMVAQRQGHGPGVLVKHYSKSRKSADRTAAEHLGRVVHG
Ga0182018_1009898113300014489PalsaMPPDYLTKRVAVLKGYLGIEDKRPEVAALEDEALRLRMAPPQPRQAGKTGPTPNGGMSFRDIGRELGRSERWASLAVAAAQRRVDAEESGRGRADFDGSILALRKFTSSELIDAGFNVSMVAQRQGHGPQVLTRHYAKLRASSDKRAAEHLGRVVHGQPE*
Ga0182024_1040850543300014501PermafrostVLKGYLGIENKRPEVVVLEDEALRLRRSSPPPRPRGKTGPLPNGGMSFREIGQQLGRSEYWASLAVAAAERREHAEASGRPGLAFDGSILALRKFTSSELLDAGFNVSMVAQRQGHGPQILTRHYSKSRASSDKRAAEHLGRVVHGDGTGYDLEH*
Ga0182024_1143633723300014501PermafrostLKGYLGIEDKDPDVVALEDEALRLRRSTPSARPAAKPGPLPGGGLSYREIGSTSGRSERWASLAVAAAERRERAKDSGRGDLDFDGSILALRKFTSSELLDAGFNVSVVAQRQGHGPQVLTRHYSKSRASSDKRAAEHLGRVVHGK*
Ga0167629_112292813300015209Glacier Forefield SoilVDASIDEGRRVKTTKTRRERSFYVDSDTVAMLRRHHDLMTERCRAFGADLEDDAFLFSLGADCSTPMPPDYVTKRVGILKDHLGIADKRPETLALEARALRLHRQKPKTRPAGMTGPAPKGGMSSREIGERLGRSERWAVLAVASAERREAADARGDALSFDGSIVALRKFTSSELLDAGFNISMVAQRQGHGPQVLTKHYAKGRRSADRRAAEHEVVAATRAGVAAVEHELLGREARLARRVIEVRGLGDE
Ga0132256_10186126223300015372Arabidopsis RhizosphereMPPDYVTKRVAVLKDHLGIAAKRPDTVALEDRALRLFRQPRTRERRTITGPLPTGGMSYREIGEQLQRSERWVALAIASATRRETANARGDALDFDGSILALRRFTSSELLDSGFNISLVAQRQGHGPGVLVKHYSKGRKSAD
Ga0182041_1071685913300016294SoilVLKGHLGIEEKRPETVAREDEALRLRRQPARPRPPSTTGPPPRGGMSFREIGEHFGRSERWAMLAVAAAQRREEARAAGLGARTFDGSIIALRKFTSSELLDAGFNVTMIAQRQGHGPGVLTRHYSKSRASADKQAADHLGRVVHGRGGL
Ga0182032_1108139413300016357SoilKHPNVVDLEDEALRLRRSVPSARLAGRPGPDSQGGMSFREIGAALGRSERWASMAVASAERREAAKAAGRPQLNFDGSILGLRKFTSSELLDAGFNISVVAERQGHGPQVLTRHYSKSRASSDQRAAEHLGRVVHGRTQRKRGA
Ga0182034_1054320123300016371SoilDEALRLRRSVPSARLAGRPGPDSQGGMSFREIGAALGRSERWASMAVASAERREAAKAAGRPQLNFDGSILGLRKFTSSELLDAGFNISVVAERQGHGPQVLTRHYSKSRASSDQRAAEHLGRVVHGRTQRKRGA
Ga0182039_1103843323300016422SoilAAGVPLDPDPYLFSAVPDYSAPLAPDLLTKQVAVLKGHLGIESKHPNVVDLEDEALRLRRSVPSARLAGRPGPDSQGGMSFREIGAALGRSERWASMAVASAERREAAKAAGRPQLNFDGSILGLRKFTSSELLDAGFNISVVAERQGHGPQVLTRHYSKSRASSDQRAAEHLGRVVHGRTQRKRGA
Ga0187780_1110313713300017973Tropical PeatlandFTKRVAVLKGHLGIEEKRPEIIALEDEALRLWRSPASPRPAGRTGPAPKGGLPFRQIGEILGRSERWAALAVEAAGRREGARDAGYGELDFDGSIIALRRFTSSELLDAGFNISVVAHRQGHGPQVLTRHYSKSRESADRRAADHLGRVVHGETA
Ga0187862_1061133913300018040PeatlandVLKGYLGIEDKDPDVVVLEDEALRLRRSTPPARPAGRTGPLPGGGLSYREIGAALGRSERWASLAVAAAERREHGQTSGRGDLDFDGSILALRKFTSSELLDAGFNVSVVAQRQGHGPQVLTRHYSKSRASSDKRAAEHLGRVVHGKGQ
Ga0190265_1132404513300018422SoilTRRVAVLKEYVGIANKRPDVVAREDEALRLFRQPAKRRPKGKTGPELRGGMSYEEIGRRLGRSTRWALEAVAAAERREAAAQRGAVDFFDGSIVALRKFTSSELLDAGFNNSMVAQRQGHGPQVLVKHYARSRPSADRKAAEHLGQVVHRLDRPSNEPPAVS
Ga0066662_1181671313300018468Grasslands SoilSMAMAPDYVTKRVAVLKDHLGVADKRSETIALEDEALRLFREPPARRPSGKTGPAPKGGLSYRAIGQLLGRSERWAALAVASALRREGACAIPPTQRFDASIIALRKFTSSELLDAGFNVSMVAHRQGHGPQVLVKHYAKSRRSADRRAADHLGSIVHTRTRPNEREHVGS
Ga0187893_1042454213300019487Microbial Mat On RocksAVLKERLGIADKKPATIAREDEALRLYRQVATERPAGRTGPAPKGGMSHSEIGTALGRSERWAALAIASAERREAAGRRGLSLAFDGSILALRKFTSSELLDAGFNVSMVAQRQGHGPQVLMKHYAKARRSSDRKAAEHLGHLVHGGQTVS
Ga0193726_107552533300020021SoilAREDEALRLRTSPPPPRPNGRTGPVPRTGLSYRDIGRQLGRSERWASLAVASAQRRANCKVSRDGDLDFDGSILALRKFTSSELLDAGFNVSMVAQRQGHGPQVLTRHYSKSRASSDKRAAEHLGRVVHGGRE
Ga0210385_1047835823300021402SoilDAGTELAADAFLFSLVPDCSTPMPPDHLTKRVAVLKGCLGIENKNPDVVALEDEALRLRRSAPPPRPAGKSGPLPTGGMSYRDIGIAVGRSERWASLAVAAAERRERAHASGLADLDFDGSILALRKFTSSELLDAGFNVSMVAQRQGHGPQVLTRHYAKSRASSDRRAAEHLGRIVHGT
Ga0210394_1186237913300021420SoilALEDEALRLRRSVPASRPIGKPGPKPIAGMSFREIGATLGRSERWASLAVAAAERREEASAAGRTNLSFDGSILGLRKFTSSELLDAGFNISVVAERQGHGPQVLTRHYSKSRASSDKRAAEHLGQAVHGGRQRKRTN
Ga0207676_1229698513300026095Switchgrass RhizosphereMDDRAATTGVDLVNDPFVFSHSPDCSEPMPPDYVTRRVAVLKEHLGIADKRPETIAAEDEALRLFRQRPVARIAGRTGPAPKGGMSFSEIGRQLGRSDRWAAAAIASAQRREEAMSNGLGHAFDGSILALRKFTSTELLDVGFNISKVAQRQGHGPAVLVKHYAKARQSADRKAADHLG
Ga0256867_1028047513300026535SoilALLKEHLGIANKRADTIALEDEALRIYRQPPKPRRAGQAGRSTVGGMSYEAIGRQLGRSERWATLAVASAKRREAVQAQGDRTHTMFDGSILALRKFTSSELLDAGFNISMVAQRQGHGPQVLAKHYARARRSADRRAAEHLGRVVHGR
Ga0207763_102176923300026879Tropical Forest SoilVDLENEALRLRRSAPSPRLAGRPGPDPQGGMSFREIGEVLGRSERWASLAVASAQRREAANAGGRAQLNFDGSILGLRKFTSSELLDAGFNVSVVAERQGHGPQVLTRHYSKLRASSDQRAAEHLGRVIHGD
Ga0214469_113029213300027636SoilPDAFVFSLAPDCSAPMPPDYVTKRVALLKEHLGIANKRAETIALEDEALRLYRQPPRQRRAGQSGRSPVGGMSYEAIGSQLGRSERWATLAIACAERREAVQAHSDRTHTMFDGSILALRKFTSSELLDAGFNISMVAQRQGHGPQVLAKHYAKARRSADRKAAEHLGRVIHGR
Ga0302147_1022468023300028566BogLTKRVAVLKGYLGIEEKDPEVAALEDEALRLRRATPPARPTGRPGPLPIGGMSYGEIGAALGRSSRWASLAVAAAKRREDARASGRSELDFDGSILALRKFTSSELLDAGFNVSVVAKRQGHGPQVLNRHYSKSRASSDKRAAEHLGRVVHGKS
Ga0302220_1030461813300028742PalsaCLRRSPPPPRPKGRTGPSPNGGMSFREIGQQLGRSERWASLAVEAAERREYAEASGYGGLNFDGSILALRKFTSSELLDAGFNVSMVAQRQGHGPQVLTRHYSKSRASSDKRAAEHLGRVIHGNDS
Ga0302156_1022896513300028748BogKDPEVAALEDEALRLRRATPPARPTGRPGPLPIGGMSYGEIGAALGRSSRWASLAVAAAKRREDARASGRSELDFDGSILALRKFTSSELLDAGFNVSVVAKRQGHGPQVLNRHYSKSRASSDKRAAEHLGRVVHGKS
Ga0302231_1006571323300028775PalsaSTAGVELGSDPFLFSLVPDCSKPMPPDYLTKRVGVLKGYLGIEDKRPGVVALEEEALCLRRSPPPPRPKGRTGPSPNGGMSFREIGQQLGRSERWASLAVEAAERREYAEASGYGGLNFDGSILALRKFTSSELLDAGFNVSMVAQRQGHGPQVLTRHYSKSRASSDKRAAEHLGRVIHGNDS
Ga0302228_1003014113300028808PalsaGSDPFLFSLVPDCSKPMPPDYLTKRVGVLKGYLGIEDKRPGVVALEEEALCLRRSPPPPRPKGRTGPSPNGGMSFREIGQQLGRSERWASLAVEAAERREYAEASGYGGLNFDGSILALRKFTSSELLDAGFNVSMVAQRQGHGPQVLTRHYSKSRASSDKRAAEHLGRVIHGNDS
Ga0307312_1045846913300028828SoilSLFVDEATMAMLQRHCNHMDERAAEFGVEISSDAFVFSLAPDCVTPMPPDFVTKRVGVLKDHLGIADKHPDTIALEAKALRLYRQKPDGRRVQRCGPAPRGGMSFREIGERLGRSERWATLAVASAERREAAKARGLKLTFDGSILALRKFTSSELLDAGFNVSMVAHRQGHGPQVLTKHYAKSRRSADRRAADHLGRVVHG
Ga0302235_1012885423300028877PalsaVGVLKGYLGIEDKRPGVVALEEEALCLRRSPPPPRPKGRTGPSPNGGMSFREIGQQLGRSERWASLAVEAAERREYAEASGYGGLNFDGSILALRKFTSSELLDAGFNVSMVAQRQGHGPQVLTRHYSKSRASSDKRAAEHLGRVIHGNDS
Ga0308309_1104216723300028906SoilEALRLRRSDPLPRSPGTPGPLPSGGMSYREIARELDRSERWANLAVAAAERREQAIAAGRGGLDFDGSVLALRKFTSSELLDAGFNVSVVAQRQGHGPQVLTRHYSKSRASSDKLAAEHLGRVVHGK
Ga0311341_1061287413300029908BogAEGGVDLAADGFLFSLTMDCSTPMPPDYLTKRVAVLKGYLGIEEKDPEVAALEDEALRLRRATPPARPTGRPGPLPIGGMSYGEIGAALGRSSRWASLAVAAAKRREDARASGRSELDFDGSILALRKFTSSELLDAGFNVSVVAKRQGHGPQVLNRHYSKSRASSDKRAAEHLGRVVHGKS
Ga0311340_1121220413300029943PalsaVLKGYLGIEDKRPEVLALEDEALRLRRQPAAPRERGRTGPAPSGGMSLRDIGEKLGRSARWAALAVEAAERREQAREAGHGNLDFDGSILALRKFTSSELLDAGFNVSMVAQRQGHGPQVLTRHYAKSRASADKRAAEHLGRVVRGGTE
Ga0311352_1048415723300029944PalsaAGVELAADSFLFSLTQDCSTPMPPDYLTKRVAVLKGYLGIEDKDPDVVVLEDEALRLRRSTPPARPAGKTGPLPGGGLSYREIGAALGRSERWASLAVAAAERREHSQTSGHGDLDFDGSILALRKFTSSELLDAGFNVSVVAQRQGHGPQVLTRHYSKSRASSDKRAAEHLGRVVHGKG
Ga0311339_1172299713300029999PalsaMLQRHCDDMDERARTAGVELATDLFLFSLVADCSKPMPPDYFTKRVGVLKGYLGIENKRPEVVSLENEALRLRRSAPGPRPRGRTGPLPSGGMSLREIGQQLGRSEYWASLAVAAAERREHAAASGRAGLDFDGSILALRKFTSSELLDAGFNVSMVAQRQGHGPQVLTRHYSKSRASSDKR
Ga0311338_1186043213300030007PalsaRPEVVSLENEALRLRRSAPGPRPRGRTGPLPSGGMSLREIGQQLGRSEYWASLAVAAAERREHAAASGRAGLDFDGSILALRKFTSSELLDAGFNVSMVAQRQGHGPQVLTRHYSRSRASSDKRAAEHLGRVIHGSD
Ga0302282_125754913300030045FenRRHCDQMRERAAEGGVDLAADGFLFSLTMDCSTPMPPDYLTKRVAVLKGYLGIEEKDPEVAALEDEALRLRRATPPARPTGRPGPLPIGGMSYGEIGAALGRSSRWASLAVAAAKRREDARASGRSELDFDGSILALRKFTSSELLDAGFNVSVVAKRQGHGPQVLNRHYSKSRASSDKRAAEHLGRVVHGKS
Ga0302177_1011265123300030053PalsaVVALEDEALRLRRSTPPARPAGKTGPLPGGGLSYREIGAALGRSERWASLAVAAAERREHSQTSGHGDLDFDGSILALRKFTSSELLDAGFNVSVVAQRQGHGPQVLTRHYSKSRASSDKRAAEHLGRVVHGKGQ
Ga0302176_1040861013300030057PalsaPMPPDYLTKRVAVLKGYLGIEDKDPDVVVLEDEALRLRRSTPPARPAGKTGPLPGGGLSYREIGAALGRSERWASLAVAAAERREHSQTSGHGDLDFDGSILALRKFTSSELLDAGFNVSVVAQRQGHGPQVLTRHYSKSRASSDKRAAEHLGRVVHGKGQ
Ga0302184_1014394723300030490PalsaKRVAVLKGYLGIEDKDPDVVVLEDEALRLRRSTPPARPAGKTGPLPGGGLSYREIGAALGRSERWASLAVAAAERREHSQTSGHGDLDFDGSILALRKFTSSELLDAGFNVSVVAQRQGHGPQVLTRHYSKSRASSDKRAAEHLGRVVHGKGQ
Ga0268240_1016650413300030496SoilALEDEALRLYRQPPAERPAGKVGRSPAGAMAYATIGEQLGRSERWATLAVAAAQRRDAVRGRSDGSTAVFDGSILALRRFTSSELLDAGFNISMVAQRQGHGPQVLVKHYAKARRSADRKAAEHLGRVIHGR
Ga0311370_1244515713300030503PalsaYLGIENKRPEVVALEDEALRLRRSSPGSRPRDRTGPLPDGGMSLREIGEKLGRSEYWASLAVAAAERREHAAASGRAGLDFDGSILALRKFTSSELLDAGFNVSMVAQRQGHGPQVLTRHYSRSRASSDKRAAEHLGRVIHGSD
Ga0302275_1026811313300030518BogMLRRHCDQMRERAAEGGVDLAADGFLFSLTMDCSTPMPPDYLTKRVAVLKGYLGIEEKDPEVAALEDEALRLRRATPPARPTGRPGPLPIGGMSYGEIGAALGRSSRWASLAVAAAKRREDARASGRSELDFDGSILALRKFTSSELLDAGFNVSVVAKRQGHGPQVLNRHYSKSRASSDKRAAEHLGRVVHGKS
Ga0302193_1040231213300030519BogCDHMDERARTAGVKLATDPFLFSLVADCSKPMPPDYFTKRVGVLKGYLGIENKRPEVVTLEDEALRLRRSSPGSRPRGRTGPLPNGGMSLREIGEQLGRSEYWASLAVAAAERREHAAASGRTGLDFDGSILALRKFTSSELLDAGFNVSMVAQRQGHGPQVLTRHYSKSRASSDKRAAEHLGRVIHGSD
Ga0311372_1204953413300030520PalsaRRSTPPARPAGRTGPLPGGGLSYREIGAALGRSERWASLAVAAAARREHGQTSGRGDLDFDGSILALRKFTSSELLDAGFNVSVVAQRQGHGPQVLTRHYSKSRASSDKRAAEHLGRVVHGKGQ
Ga0311372_1244576923300030520PalsaGIEDKDPDVVALEDEALRFRRSTPPARPAGRTGPLPGGGLSYRDIGAALGRSERWASLAVAAAERREHTQTSGHGDLDFDGSILALRKFTSSELLDAGFNVSVVAQRQGHGPQVLTRHYSKSRASSDKRAAEHLGRVVHGKGQ
Ga0299906_1125255613300030606SoilPADYVTKRVAVLKQHLGIEDKRPETVALEDEALRLFRLVPEPRPAGRRGPAPKGGLSYDEIGKRLGRSSRWAAMAIAAAERRELAAAKGDGEVFDGSILALRKFTSSELLDAGFNISAVAQRQGHGPQVLTKHYAKGRRSADRKAAEHLGRLVHRRDDDSLGL
Ga0311356_1123672723300030617PalsaGIEEKDPEVAALEDEALRLRRATPPARPTGRPGPLPIGGMSYGEIGAALGRSSRWASLAVAAAKRREDARASGRSELDFDGSILALRKFTSSELLDAGFNVSVVAKRQGHGPQVLNRHYSKSRASSDKRAAEHLGRVVHGKS
Ga0302311_1101818813300030739PalsaIEDKRPGVVALEEEALCLRRSPPPPRPKGRTGPSPNGGMSFREIGQQLGRSERWASLAVEAAERREYAEASGYGGLNFDGSILALRKFTSSELLDAGFNVSMVAQRQGHGPQVLTRHYSKSRASSDKRAAEHLGRVIHGNDS
Ga0265721_100046213300030977SoilLEDEALRLRRSAPPPRPAGKSGPLPTGGMSYRDIGIAVGRSERWASLAVAAAERRERAHASGLADLDFDGSILALRKFTSSELLDAGFNVSMVAQRQGHGPQVLTRHYAKSRASSDRRAAEHLGRIVHGK
Ga0302307_1058849013300031233PalsaQIKEEAAAAGVELAADSFLFSLTQDCSTPMPPDYLTKRVAVLKGYLGIEDKDPDVVVLEDEALRLRRSTPPARPAGKTGPLPGGGLSYREIGAALGRSERWASLAVAAAERREHSQTSGHGDLDFDGSILALRKFTSSELLDAGFNVSVVAQRQGHGPQVLTRHYSKSRASSDKRAAEHLGRVVHGK
Ga0302325_1268900523300031234PalsaGIEDKRPEIVALEDEALRLRRSPPPQRPRGRTGPSPDGGISFREIGERLGRSQRWASLAVEAAERRERAAASGRTGLDFDGSILALRKFTSSELLDAGFNVTMVAQRQGHGPQVLTRHYSKSRASSDKRAAEHLGRVVHGHNPQQ
Ga0302324_10196800313300031236PalsaLGTDPFLFSLVADCSAPMPPDYLTKRVGVLKGYLGIEDKRPDIVTLEDEALRLRRLPPQRRPQGRTGPSPNGGMSFREIGQQLGRSERWASLAVAAAERREHAQASGNTDLDFDGSILALRKFTSSELLDAGFNVSMVAQRQGHGPQVLTRHYSKSRASSDKRAAEHLGRVVHGSDT
Ga0302324_10222233013300031236PalsaKPMPPDYFTKRVGVLKGYLGIENKRPEVVALENEALRLRRSAPGPRPRGKTGPLPNGGMSLREIGQQLGRSEYWASLAVAAAERREHAAASGRAGLDFDGSILALRKFTSSELLDAGFNVSMVAQRQGHGPQVLTRHYSRSRASSDKRAAEHLGRVIHGSD
Ga0302318_1050226423300031258BogRVAVLKGYLGIEEKDPEVAALEDEALRLRRATPPARPTGRPGPLPIGGMSYGEIGAALGRSSRWASLAVAAAKRREDARASGRSELDFDGSILALRKFTSSELLDAGFNVSVVAKRQGHGPQVLNRHYSKSRASSDKRAAEHLGRVVHGKS
Ga0302140_1091339623300031261BogPDYFTKRVGVLKGYLGIENKRPEVVTLEDEALRLRRSSPGSRPRGRTGPLPNGGMSLREIGEQLGRSEYWASLAVAAAERREHAAASGRTGLDFDGSILALRKFTSSELLDAGFNVSMVAQRQGHGPQVLTRHYSKSRASSDKRAAEHLGRVIHGSD
Ga0302320_1126000113300031524BogTAGVKLATDPFLFSLVADCSKPMPPDYFTKRVGVLKGYLGIENKRPEVVTLEEEALRLRRSSPGSRPRGRTGPLPNGGMSLREIGEQLGRSEYWASLAVAAAERREHAAASGRTGLDFDGSILALRKFTSSELLDAGFNVSMVAQRQGHGPQVLTRHYSKSRASSDKRAAEHLGRVIHGS
Ga0302326_1205793613300031525PalsaTAGVELAADPFLFSLVDNCSKPMPPDYFTKRVGVLKGYLGIENKRPEVVALENEALRLRRSAPGPRPRGKTGPLPNGGMSLREIGQQLGRSEYWASLAVAAAERREHAAASGRAGLDFDGSILALRKFTSSELLDAGFNVSMVAQRQGHGPQVLTRHYSRSRASSDKRAAEHLGRVIHGS
Ga0302326_1281549013300031525PalsaLATDPFLFSLVADCSKPMPPDYFTKRVGVLKGYLGIENKRPEVVTLEDEALRLRRSSPGSRPRGRTGPLPNGGMSLREIGEQLGRSEYWASLAVAAAERREHAAASGRTGLDFDGSILALRKFTSSELLDAGFNVSMVAQRQGHGPQVLTRHYSKSRASSDKRAAEHLGRVIHGSD
Ga0302326_1329100613300031525PalsaNYFTKRVGVLKGYLGIEDKRPEVVALEDEALRLRTSPSPPRPSGKTGPPPNGGMSFRDIGQQLRRSERWANLAVSAAQRRMQANSSGRGDLDFDGSILALRKFTSSELLDAGFNVSMVAQRQGHGPQVLTRHYSKSRASSDRRAAEHLGRVVHGGDS
Ga0318571_1025385013300031549SoilPDPYLFSAVPDYSAPLAPDLLTKQVAVLKGHLGIESKHPNVVDLEDEALRLRRSVPSARLAGRPGPDSQGGMSFREIGAALGRSERWASMAVASAERREAAKAAGRPQLNFDGSILGLRKFTSSELLDAGFNISVVAERQGHGPQVLTRHYSKSRASSDQRAAEHLGRVVHGRTQRKRGA
Ga0318528_1006817643300031561SoilPETVAREDEALRLQRQPARPKPRSTTGPPPKGGMSFREIGEHFGRSERWAMLAVAAAQRREEARAAGLGARTFDGSIIALRKFTSSELLDAGFNVTMIAQRQGHGPGVLTRHYSKSRASADKQAADHLGRVVHGRGGL
Ga0310686_11945386013300031708SoilSTPMPPDHLTKRVAVLKGYLGIENKAPAVIALEDKALKLRRSTPPARPVGKPGPLPTGGMSYRDIAAALGRSERWANLAVAAAERREEAQASGRGDLDFDGSILALRKFTSSELLDAGFNVSVVAQRQGHGPQVLTRHYSKSRASSDKRAADHLGRVVHGKGKSSSPAETQ
Ga0318501_1029961013300031736SoilHCELMDERAQLFAVDLCPDPFLFSLVPDCSEPIPPDYVTKRVAVLKGHLGIEEKRPETVAREDEALRLRRQPARPRPPSTTGPPPRGGMSFREIGEHFGRSERWATLAVAAAERRERARAAGLGARTFDGSIIALRRFTSSELLDAGFNVSMIAQRQGHGPGVLTRHYSKSRASADKQAADHLGRLVHGQRST
Ga0318492_1009089613300031748SoilTKQVAVLKGHLGIESKHPNVVDLEDEALRLRRSVPSARLAGRPGPDSQGGMSFREIGAALGRSERWASMAVASAERREAAKAAGRPQLNFDGSILGLRKFTSSELLDAGFNISVVAERQGHGPQVLTRHYSKSRASSDQRAAEHLGRVVHGRTQRKRGA
Ga0318554_1015955023300031765SoilAVPDYSAPLAPDLLTKQVAVLKGHLGIESKHPNVVDLEDEALRLRRSVPSARLAGRPGPDSQGGMSFREIGAALGRSERWASMAVASAERREAAKAAGRPQLNFDGSILGLRKFTSSELLDAGFNISVVAERQGHGPQVLTRHYSKSRASSDQRAAEHLGRVVHGRTQRKRGA
Ga0318543_1025881413300031777SoilLDPDPYLFSAVPDYSAPLAPDLLTKQVAVLKGHLGIESKHPNVVDLEDEALRLRRSVPSARLAGRPGPDSQGGMSFREIGAALGRSERWASMAVASAERREAAKAAGRPQLNFDGSILGLRKFTSSELLDAGFNISVVAERQGHGPQVLTRHYSKSRASSDQRAAEHLGRVVHGRTQRKRGA
Ga0302319_1124657523300031788BogTDPFLFSLVADCSKPMPPDYFTKRVGVLKGYLGIENKRPEVVTLEDEALRLRRSSPGSRPRGRTGPLPNGGMSLREIGEQLGRSEYWASLAVAAAERREHAAASGRTGLDFDGSILALRKFTSSELLDAGFNVSMVAQRQGHGPQVLTRHYSKSRASSDKRAAEHLGRVIHGSD
Ga0302319_1161000913300031788BogAVLKGYLGIENKRPEVVALEDEALRLRRSAPGPRPRGRTGPLPNGGMSLREIGQQLGRSEYWASLAVAAAERREHAEASGRTGLDFDGSILGLRKFTSSELLDAGFNVSMVAQRQGHGPQVLTRHYSKSRASSDKRAAEHLGRIVHGNDG
Ga0307410_1145816213300031852RhizosphereLAADPFVFGLALDCSTPMPPDHLTRRVSVLEEHLGIADKRAESIELEDEALRLFRQKPTNRRTTTTGPAPKGGLSYTEIGRRLARSDRWVAAAIESANRREQAAASGIRHNFDGSILALRKFTSTELLDAGFNISMVAQRQGHGPAVLVKHYSKARESADRRAADHLGSIVHKRTAG
Ga0310912_1021395913300031941SoilVDLEDEALRLRRSVPSARLAGRPGPDSQGGMSFREIGAALGRSERWASMAVASAERREAAKAAGRPQLNFDGSILGLRKFTSSELLDAGFNISVVAERQGHGPQVLTRHYSKSRASSDQRAAEHLGRVVHGRTQRKRGA
Ga0318570_1041488213300032054SoilAGVPLDPDPYLFSAVPDYSAPLAPDLLTKQVAVLKGHLGIESKHPNVVDLEDEALRLRRSVPSARLAGRPGPDSQGGMSFREIGAALGRSERWASMAVASAERREAAKAAGRPQLNFDGSILGLRKFTSSELLDAGFNISVVAERQGHGPQVLTRHYSKSRASSDQRAAEHLGRVVHGRTQRKRGA
Ga0318575_1066132113300032055SoilRLRRQPPQARPVGITGPVPKGGMSFREIGERFGRSERWAVLAVYAATRRQEARARGLTNGVFDGSILALRKFTSSELLDAGFNISMVAERQGHGAQVLTRHYSKSRASSDKKAAEHLGRVVHRRAT
Ga0318525_1017148413300032089SoilGIESKHPNVVDLEDEALRLRRSVPSARLAGRPGPDSQGGMSFREIGAALGRSERWASMAVASAERREAAKAAGRPQLNFDGSILGLRKFTSSELLDAGFNISVVAERQGHGPQVLTRHYSKSRASSDQRAAEHLGRVVHGRTQRKRGA
Ga0311301_1120825723300032160Peatlands SoilVTKRVGILKDHLGIADKKPGTVQLEDEALRLYWMAPIERTGVTGPTPKGGMSFQRIGAALGRTERWAALAVAAAERRETAQTRGWSLSFDGSTLALRKFTSSELLDAGFNISAVAQRQGHGPQVLIKHYSKGRRSADRRAADHLGKIVHQSTKDRTG
Ga0335081_1116568523300032892SoilDSSTPLAPDLLTKRVAMLKGHLGIEHKDPEAVALKNEALRLRRSAPSSRPAGRPGPHPQGCMSFREIGETLDRSERWASLAVASAERREKAEAEGLTHLRFDGSILGLRKFTWSELLDAGFNVGVVAERQGHGPQVPTRHYSKSRASSDQRAAEHLGRVVHGKSERQKESDSA
Ga0310914_1034777913300033289SoilCDLMDERAQLFGIDLCPDPFLFSLVPDCAEPIPPDYVTKRVAVLKGHLGIEEKRPETVAREDEALRLQRQPARPKPRSTTGPPPKGGMSFREIGEHFGRSERWAMLAVAAAQRREEARAAGLGARTFDGSIIALRKFTSSELLDAGFNVSMVAQRQGHGPGVLTRHYSKSRASADKQAADHLGRVVHGRGGL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.