NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F090050

Metagenome / Metatranscriptome Family F090050

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F090050
Family Type Metagenome / Metatranscriptome
Number of Sequences 108
Average Sequence Length 85 residues
Representative Sequence MIRSSKESIDTVVNNIENSIDYYINQHTADINGASRIRNDASIVRGLVEYRSALLSLLDENPPKKKRGNPNFGKNNPYLTKEVNE
Number of Associated Samples 91
Number of Associated Scaffolds 108

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 78.70 %
% of genes near scaffold ends (potentially truncated) 27.78 %
% of genes from short scaffolds (< 2000 bps) 48.15 %
Associated GOLD sequencing projects 83
AlphaFold2 3D model prediction Yes
3D model pTM-score0.53

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (40.741 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater
(18.518 % of family members)
Environment Ontology (ENVO) Unclassified
(46.296 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(86.111 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 47.79%    β-sheet: 0.00%    Coil/Unstructured: 52.21%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.53
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 108 Family Scaffolds
PF03237Terminase_6N 12.96
PF06568DUF1127 2.78
PF09095AmyA-gluTrfs_C 1.85
PF16778Phage_tail_APC 0.93
PF00004AAA 0.93
PF13203DUF2201_N 0.93
PF10282Lactonase 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 108 Family Scaffolds
COG5457Uncharacterized conserved protein YjiS, DUF1127 familyFunction unknown [S] 2.78


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms75.00 %
UnclassifiedrootN/A25.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003216|JGI26079J46598_1075223All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-7638Open in IMG/M
3300003264|JGI26119J46589_1000404Not Available8462Open in IMG/M
3300003346|JGI26081J50195_1040000All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-7972Open in IMG/M
3300004097|Ga0055584_100377539All Organisms → Viruses → Predicted Viral1464Open in IMG/M
3300005912|Ga0075109_1001003Not Available18276Open in IMG/M
3300006810|Ga0070754_10003009Not Available12115Open in IMG/M
3300006920|Ga0070748_1006721All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-75102Open in IMG/M
3300007276|Ga0070747_1308635All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-7543Open in IMG/M
3300007540|Ga0099847_1000410Not Available14599Open in IMG/M
3300007544|Ga0102861_1053833All Organisms → Viruses → Predicted Viral1047Open in IMG/M
3300007545|Ga0102873_1271312All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-7509Open in IMG/M
3300007551|Ga0102881_1002400All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-75667Open in IMG/M
3300007624|Ga0102878_1241121All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-7513Open in IMG/M
3300007639|Ga0102865_1175332All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-7641Open in IMG/M
3300008961|Ga0102887_1006394All Organisms → Viruses → Predicted Viral4664Open in IMG/M
3300008993|Ga0104258_1000784Not Available5306Open in IMG/M
3300009001|Ga0102963_1235912All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-7725Open in IMG/M
3300009049|Ga0102911_1003509Not Available5051Open in IMG/M
3300009055|Ga0102905_1005424All Organisms → Viruses → Predicted Viral2250Open in IMG/M
3300009172|Ga0114995_10114557All Organisms → Viruses → Predicted Viral1511Open in IMG/M
3300009420|Ga0114994_10003444All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-711529Open in IMG/M
3300009432|Ga0115005_11112888All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-7641Open in IMG/M
3300009436|Ga0115008_10006037Not Available9989Open in IMG/M
3300009436|Ga0115008_10059923Not Available2918Open in IMG/M
3300009441|Ga0115007_10000667All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-722625Open in IMG/M
3300009495|Ga0115571_1003451Not Available9984Open in IMG/M
3300009505|Ga0115564_10004761Not Available10951Open in IMG/M
3300009543|Ga0115099_10087650All Organisms → Viruses → Predicted Viral3049Open in IMG/M
3300009592|Ga0115101_1173988All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-7985Open in IMG/M
3300009592|Ga0115101_1429626All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-71613Open in IMG/M
3300009592|Ga0115101_1459761All Organisms → Viruses → Predicted Viral4054Open in IMG/M
3300009599|Ga0115103_1391952Not Available1232Open in IMG/M
3300009599|Ga0115103_1865422All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-76324Open in IMG/M
3300009785|Ga0115001_10394653All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-7865Open in IMG/M
3300010316|Ga0136655_1207624Not Available583Open in IMG/M
3300010883|Ga0133547_10740911Not Available1939Open in IMG/M
3300017950|Ga0181607_10080936All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-72097Open in IMG/M
3300018048|Ga0181606_10003439All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-713384Open in IMG/M
3300018560|Ga0188845_100645All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-71643Open in IMG/M
3300018569|Ga0188844_101270All Organisms → Viruses → Predicted Viral1862Open in IMG/M
3300020165|Ga0206125_10003113Not Available16457Open in IMG/M
3300020165|Ga0206125_10008215All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-77934Open in IMG/M
3300021085|Ga0206677_10002042Not Available18322Open in IMG/M
3300021085|Ga0206677_10003427Not Available13351Open in IMG/M
3300021169|Ga0206687_1948789All Organisms → Viruses → Predicted Viral1340Open in IMG/M
3300021185|Ga0206682_10011206Not Available6300Open in IMG/M
3300021185|Ga0206682_10017669All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-74662Open in IMG/M
3300021350|Ga0206692_1011854All Organisms → Viruses → Predicted Viral2646Open in IMG/M
3300021957|Ga0222717_10002527All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes14106Open in IMG/M
3300021957|Ga0222717_10007578Not Available7702Open in IMG/M
3300021957|Ga0222717_10010816All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-76331Open in IMG/M
3300021957|Ga0222717_10176825All Organisms → Viruses → Predicted Viral1281Open in IMG/M
3300021960|Ga0222715_10134816All Organisms → Viruses → Predicted Viral1550Open in IMG/M
3300021960|Ga0222715_10153304All Organisms → Viruses → Predicted Viral1425Open in IMG/M
3300022223|Ga0224501_10111215All Organisms → Viruses → Predicted Viral1644Open in IMG/M
3300022223|Ga0224501_10307275All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-7814Open in IMG/M
3300022841|Ga0222644_1006154All Organisms → Viruses → Predicted Viral1883Open in IMG/M
3300022921|Ga0255765_1249369Not Available742Open in IMG/M
3300023674|Ga0228697_118252All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-7659Open in IMG/M
3300023674|Ga0228697_127913Not Available531Open in IMG/M
3300023698|Ga0228682_1000858All Organisms → Viruses → Predicted Viral3131Open in IMG/M
3300024343|Ga0244777_10003817All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-79983Open in IMG/M
3300025543|Ga0208303_1000715Not Available13629Open in IMG/M
3300025608|Ga0209654_1047255All Organisms → Viruses → Predicted Viral1354Open in IMG/M
3300025636|Ga0209136_1083632Not Available962Open in IMG/M
3300025652|Ga0208134_1055324All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-71238Open in IMG/M
3300025809|Ga0209199_1009796All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-77262Open in IMG/M
3300025849|Ga0209603_1004141Not Available12268Open in IMG/M
3300025853|Ga0208645_1043011All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-72218Open in IMG/M
3300026419|Ga0247575_1001912All Organisms → Viruses → Predicted Viral2888Open in IMG/M
3300026421|Ga0247569_1000625All Organisms → Viruses → Predicted Viral3500Open in IMG/M
3300026427|Ga0247556_1002387All Organisms → Viruses → Predicted Viral2882Open in IMG/M
3300026449|Ga0247593_1000291All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-75527Open in IMG/M
3300026462|Ga0247568_1006449All Organisms → Viruses → Predicted Viral2034Open in IMG/M
3300026470|Ga0247599_1018372All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-71451Open in IMG/M
3300026500|Ga0247592_1160486All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-7535Open in IMG/M
3300026503|Ga0247605_1000786All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-75793Open in IMG/M
3300026503|Ga0247605_1019776All Organisms → Viruses → Predicted Viral1663Open in IMG/M
3300026503|Ga0247605_1027997All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-71407Open in IMG/M
3300026513|Ga0247590_1004305All Organisms → Viruses → Predicted Viral2930Open in IMG/M
3300026513|Ga0247590_1205452All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-7500Open in IMG/M
3300027215|Ga0208166_1001709All Organisms → Viruses → Predicted Viral2720Open in IMG/M
3300027223|Ga0208169_1061599Not Available673Open in IMG/M
3300027224|Ga0208164_1093212All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-7507Open in IMG/M
3300027235|Ga0208804_1001456All Organisms → Viruses → Predicted Viral3301Open in IMG/M
3300027251|Ga0208809_1014698All Organisms → Viruses → Predicted Viral1500Open in IMG/M
3300027810|Ga0209302_10000756All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-718691Open in IMG/M
3300027813|Ga0209090_10059903All Organisms → Viruses → Predicted Viral2116Open in IMG/M
3300027833|Ga0209092_10008429Not Available7816Open in IMG/M
3300027833|Ga0209092_10122342All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-71524Open in IMG/M
3300028076|Ga0247562_1011664All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-7903Open in IMG/M
3300028095|Ga0247563_1002902All Organisms → Viruses → Predicted Viral2607Open in IMG/M
3300028109|Ga0247582_1039239All Organisms → Viruses → Predicted Viral1225Open in IMG/M
3300028196|Ga0257114_1092862All Organisms → Viruses → Predicted Viral1241Open in IMG/M
3300028333|Ga0247595_1019822All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-71066Open in IMG/M
3300028338|Ga0247567_1001524All Organisms → Viruses → Predicted Viral3997Open in IMG/M
3300031141|Ga0308021_10010764All Organisms → Viruses → Predicted Viral4017Open in IMG/M
3300031510|Ga0308010_1030861All Organisms → Viruses → Predicted Viral2267Open in IMG/M
3300031589|Ga0307996_1055450All Organisms → Viruses → Predicted Viral1050Open in IMG/M
3300031608|Ga0307999_1039813All Organisms → Viruses → Predicted Viral1127Open in IMG/M
3300031629|Ga0307985_10001458All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-713330Open in IMG/M
3300031644|Ga0308001_10079551All Organisms → Viruses → Predicted Viral1392Open in IMG/M
3300031659|Ga0307986_10016390All Organisms → Viruses → Predicted Viral4353Open in IMG/M
3300031706|Ga0307997_10292060All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-7578Open in IMG/M
3300031851|Ga0315320_10000432All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-734624Open in IMG/M
3300032011|Ga0315316_10473587Not Available1051Open in IMG/M
3300032251|Ga0316198_10162375Not Available1306Open in IMG/M
3300034374|Ga0348335_151159All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-7635Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater18.52%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine12.96%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine11.11%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous7.41%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine7.41%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater5.56%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine5.56%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water5.56%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine4.63%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine3.70%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh2.78%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake1.85%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.85%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater1.85%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment1.85%
MarineEnvironmental → Aquatic → Marine → Inlet → Unclassified → Marine0.93%
SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Sediment0.93%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.93%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.93%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake0.93%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water0.93%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water0.93%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003216Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNAEnvironmentalOpen in IMG/M
3300003264Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_54_BLW_10EnvironmentalOpen in IMG/M
3300003346Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_74LU_5_DNAEnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300005912Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKDEnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007544Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3EnvironmentalOpen in IMG/M
3300007545Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3EnvironmentalOpen in IMG/M
3300007551Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3EnvironmentalOpen in IMG/M
3300007624Estuarine microbial communities from the Columbia River estuary - metaG 1548A-02EnvironmentalOpen in IMG/M
3300007639Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02EnvironmentalOpen in IMG/M
3300008961Estuarine microbial communities from the Columbia River estuary - metaG 1550B-02EnvironmentalOpen in IMG/M
3300008993Marine microbial communities from eastern North Pacific Ocean - P1 free-livingEnvironmentalOpen in IMG/M
3300009001Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MGEnvironmentalOpen in IMG/M
3300009049Estuarine microbial communities from the Columbia River estuary - metaG 1558A-02EnvironmentalOpen in IMG/M
3300009055Estuarine microbial communities from the Columbia River estuary - metaG 1556B-3EnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009420Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009495Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531EnvironmentalOpen in IMG/M
3300009505Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523EnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300010316Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNAEnvironmentalOpen in IMG/M
3300010883western Arctic Ocean co-assemblyEnvironmentalOpen in IMG/M
3300017950Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018048Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018560Metatranscriptome of marine microbial communities from Baltic Sea - GS678_3p0EnvironmentalOpen in IMG/M
3300018569Metatranscriptome of marine microbial communities from Baltic Sea - GS678_0p8EnvironmentalOpen in IMG/M
3300020165Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1EnvironmentalOpen in IMG/M
3300021085Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015EnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021185Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021960Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9DEnvironmentalOpen in IMG/M
3300022223Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_8_1EnvironmentalOpen in IMG/M
3300022841Saline water microbial communities from Ace Lake, Antarctica - #291EnvironmentalOpen in IMG/M
3300022921Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaGEnvironmentalOpen in IMG/M
3300023674Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 90R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023698Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 27R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300025543Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025608Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_161SG_22_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025636Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025652Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes)EnvironmentalOpen in IMG/M
3300025809Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes)EnvironmentalOpen in IMG/M
3300025849Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes)EnvironmentalOpen in IMG/M
3300025853Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes)EnvironmentalOpen in IMG/M
3300026419Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 30R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026421Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 20R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026427Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 1R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026449Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 56R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026462Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 17R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026470Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 73R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026500Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026503Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026513Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 51R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027215Estuarine microbial communities from the Columbia River estuary - metaG 1546C-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027223Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027224Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027235Estuarine microbial communities from the Columbia River estuary - metaG 1553A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027251Estuarine microbial communities from the Columbia River estuary - metaG 1556B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027813Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028076Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 10R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028095Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 11R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028109Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 41R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028196Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10mEnvironmentalOpen in IMG/M
3300028333Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 60R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028338Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 15R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031141Marine microbial communities from water near the shore, Antarctic Ocean - #351EnvironmentalOpen in IMG/M
3300031510Marine microbial communities from water near the shore, Antarctic Ocean - #129EnvironmentalOpen in IMG/M
3300031589Marine microbial communities from David Island wharf, Antarctic Ocean - #35EnvironmentalOpen in IMG/M
3300031608Marine microbial communities from water near the shore, Antarctic Ocean - #1EnvironmentalOpen in IMG/M
3300031629Marine microbial communities from Ellis Fjord, Antarctic Ocean - #80EnvironmentalOpen in IMG/M
3300031644Marine microbial communities from water near the shore, Antarctic Ocean - #5EnvironmentalOpen in IMG/M
3300031659Marine microbial communities from Ellis Fjord, Antarctic Ocean - #82EnvironmentalOpen in IMG/M
3300031706Marine microbial communities from David Island wharf, Antarctic Ocean - #36EnvironmentalOpen in IMG/M
3300031851Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515EnvironmentalOpen in IMG/M
3300032011Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416EnvironmentalOpen in IMG/M
3300032251Coastal sediment microbial communities from Oude Bieten Haven, Netherlands - site A anoxicEnvironmentalOpen in IMG/M
3300034374Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI26079J46598_107522323300003216MarineMIRSSKESIDTVVNNIENSIDYYINQHTADINGASRIRNDASIVRGLVEYRSALLSLLDENPPRKKRGNPNFGKNNPYLTKEVNE*
JGI26119J46589_100040433300003264MarineMIKSSNEQINTVITNIENSIDYFINQHTADLNGAARIRNDANIVRGLVEYRSALLNLQKENTPVKKRGNPNFGKNNPYTTKQEVSNDG*
JGI26081J50195_104000013300003346MarineMIRSSRESIDKVVSNIESSIDYFINQHIADINGSARIRNDANIVRGLVEYRAALLSLQEEYTPKKKRGNPNFGKDNPYLNKTEDNE*
Ga0055584_10037753933300004097Pelagic MarineMIRSSKESIDTVVNNIENSIDYYINQHAADINGASRIRNDASIVRGLVEYRSALLSLLDENPPKKKRGNPNFGKNNPYLTKEVNE*
Ga0075109_1001003123300005912Saline LakeMIRSSEESINTVLNNIDNSIDYYINQHTAGINGASRLRNDAMTVKGLVEYRSALKALLEENYSPKKKRGNPNFGKDNPYLNKEVTE*
Ga0070754_1000300973300006810AqueousMINTKKETIDTVISNIESSIDYYLNQHRADISGASRIRNDATIVKGLFDYREALINLQKENAPAKKRGNPNFGKNNPYNIKQEVKNDG*
Ga0070748_100672163300006920AqueousMIRSSRESIDKVVSNIESSIDYFINQHIADINGSARIRNDANIVRGLVEYRAALLSLQEEYTPKKKRGNPNFGKDNPYLNKTEDN*
Ga0070747_130863513300007276AqueousMINTKKETIDTVISNIESSIDYYLNQHRADISGASRIRNDATIVKGLFDYREALINLQKENAPAKKRGNPNFGKNNPYNIKQEVKN
Ga0099847_1000410163300007540AqueousMLRSSRESIDKVIENIEKSIDYYINQHIADINGANRIRNDASTVRGLVEYRLALIDLLEENYSPKKKRGNPNFGKNNPYLNKEVTE*
Ga0102861_105383323300007544EstuarineMIKSSNEQINTVITNIENSIDYFINQHTADLNGAARIRNDALVVKALFEYRTSLLDLQKENTPVKKRGNPNFGKNNPYTTKQEVTNDG*
Ga0102873_127131213300007545EstuarineMIKSNNEQINTVITNIENSIDYFINQHTADLNGAARIRNDALVVKALFEYRTSLLDLQKENTPVKKRGNPNFGKNNPYTTKQEVTNDG*
Ga0102881_100240073300007551EstuarineMIKSSNEQINTVINNIENSIDYFINQHTADLNGAARIRNDALVVKALFEYRTSLLDLQKENTPVKKRGNPNFGKNNPYTTKQEVTNDG*
Ga0102878_124112123300007624EstuarineINNIENSIDYFINQHTADLNGAARIRNDALVVKALFEYRTSLLDLQKENTPVKKRGNPNFGKNNPYTTKQEVTNDG*
Ga0102865_117533223300007639EstuarineMIKSSNEQINTVITNIENSIDYFINQHTADLNGAARIRNDANIVRGLVEYRSALLNLQKENTPVKKRGNPNFGKNNPYTTKQEVTNDG*
Ga0102887_100639473300008961EstuarineNEQINTVITNIENSIDYFINQHTADLNGAARIRNDALVVKALFEYRTSLLDLQKENTPVKKRGNPNFGKNNPYTTKQEVTNDG*
Ga0104258_100078463300008993Ocean WaterMIKSSKESIDKVVINIERSIDYFINQHTADINGASRIRNDASVVRSLFEYRTALLELLEENTPKKKRGNPNFGKDNPYLNKEVNE*
Ga0102963_123591213300009001Pond WaterMLRSSRESIDTVIENIDKSIDYYINQHIADISGANRIRNDANTVRGLVEYRSALMDLLEENYSPKKKRGNPNFGKNNPYLNKEVTE*
Ga0102911_100350963300009049EstuarineMIKSSNEQINTVITNIENSIDYFINQHTADLNGAARIRNDANIVRGLVEYRSALLNLQKENTAVKKRGNPNFGKNNPYTTKQEVTNDG*
Ga0102905_100542423300009055EstuarineMIKSNNEQINTVINNIENSIDYFINQHTADLNGAARIRNDALVVKALFEYRTSLLDLQKENTPVKKRGNPNFGKNNPYTTKQEVTNDG*
Ga0114995_1011455723300009172MarineMIRSSKESIDTVVSNIESSIDYYINQHTADISGASRIRNDASVVRSLFEYRTALLGLQEENTPKKKRGNPNFGKDNPYLGKEVNE*
Ga0114994_1000344493300009420MarineMIRSSRESIDTVVSNIEKSIDYYINQHTADISGASRIRGDANTVRGLVEYRSALLSLLEEDTPKKKRGNPNFGKDNPYLTKTEVNE*
Ga0115005_1111288823300009432MarineMMIRSSKESIGKVVINIESSIDYFINQHTADINGASRIRNDASVVQGLFEYRTSLLELLEENTPKKKRGNPNFGKDNPYLNKEVNE*
Ga0115008_1000603733300009436MarineMIRSSKESIDTVVINIERSIDYFINQHTADINGASRIRNDASVVHSLFEYRTALLELLEENTPKKKRGNPNFGKDNPYLNKEVN*
Ga0115008_1005992333300009436MarineMIKSSNEQINTVITNIENSIDYFINQHTADLNGAARIRNDALVVKALFEYRTSLLDLQKDNTPVKKRGNPNFGKNNPYTTKQEVSNDG*
Ga0115007_10000667423300009441MarineMMIKSSKESIDTVVINIERSIDYFINQHTADISGASRIRNDASVVRSLFEYRTALLELLEESTPKKKRGNPNFGKDNPYLNKEVNE*
Ga0115571_1003451163300009495Pelagic MarineMINTKKETIDTVISNIESSIDYYLNQHRADISGASRIRNDATIVKGLFDYREALINLQKENAPAKKRGNPNFGKHNPYNTKQEVKNDG*
Ga0115564_10004761103300009505Pelagic MarineMIKSSNEQINTVITNIENSIDYFINQHTADLNGAARIRNDALVVKALFEYRTSLLNLQKDNAPAKKRGNPNFGKNNPYTIKQEVSNDG*
Ga0115099_1008765013300009543MarineSRESIDKVIENIEKSIDYYINQHIADINGANRIRNDASTVRGLVEYRSALIEMLEENYAPKRKRGNPNFGKNNPYLSKEVTE*
Ga0115101_117398823300009592MarineVVIDNIDNSITYYLNQHTADISGASRIRNDAPIIKGLFDYREALIKLQKENSPAKKRGNPNFGKNNPYNTNKQEVTNDG*
Ga0115101_142962613300009592MarineMIRSSRESIDTVVNNIDNSIDYYINQHTADINGASRIRNDASIVRGLVEYRSALLSLLEDNPPKKKRGNPNFGKNNPYLIKEVNE*
Ga0115101_145976133300009592MarineMLRSSRESIDKVIENIEKSIDYYINQHIADINGANRIRNDASTVRGLVEYRSALIEMLEENYAPKRKRGNPNFGKNNPYLSKEVTE*
Ga0115103_139195233300009599MarineMIKSSNEQINTVITNIENSIDYFINQHTADLNGAARIRNDANIVRGLVEYRSALLNLQKENTPVKKRGNPNFGKNNP
Ga0115103_186542263300009599MarineMLRSSRESIDKVIENIEKSIDYYINQHIADINGANRIRNDANTVRGLVEYRSALIEMLEENYAPKRKRGNPNFGKNNPYLSKEVTE*
Ga0115001_1039465333300009785MarineMIKSNNESINKVVDNIDKSIDYFINQHIIDLTGANRIRNDASVVRGLVEYRSALLGLIEENTPKKKRGNPNFGKDNPYNTKTEVNE*
Ga0136655_120762423300010316Freshwater To Marine Saline GradientMIRSSRESIDKVVSNIESSIDYFINQHIADINGSARIRNDANIVRGLVEYRAALLSLQEEYTPKKKRGNPNFGK
Ga0133547_1074091133300010883MarineMINSTKESINKVIENIDKSIDYFINQHIVDLNGANRIRNDASVVRGLVEYRSALLSLLEENTPKKKRGNPNFGKDNPYTNKTEVNE*
Ga0181607_1008093623300017950Salt MarshMIRSSKESIDKVVSNIESSIDYFINQHIADINGSARIRNDANIVRGLVEYRAALLSLQEEYTPKKKRGNPNFGKDNPYLNKTEDNE
Ga0181606_1000343963300018048Salt MarshMIRSSRESIDKVVSNIESSIDYFINQHIADINGSARIRNDANIVRGLVEYRAALLSLQEEYTPKKKRGNPSFGKDNPYLNKTEDNE
Ga0188845_10064533300018560Freshwater LakeMIRSSKESIETVVTNIENSIDYYINQHTADLNGASRIRNDASIVRGLVEYRSALLDLLEEETPRKKRGNPNFGKDNPYFTKKEVNE
Ga0188844_10127023300018569Freshwater LakeMIRSSKESIETVVTNIENSIDYYINQHTADLNGASRIRNDASIVRGLVEYRSALLDLLEEETPRKKRGNPNFGKDNPYFTKKEGNE
Ga0206125_10003113153300020165SeawaterVRKTAMINTKKETIDTVISNIESSIDYYLNQHRADISGASRIRNDATIVKGLFDYREALINLQKENAPAKKRGNPNFGKHNPYNTKQEVKNDG
Ga0206125_1000821573300020165SeawaterMIRSSRESIDKVVSNIESSIDYFINQHIADINGSARIRNDANIVRGLVEYRAALLSLQEEYTPKKKRGNPNFGKDNPYLNKTEDNE
Ga0206677_10002042163300021085SeawaterMIKSSNEQINTVITNIENSIDYFINQHTADLNGAARIRNDANIVRGLVEYRSALLNLQKENTPVKKRGNPNFGKNNPYTTKQEVSNDG
Ga0206677_10003427103300021085SeawaterMINIKKETIDVVIDNIDNSITYYLNQHTADISGASRIRNDAPIIKGLFDYREALIKLQKENAPAKKRGNPNFGKNNPYNTNKQEVTNDG
Ga0206687_194878923300021169SeawaterMLRSSRESIDKVIENIEKSIDYYINQHIADINGANRIRNDASSVRGLVEYRSALIEMLEENYAPKRKRGNPNFGKNNPYLSKEVTE
Ga0206682_1001120663300021185SeawaterMLRSSRESIDKVIENIEKSIDYYINQHIADINGANRIRNDASTVRGLVEYRSALIEMLEENYAPKRKRGNPNFGKNNPYLSKEVTE
Ga0206682_1001766973300021185SeawaterMIRSSRESIDTVVNNIDNSIDYYINQHTADINGASRIRNDASIVRGLVEYRSALLSLLEDNPPKKKRGNPNFGKNNPYLIKEVNE
Ga0206692_101185433300021350SeawaterMIRSSKESIDTVVNNIENSIDYYINQHTADINGASRIRNDASIVRGLVEYRSALLSLLEDNPPKKKRGNPNFGKNNPYLIKEVNE
Ga0222717_1000252763300021957Estuarine WaterMLRSSRESIDKVIENIEKSIDYYINQHIADINGANRIRNDANTVRGLVEYRSALIEMLEENYAPKKKRGNPNFGKNNPYLGKEVTE
Ga0222717_1000757893300021957Estuarine WaterMIRSSKESIDKVVVNIETSIDYFINQHIADINGASRIRNDASVVRSLFEYRTALLELLEENTPKKKRGNPNFGKDNPYLKKEVSE
Ga0222717_1001081673300021957Estuarine WaterMINIKKETIDVVIDNIDNSITYYLNQHTADISGASRIRNDAPIIKGLFDYREALIKLQKENSPAKKRGNPNFGKNNPYNTNKQEVTNDG
Ga0222717_1017682523300021957Estuarine WaterMIRSSKESIDTVVNNIENSIDYYINQHTADINGASRIRNDASIVRGLVEYRSALLSLLDDNPPKKKRGNPNFGKNNPYLTKEVNE
Ga0222715_1013481633300021960Estuarine WaterMIRSSKESIDTVVNNIDNSIDYYINQHTADINGASRIRNDASIVRGLVEYRSALLSLLDDNPPKKKRGNPNFGKNNPYLTKEVNE
Ga0222715_1015330423300021960Estuarine WaterMIRSSRESIDKVVSNIESSIDYFINQHIADINGSARIRNDANIVRGLVEYRSALLSLQEEYTPKKKRGNPNFGKDNPYLNKTEDNE
Ga0224501_1011121523300022223SedimentMIRSSKESIDTVVNNIENSIDYYINQQTADINGASRIRNDASIVRGLVEYRSALLSLLDDNPPKKKRGNPNFGKNNPYLTKEVNE
Ga0224501_1030727533300022223SedimentMIRSSKESIDTVVNNIENSIDYYINQHTADINGASRIRNDASIVRGLVEYRSALLSLLDENPPKKKRGNPNFGKNNPYLTKEVNE
Ga0222644_100615433300022841Saline WaterMIRSSEESINTVLNNIDNSIDYYINQHTAGINGASRLRNDAMTVKGLVEYRSALKALLEENYSPKKKRGNPNFGKDNPYLNKEVTE
Ga0255765_124936913300022921Salt MarshMIRSSKESIDKVVSNIESSIDYFINQHIADINGSARIRNDANIVRGLVEYRAALLSLQEEYTPKKKRGNPNFGKDNPYLNKT
Ga0228697_11825213300023674SeawaterLLWKRWVRAKTMIRSSRESIDKVVSNIESSIDYFINQHIADINGSARIRNDANIVRGLVEYRAALLSLQEEYTPKKKRGNPNFGKDNPYLNKTEVNE
Ga0228697_12791323300023674SeawaterMINIKKETIDVVIDNIDNSITYYLNQHTADISGASRIRNDAPIIKGLFDYREALIKLQKENSPAKKRGNPNFGKNNPYNTNKQEV
Ga0228682_100085813300023698SeawaterDNIDNSITYYLNQHTADISGASRIRNDAPIIKGLFDYREALIKLQKENSPAKKRGNPNFGKNNPYNTNKQEVTNDG
Ga0244777_1000381763300024343EstuarineMIKSNNEQINTVITNIENSIDYFINQHTADLNGAARIRNDALVVKALFEYRTSLLDLQKENTPVKKRGNPNFGKNNPYTTKQEVTNDG
Ga0208303_1000715173300025543AqueousMLRSSRESIDKVIENIEKSIDYYINQHIADINGANRIRNDASTVRGLVEYRLALIDLLEENYSPKKKRGNPNFGKNNPYLNKEVTE
Ga0209654_104725523300025608MarineMIRSSKESIDTVVNNIENSIDYYINQHTADINGASRIRNDASIVRGLVEYRSALLSLLDENPPRKKRGNPNFGKNNPYLTKEVNE
Ga0209136_108363223300025636MarineMIKSSNEQINTVITNIENSIDYFINQHTADLNGAARIRNDALVVKALFEYRTSLLDLQKDNTPVKKRGNPNFGKNNPYTTKQEVSNDG
Ga0208134_105532433300025652AqueousMIRSSRESIDKVVSNIESSIDYFINQHIADINGSARIRNDANIVRGLVEYRAALLSLQEEYTPKKKRGNPNFGKDNPYLNKTEDN
Ga0209199_100979673300025809Pelagic MarineMIKSSNEQINTVITNIENSIDYFINQHTADLNGAARIRNDALVVKALFEYRTSLLNLQKDNAPAKKRGNPNFGKNNPYTIKQEVSNDG
Ga0209603_100414153300025849Pelagic MarineMINTKKETIDTVISNIESSIDYYLNQHRADISGASRIRNDATIVKGLFDYREALINLQKENAPAKKRGNPNFGKHNPYNTKQEVKNDG
Ga0208645_104301133300025853AqueousVRKTAMINTKKETIDTVISNIESSIDYYLNQHRADISGASRIRNDATIVKGLFDYREALINLQKENAPAKKRGNPNFGKNNPYNIKQEVKNDG
Ga0247575_100191243300026419SeawaterVITNIENSIDYFINQHTSDLNGAARIRNDANIVRGLVEYRSALLNLQKENTPVKKRGNPNFGKNNPYTTKQEVSNDG
Ga0247569_100062523300026421SeawaterMIKSSNKQINTVITNIENSIDYFINQHTADLNGAARIRNDANIVRGLVEYRSALLNLQKENTPVKKRGNPNFGKNNPYTTKQEVSNDG
Ga0247556_100238713300026427SeawaterNIDNSITYYLNQHTADISGASRIRNDAPIIKGLFDYREALIKLQKENSPAKKRGNPNFGKNNPYNTNKQEVTNDG
Ga0247593_100029163300026449SeawaterMISSSRESIDKVVSNIESSIDYFINQHIADINGSARIRNDANIVRGLVEYRAALLSLQEEYTPKKKRGNPNFGKDNPYLNKTEVNE
Ga0247568_100644913300026462SeawaterVVIDNIDNSITYYLNQHTADISGASRIRNDAPIIKGLFDYREALIKLQKENSPAKKRGNPNFGKNNPYNTNKQEVTNDG
Ga0247599_101837213300026470SeawaterVSNIESSIDYFINQHIADINGSARIRNDANIVRGLVEYRAALLSLQEEYTPKKKRGNPNFGKDNPYLNKTEVNE
Ga0247592_116048613300026500SeawaterLLWNPWVRKTTMIRSSKESIDTVVNNIENSIDYYINQHTADINGASRIRNDASIVRGLVEYRSALLSLLDDNPPKKKRGNPNFGKNNPYLTKEVNE
Ga0247605_100078653300026503SeawaterMIRSSRESIDKVVSNIESSIDYFINQHIADINGSARIRNDANIVRGLVEYRAALLSLQEEYTPKKKRGNPNFGKDNPYLNKTEVNE
Ga0247605_101977633300026503SeawaterMIRSSKESIDTVVNNIENSIDYYINQHTADINGASRIRNDASIVRGLVEYRSALLSLLDDNPPRKKRGNPNFGKNNPYLTKEVNE
Ga0247605_102799713300026503SeawaterAMIKSSNEQINTVITNIENSIDYFINQHTADLNGAARIRNDANIVRGLVEYRSALLNLQKENTPVKKRGNPNFGKNNPYTTKQEVTNDG
Ga0247590_100430513300026513SeawaterAMINIKKETIDVVIDNIDNSITYYLNQHTADISGASRIRNDAPIIKGLFDYREALIKLQKENSPAKKRGNPNFGKNNPYNTNKQEVTNDG
Ga0247590_120545213300026513SeawaterQINTVITNIENSIDYFINQHTADLNGAARIRNDANIVRGLVEYRSALLNLQKENTPVKKRGNPNFGKNNPYTTKQEVSNDG
Ga0208166_100170913300027215EstuarineSNNEQINTVITNIENSIDYFINQHTADLNGAARIRNDALVVKALFEYRTSLLDLQKENTPVKKRGNPNFGKNNPYTTKQEVTNDG
Ga0208169_106159933300027223EstuarineMIKSNNEQINTVITNIENSIDYFINQHTADLNGAARIRNDALVVKALFEYRTSLLDLQKENTPVKKRGNPNFGKNNPYTTKQ
Ga0208164_109321223300027224EstuarineMIKSSNEQINTVITNIENSIDYFINQHTADLNGAARIRNDANIVRGLVEYRSALLNLQKENTPVKKRGNPNFGKNNPYTTKQEVTNDG
Ga0208804_100145633300027235EstuarineMIKSNNEQINTVINNIENSIDYFINQHTADLNGAARIRNDALVVKALFEYRTSLLDLQKENTPVKKRGNPNFGKNNPYTTKQEVTNDG
Ga0208809_101469833300027251EstuarineMIKSSNEQINTVITNIENSIDYFINQHTADLNGAARIRNDALVVKALFEYRTSLLDLQKENTPVKKRGNPNFGKNNPYTTKQEVTNDG
Ga0209302_10000756293300027810MarineMMIKSSKESIDTVVINIERSIDYFINQHTADISGASRIRNDASVVRSLFEYRTALLELLEESTPKKKRGNPNFGKDNPYLNKEVNE
Ga0209090_1005990323300027813MarineMIRSSRESIDTVVSNIEKSIDYYINQHTADISGASRIRGDANTVRGLVEYRSALLSLLEEDTPKKKRGNPNFGKDNPYLTKTEVNE
Ga0209092_1000842963300027833MarineMIKSSNEQINTVITNIENSIDYFINQHTADLNGAARIRNDALVVKALFEYRTSLLDLQKDNAPAKKRGNPNFGKNNPYTIKQEVSNDG
Ga0209092_1012234213300027833MarineIDTVVINIERSIDYFINQHTADINGASRIRNDASVVHSLFEYRTALLELLEENTPKKKRGNPNFGKDNPYLNKEVN
Ga0247562_101166423300028076SeawaterMLRSSRESIDKVIENIKKSIDYYINQHIADINGANRIRNDASTVRGLVEYRSALIEMLEENYAPKRKRGNPNFGKNNPYLSKEVTE
Ga0247563_100290233300028095SeawaterNEQINTVITNIENSIDYFINQHTADLNGAARIRNDANIVRGLVEYRSALLNLQKENTPVKKRGNPNFGKNNPYTTKQEVSNDG
Ga0247582_103923923300028109SeawaterMIRSSRESIDKVVSNIESSIDYFINQHIADINGSDRIRNDANIVRGLVEYRAALLSLQEEYTPKKKRGNPNFGKDNPYLNKTEVNE
Ga0257114_109286223300028196MarineMIKSSNEQINTVITNIENSIDYFINQHTADLNGAARIRNDALVVKALFEYRTSLLDLQKENTPVKKRGNPNFGKNNPYTTKQEVSNDG
Ga0247595_101982223300028333SeawaterMIRSSKESIDTVVNNIENSIDYYINQHTADINGASRIRNDASIVRGLVEYRSALLSLLDDNPPKKKRGNPNFGKNNPYLNKEVNE
Ga0247567_100152463300028338SeawaterRIAMIKSSNEQINTVITNIENSIDYFINQHTADLNGAARIRNDANIVRGLVEYRSALLNLQKENTPVKKRGNPNFGKNNPYTTKQEVSNDG
Ga0308021_1001076463300031141MarineMIKSSNESINKVVENIDKSIDYFINQHIIDLTGANRIRNDAGVVRGLVEYRSALLGLVEENTPKKKRGNPNFGKDNPYNTKTEVNE
Ga0308010_103086123300031510MarineMINSKKETIDIVVKNIENSIDYYLNQHIADINGASRIRNDALVVKGLFDYRTSLLDLLKEDTSVRKRGNPNFGKNNPYNTKQEVSNDG
Ga0307996_105545023300031589MarineMIKSSKDSIDTVVINIERSIDYFINQHTADINGASRIRNDASVVRSLFEYRTALLELLDETTPKKKRGNPNFGKDNPYLNKEVN
Ga0307999_103981333300031608MarineMINSKKETIDIVVKNIENSIDYYLNQHIADINGASRIRNDALVVKGLFDYRTSLLDLLKEDTSVRKRGNPNFGKNN
Ga0307985_1000145873300031629MarineMIRSSKESIEIVVTNIENSIDYYITQHTADLNGASRIRNDASIVRGLVEYRSTLLGLLDEETPRKKRGNPNFGKDNPYFTKKEDTE
Ga0308001_1007955113300031644MarineMINSTNESINKVVENIDKSIDYFINQHIIDLTGANRIRNDAGVVRGLVEYRSALLGLVEENTPKKKRGNPNFGKDNPYNTKTEVNE
Ga0307986_1001639033300031659MarineMIRSSKESIDTVVSNIESSIDYYINQHTADISGASRIRNDASVVRGLFEYRTALLGLQEENTPKKKRGNPNFGKDNPYLGKEVNE
Ga0307997_1029206023300031706MarineINKVVENIDKSIDYFINQHIIDLTGANRIRNDAGVVRGLVEYRSALLGLVEENTPKKKRGNPNFGKDNPYNTKTEVNE
Ga0315320_10000432233300031851SeawaterMLRSSRESIDKVIENIEKSIDYYINQHIADINGANRIRNDANTVRGLVEYRSALIEMLEENYAPKRKRGNPNFGKNNPYLSKEVTE
Ga0315316_1047358713300032011SeawaterMINSSKESINKVIENIDKSIDYFINQHLVDLTGANRIRNDASIVRGLVEYRSALNSLLEEITPKKKRGNPNFGKNNPYNKAASV
Ga0316198_1016237513300032251SedimentMIRSSRESIDKVVSNIESSIDYFINQHIADINGSARIRNDANIVRGLVEYRAALLSLQEEYTPKKKRGNPNFGKDNPYLN
Ga0348335_151159_418_6333300034374AqueousIESSIDYFINQHIADINGSARIRNDANIVRGLVEYRAALLSLQEEYTPKKKRGNPNFGKDNPYLNKTEDNE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.