Basic Information | |
---|---|
Family ID | F089945 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 108 |
Average Sequence Length | 42 residues |
Representative Sequence | VTTFADGFAHPLALLVDRDGGLLVADWGRGVVYRIQARGRT |
Number of Associated Samples | 102 |
Number of Associated Scaffolds | 108 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 2.86 % |
% of genes near scaffold ends (potentially truncated) | 93.52 % |
% of genes from short scaffolds (< 2000 bps) | 93.52 % |
Associated GOLD sequencing projects | 99 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.55 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (83.333 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (24.074 % of family members) |
Environment Ontology (ENVO) | Unclassified (34.259 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.556 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 21.74% Coil/Unstructured: 78.26% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 108 Family Scaffolds |
---|---|---|
PF00472 | RF-1 | 10.19 |
PF07099 | DUF1361 | 6.48 |
PF13189 | Cytidylate_kin2 | 5.56 |
PF13344 | Hydrolase_6 | 5.56 |
PF12697 | Abhydrolase_6 | 5.56 |
PF01293 | PEPCK_ATP | 3.70 |
PF11798 | IMS_HHH | 2.78 |
PF11354 | DUF3156 | 2.78 |
PF05988 | DUF899 | 2.78 |
PF00171 | Aldedh | 2.78 |
PF11790 | Glyco_hydro_cc | 1.85 |
PF02151 | UVR | 1.85 |
PF00211 | Guanylate_cyc | 1.85 |
PF01435 | Peptidase_M48 | 1.85 |
PF02608 | Bmp | 1.85 |
PF04307 | YdjM | 1.85 |
PF03061 | 4HBT | 0.93 |
PF02873 | MurB_C | 0.93 |
PF01391 | Collagen | 0.93 |
PF07730 | HisKA_3 | 0.93 |
PF13520 | AA_permease_2 | 0.93 |
PF00480 | ROK | 0.93 |
PF13229 | Beta_helix | 0.93 |
PF00150 | Cellulase | 0.93 |
PF01887 | SAM_HAT_N | 0.93 |
PF13302 | Acetyltransf_3 | 0.93 |
PF03853 | YjeF_N | 0.93 |
PF00440 | TetR_N | 0.93 |
PF01743 | PolyA_pol | 0.93 |
PF12680 | SnoaL_2 | 0.93 |
PF00817 | IMS | 0.93 |
PF03551 | PadR | 0.93 |
PF01520 | Amidase_3 | 0.93 |
PF01436 | NHL | 0.93 |
COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
---|---|---|---|
COG0216 | Protein chain release factor RF1 | Translation, ribosomal structure and biogenesis [J] | 10.19 |
COG1186 | Protein chain release factor PrfB | Translation, ribosomal structure and biogenesis [J] | 10.19 |
COG4330 | Uncharacterized membrane protein, DUF1361 domain | Function unknown [S] | 6.48 |
COG1866 | Phosphoenolpyruvate carboxykinase, ATP-dependent | Energy production and conversion [C] | 3.70 |
COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 2.78 |
COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 2.78 |
COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 2.78 |
COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 2.78 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 1.85 |
COG1988 | Membrane-bound metal-dependent hydrolase YbcI, DUF457 family | General function prediction only [R] | 1.85 |
COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 1.85 |
COG1744 | Lipoprotein Med, regulator of KinD/Spo0A, PBP1-ABC superfamily, includes NupN | Signal transduction mechanisms [T] | 1.85 |
COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.93 |
COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.93 |
COG2730 | Aryl-phospho-beta-D-glucosidase BglC, GH1 family | Carbohydrate transport and metabolism [G] | 0.93 |
COG3934 | Endo-1,4-beta-mannosidase | Carbohydrate transport and metabolism [G] | 0.93 |
COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.93 |
COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.93 |
COG1912 | Stereoselective (R,S)-S-adenosylmethionine hydrolase (adenosine-forming) | Defense mechanisms [V] | 0.93 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.93 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.93 |
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.93 |
COG0860 | N-acetylmuramoyl-L-alanine amidase | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
COG0812 | UDP-N-acetylenolpyruvoylglucosamine reductase | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
COG0617 | tRNA nucleotidyltransferase/poly(A) polymerase | Translation, ribosomal structure and biogenesis [J] | 0.93 |
COG0389 | Nucleotidyltransferase/DNA polymerase DinP involved in DNA repair | Replication, recombination and repair [L] | 0.93 |
COG0062 | NAD(P)H-hydrate repair enzyme Nnr, NAD(P)H-hydrate epimerase domain | Nucleotide transport and metabolism [F] | 0.93 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 83.33 % |
Unclassified | root | N/A | 16.67 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000891|JGI10214J12806_10432352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 691 | Open in IMG/M |
3300002568|C688J35102_119858180 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
3300004114|Ga0062593_102902404 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300004153|Ga0063455_100663948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 693 | Open in IMG/M |
3300004157|Ga0062590_102342524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 562 | Open in IMG/M |
3300004479|Ga0062595_100325543 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
3300004479|Ga0062595_100459698 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
3300005093|Ga0062594_102451972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 571 | Open in IMG/M |
3300005178|Ga0066688_10695889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 646 | Open in IMG/M |
3300005347|Ga0070668_100616241 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
3300005365|Ga0070688_100397877 | All Organisms → cellular organisms → Bacteria | 1019 | Open in IMG/M |
3300005438|Ga0070701_10584993 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
3300005441|Ga0070700_101192575 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300005457|Ga0070662_100176671 | All Organisms → cellular organisms → Bacteria | 1681 | Open in IMG/M |
3300005458|Ga0070681_10690055 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
3300005518|Ga0070699_101184443 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
3300005545|Ga0070695_101655176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 535 | Open in IMG/M |
3300005554|Ga0066661_10901744 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300005617|Ga0068859_102794815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 536 | Open in IMG/M |
3300005719|Ga0068861_100049054 | All Organisms → cellular organisms → Bacteria | 3195 | Open in IMG/M |
3300005842|Ga0068858_102198729 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300006058|Ga0075432_10138760 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
3300006953|Ga0074063_10079890 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
3300006954|Ga0079219_10456500 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
3300009094|Ga0111539_11667965 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
3300009176|Ga0105242_10580809 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1079 | Open in IMG/M |
3300010036|Ga0126305_11136909 | Not Available | 538 | Open in IMG/M |
3300010038|Ga0126315_10061370 | All Organisms → cellular organisms → Bacteria | 2071 | Open in IMG/M |
3300010039|Ga0126309_10450310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 782 | Open in IMG/M |
3300010041|Ga0126312_11106777 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300010166|Ga0126306_10118953 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1931 | Open in IMG/M |
3300010321|Ga0134067_10312456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 609 | Open in IMG/M |
3300010373|Ga0134128_10655457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1167 | Open in IMG/M |
3300010397|Ga0134124_11882850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 633 | Open in IMG/M |
3300010401|Ga0134121_11614631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 668 | Open in IMG/M |
3300010863|Ga0124850_1084898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 932 | Open in IMG/M |
3300011992|Ga0120146_1012668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1726 | Open in IMG/M |
3300011992|Ga0120146_1030716 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
3300012207|Ga0137381_11573618 | Not Available | 548 | Open in IMG/M |
3300012212|Ga0150985_110225847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 770 | Open in IMG/M |
3300012482|Ga0157318_1030626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 530 | Open in IMG/M |
3300012501|Ga0157351_1015897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 748 | Open in IMG/M |
3300012502|Ga0157347_1012217 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_58_21 | 923 | Open in IMG/M |
3300012903|Ga0157289_10218115 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
3300012910|Ga0157308_10029863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1293 | Open in IMG/M |
3300012937|Ga0162653_100088780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 512 | Open in IMG/M |
3300012939|Ga0162650_100003295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1754 | Open in IMG/M |
3300012961|Ga0164302_10730036 | Not Available | 738 | Open in IMG/M |
3300012975|Ga0134110_10047331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1694 | Open in IMG/M |
3300013770|Ga0120123_1023560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1252 | Open in IMG/M |
3300014326|Ga0157380_11328771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 767 | Open in IMG/M |
3300014823|Ga0120170_1054126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 891 | Open in IMG/M |
3300014969|Ga0157376_11279191 | Not Available | 763 | Open in IMG/M |
3300015201|Ga0173478_10145014 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
3300015371|Ga0132258_12244750 | All Organisms → cellular organisms → Bacteria | 1370 | Open in IMG/M |
3300017789|Ga0136617_10153688 | All Organisms → cellular organisms → Bacteria | 1963 | Open in IMG/M |
3300018052|Ga0184638_1267194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 585 | Open in IMG/M |
3300018072|Ga0184635_10081458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1270 | Open in IMG/M |
3300018076|Ga0184609_10139718 | Not Available | 1110 | Open in IMG/M |
3300018078|Ga0184612_10506386 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 589 | Open in IMG/M |
3300018081|Ga0184625_10607865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 535 | Open in IMG/M |
3300020202|Ga0196964_10465473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora rhizosphaerae | 615 | Open in IMG/M |
3300021510|Ga0222621_1121089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 557 | Open in IMG/M |
3300022467|Ga0224712_10051428 | Not Available | 1604 | Open in IMG/M |
3300022534|Ga0224452_1240872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 554 | Open in IMG/M |
3300022756|Ga0222622_10373144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 999 | Open in IMG/M |
3300022756|Ga0222622_11238836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 549 | Open in IMG/M |
3300022898|Ga0247745_1051224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 653 | Open in IMG/M |
3300025907|Ga0207645_10130857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1633 | Open in IMG/M |
3300025922|Ga0207646_11222459 | Not Available | 658 | Open in IMG/M |
3300025925|Ga0207650_10272425 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1376 | Open in IMG/M |
3300025929|Ga0207664_10307519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1396 | Open in IMG/M |
3300025934|Ga0207686_10364236 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1092 | Open in IMG/M |
3300025937|Ga0207669_10152723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1620 | Open in IMG/M |
3300026041|Ga0207639_10665214 | Not Available | 964 | Open in IMG/M |
3300026067|Ga0207678_10500973 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1059 | Open in IMG/M |
3300026078|Ga0207702_11518864 | Not Available | 663 | Open in IMG/M |
3300026807|Ga0207547_105856 | Not Available | 552 | Open in IMG/M |
3300027907|Ga0207428_10070649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2744 | Open in IMG/M |
3300027907|Ga0207428_10527147 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
3300028281|Ga0247689_1041807 | Not Available | 637 | Open in IMG/M |
3300028707|Ga0307291_1149914 | Not Available | 594 | Open in IMG/M |
3300028708|Ga0307295_10014042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1918 | Open in IMG/M |
3300028711|Ga0307293_10272239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 537 | Open in IMG/M |
3300028718|Ga0307307_10190312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 648 | Open in IMG/M |
3300028719|Ga0307301_10192015 | Not Available | 662 | Open in IMG/M |
3300028744|Ga0307318_10117241 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
3300028778|Ga0307288_10170338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 828 | Open in IMG/M |
3300028778|Ga0307288_10469662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 518 | Open in IMG/M |
3300028784|Ga0307282_10000792 | All Organisms → cellular organisms → Bacteria | 10547 | Open in IMG/M |
3300028791|Ga0307290_10308549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 579 | Open in IMG/M |
3300028796|Ga0307287_10150675 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
3300028799|Ga0307284_10130116 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
3300028811|Ga0307292_10070128 | All Organisms → cellular organisms → Bacteria | 1340 | Open in IMG/M |
3300028811|Ga0307292_10205909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 809 | Open in IMG/M |
3300028814|Ga0307302_10065300 | All Organisms → cellular organisms → Bacteria | 1707 | Open in IMG/M |
3300028819|Ga0307296_10364134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 790 | Open in IMG/M |
3300028828|Ga0307312_10561459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 754 | Open in IMG/M |
3300028872|Ga0307314_10065687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 938 | Open in IMG/M |
3300028875|Ga0307289_10444548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 533 | Open in IMG/M |
3300028876|Ga0307286_10308834 | Not Available | 585 | Open in IMG/M |
3300028878|Ga0307278_10095794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1335 | Open in IMG/M |
3300028881|Ga0307277_10356207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 652 | Open in IMG/M |
3300030336|Ga0247826_10973758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. Ag109_O5-1 | 673 | Open in IMG/M |
3300031938|Ga0308175_102235845 | Not Available | 613 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 24.07% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 5.56% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.56% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.63% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 4.63% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.70% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 3.70% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.70% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.78% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.78% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.78% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.85% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.85% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 1.85% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.85% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.85% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.85% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.85% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.85% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.93% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.93% |
Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.93% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.93% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.93% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.93% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.93% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.93% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.93% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.93% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.93% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.93% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Arabidopsis Rhizosphere | 0.93% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
3300011992 | Permafrost microbial communities from Nunavut, Canada - A23_65cm_12M | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Host-Associated | Open in IMG/M |
3300012501 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.170610 | Environmental | Open in IMG/M |
3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Host-Associated | Open in IMG/M |
3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
3300012937 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015 | Environmental | Open in IMG/M |
3300012939 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015 | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300013770 | Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014823 | Permafrost microbial communities from Nunavut, Canada - A3_80cm_0M | Environmental | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300020202 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_10 | Environmental | Open in IMG/M |
3300021510 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex | Environmental | Open in IMG/M |
3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300022898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5 | Environmental | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026807 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G09A5-11 (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300028281 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK30 | Environmental | Open in IMG/M |
3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI10214J12806_104323522 | 3300000891 | Soil | RVTVFASGFAHPLALLVDRRGGLLVADWGPGIVYRIHARS* |
C688J35102_1198581801 | 3300002568 | Soil | PKRVTTFASGFDHPLALVVDKSGGLLVSDWGRGVIYRIQSRGG* |
Ga0062593_1029024042 | 3300004114 | Soil | TKFASGFDHPLALAVDRTGGLLVADWGRGVIYRIQSRGG* |
Ga0063455_1006639481 | 3300004153 | Soil | PARVTSFASGFVHPLALLVDHRGGLLVADWGRGVVYRIRPA* |
Ga0062590_1023425241 | 3300004157 | Soil | ELRRDGRARRVVSFASGFEHPLALLIDRRGGLLVADWGNGMVYRIQADGQP* |
Ga0062595_1003255431 | 3300004479 | Soil | QSRVSVFARGFDHPIVVLADPAGGLLVADWGRGTIYRIRAPVS* |
Ga0062595_1004596981 | 3300004479 | Soil | FASGFAHPLALLADRGGGLLVADWGRGIVYRIQARATRRS* |
Ga0062594_1024519722 | 3300005093 | Soil | RIHFGPPRRVTTFARGFDHPLALVVDKSGALLVADWGRGAIYRIRSD* |
Ga0066688_106958891 | 3300005178 | Soil | VSFASGFVHPLALLVDRRGGLLVADWGRGVAYRIQADGRP* |
Ga0070691_106318142 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | VTRFAGGFAHPLALAFDGKGALLVADWERGTIYRIQRRGKP* |
Ga0070668_1006162411 | 3300005347 | Switchgrass Rhizosphere | RVTVFASGFAHPLALLADRGGGLLVADWGRGIVYRIQARATRRS* |
Ga0070688_1003978771 | 3300005365 | Switchgrass Rhizosphere | VTVFASGFAHPLALLADRGGGLLVADWGRGIVYRIQARATRRS* |
Ga0070701_105849932 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | ARHVTTFASGFAHPLALLVDRKGGLLVADWGRGVVYRISQR* |
Ga0070700_1011925752 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | SAFASGFGHPLALLVDPGGGLLVADWGRGVVYRIQARGHS* |
Ga0070662_1001766713 | 3300005457 | Corn Rhizosphere | VRLRPGRRAQVTSFASGFAHPLALLAGRRGGLLVADWGRGVVYRIAPR* |
Ga0070681_106900551 | 3300005458 | Corn Rhizosphere | TARKVSVFASGFAHPLALLPDRAGGLLVADWGRGIVYRIHGS* |
Ga0070699_1011844433 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | ELKKDGTASRVTVFASGFAHPLALLADRGGGLLVADWGRGIVYRIQARATRRS* |
Ga0070695_1016551762 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | RDGRARRVVSFASGFEHPLALLIDRRGGLLVADWGSGIVYRIQADGQP* |
Ga0066661_109017442 | 3300005554 | Soil | LDRAGYARRTSVFATGFDHPLALATDRLGALLVADWGSGTIYRIQARGRR* |
Ga0068859_1027948153 | 3300005617 | Switchgrass Rhizosphere | SGFAHPLALLVDRRGGLLVADWGRGVVYRITPTA* |
Ga0068861_1000490541 | 3300005719 | Switchgrass Rhizosphere | LRPNGTARRVTVFASGFAHPLALLVDRRGGLLVADWGPGIVYRIHVRS* |
Ga0068858_1021987293 | 3300005842 | Switchgrass Rhizosphere | FAHPLALLADRGGGLLVADWGRGIVYRIQARATRRS* |
Ga0075432_101387601 | 3300006058 | Populus Rhizosphere | VSTFATGFDHPIAVTVDQRGALLVADYGRGVVYRIQARGKR* |
Ga0074063_100798902 | 3300006953 | Soil | VTTFARGFDHPLALAVDPKGGLLVADWGTGVIYRIQSRGG* |
Ga0079219_104565001 | 3300006954 | Agricultural Soil | IQLRPNGTARRVSVFASGFAHPLALLADQRGGLLVADWARGVVYRFS* |
Ga0111539_116679653 | 3300009094 | Populus Rhizosphere | VRVHLGPPRRVTTFARGFDHPLALVVDKSGALLVADWGRGAIYGIQSTGR* |
Ga0105242_105808091 | 3300009176 | Miscanthus Rhizosphere | AQSRVSVFARGFDHPIAVLADPAGGLLVADWGRGTIYLIRAPVS* |
Ga0126305_111369092 | 3300010036 | Serpentine Soil | HLGPPRRVTTFARGFDHPLALVVDKSGALLVADWGRGVIYRIQSTGR* |
Ga0126315_100613705 | 3300010038 | Serpentine Soil | EGRPAAVSTFATGFEHPIAVALDPAGGLLVADYGRGVVYRISKR* |
Ga0126309_104503102 | 3300010039 | Serpentine Soil | FAHPLALLVDRRGGLLVADWDRGVVYRIQARGRR* |
Ga0126312_111067771 | 3300010041 | Serpentine Soil | PGAVSTFATGFDHPIAVTVDPLGALLVADYGRGVVYRIQARGKR* |
Ga0126306_101189532 | 3300010166 | Serpentine Soil | VSTFADGFSHPLALLVDRSGGVLVADWGPGVVYRIQARGRP* |
Ga0134067_103124563 | 3300010321 | Grasslands Soil | VPFASGFEHPLALLVDRRGGLLVADWGSGIVYRIQADGRR* |
Ga0134128_106554573 | 3300010373 | Terrestrial Soil | GKASTFARGFDHPLALVVDKTGALLVADWGRGVIYRIQSAGG* |
Ga0126381_1037812461 | 3300010376 | Tropical Forest Soil | KAETFATGFSHPLALAVGPAGDLLVADWSRGVIYAIRKT* |
Ga0134124_118828502 | 3300010397 | Terrestrial Soil | VTSFASGFAHPLALLAGRRGGLLVADWGRGVVYRIAPR* |
Ga0134121_116146311 | 3300010401 | Terrestrial Soil | SVFASGFAHPLALLPDRAGGLLVADWGRGIVYRIHGS* |
Ga0124850_10848981 | 3300010863 | Tropical Forest Soil | RRVTVFASGFAHPLALLVDRRGGLLVADWGPGIVYRIHAGS* |
Ga0120146_10126682 | 3300011992 | Permafrost | VSTFADGFAHPLALLVDRNGGLLVADWGPGVVYRIQASGRA* |
Ga0120146_10307161 | 3300011992 | Permafrost | ATGFDPPLALAVGPSGDLLVADWGRGTIYAIRKP* |
Ga0137381_115736181 | 3300012207 | Vadose Zone Soil | GFDHPLALAVDRRGALLVADWGRGVIYRIQSLGGA* |
Ga0150985_1102258473 | 3300012212 | Avena Fatua Rhizosphere | ATTFASGFSHPLALLVDRRGGLLVADWGRGVVYRISRR* |
Ga0157318_10306261 | 3300012482 | Arabidopsis Rhizosphere | VVRVDLRPNGTARRVTVFASGFAHPLALLVDRSGGLLVADWGP |
Ga0157351_10158972 | 3300012501 | Unplanted Soil | RGRRISSFASGFAHPLALLVDHDGGLLVADWGRGVVYRIQARGRR* |
Ga0157347_10122172 | 3300012502 | Arabidopsis Rhizosphere | RISSFASGFAHPLALLVDHDGGLLVADWGRGVVYRIQARGRR* |
Ga0157289_102181151 | 3300012903 | Soil | KKDETARRVTTFASGFAHPLALLVDRGGGLLVADWGRGLVYRIVPR* |
Ga0157308_100298631 | 3300012910 | Soil | KDGTARRVTTFASGFAHPLALLGDRSGGLLVADWGRGLVYRIVPR* |
Ga0162653_1000887802 | 3300012937 | Soil | NHAETLALRARRDGIASRVTSFASGFAHPLALLVDKRGGLLVADWGRGLVYRIQARGKP* |
Ga0162650_1000032953 | 3300012939 | Soil | VSIFASGFGHPLALLVDPGGGLLVADWGRGVVYRIQARGRS* |
Ga0164302_107300361 | 3300012961 | Soil | TSFASGFAHPLALLAYRAGGLLVADWGRGVVYRISRLAT* |
Ga0134110_100473313 | 3300012975 | Grasslands Soil | FAHPLALLVDRRGVLLVADWGRGVVYRIQAAGFR* |
Ga0120123_10235601 | 3300013770 | Permafrost | VSTFAEGFAHPLALLVDRNGGLLVADWGPGVVYRIQASGRA* |
Ga0157380_113287711 | 3300014326 | Switchgrass Rhizosphere | SGKASTFARGFDHPLALVVDKTGALLVADWGRGVIYRVRKR* |
Ga0120170_10541262 | 3300014823 | Permafrost | RSVSSFAGGFSHPLALAFDPEGALLVADWGRGTIYRIQARDKP* |
Ga0157376_112791911 | 3300014969 | Miscanthus Rhizosphere | LRPNGTARRVSVFASGFAHPLALLADQRGGLLVADWARGVVYRIS* |
Ga0173478_101450141 | 3300015201 | Soil | KFASGFDHPLALAVDRAGGLLVADWGRGVIYRIQSRGG* |
Ga0132258_122447501 | 3300015371 | Arabidopsis Rhizosphere | GFDHPLALVVDPKGGLLVADWGRGVIYRIQSRGG* |
Ga0136617_101536881 | 3300017789 | Polar Desert Sand | TTVFADGFEHPLALAVDRLGGLLVTDFGRGVIYRIQAAGRR |
Ga0184638_12671941 | 3300018052 | Groundwater Sediment | GFDHPLALAVDRLGGLLVGDWGRGLIYRIQAKGKP |
Ga0184635_100814581 | 3300018072 | Groundwater Sediment | ARGFDHPLALVVDPKGGLLVADWGRGVIYRIQSRGG |
Ga0184609_101397181 | 3300018076 | Groundwater Sediment | GRAAAVSTFATGFDHPIAVTVDRLGALLVADYGRGVIYRIQARGNG |
Ga0184612_105063861 | 3300018078 | Groundwater Sediment | TFASGFDHPLALAVDRLGGLLVGDWGRGLIYRIQAKGKP |
Ga0184625_106078652 | 3300018081 | Groundwater Sediment | GPAQVTTFATGFEHPLAVIVDPDGALLVADHGRGVVYRIVKTR |
Ga0196964_104654731 | 3300020202 | Soil | ARPFADGFEHPLAVAVDRQNALLVADWGRGVVYRIQRRGEP |
Ga0222621_11210891 | 3300021510 | Groundwater Sediment | SAFASGFGHPLALLVDPGGGLLVADWGRGVVYRIQARGHS |
Ga0224712_100514282 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | TTFATGIDHPLALAVDPSGGLLVADWGRGAIYEIVRV |
Ga0224452_12408721 | 3300022534 | Groundwater Sediment | VTTFASGFAHPLALLVDRGGGLLVADRGRGVVYRIQA |
Ga0222622_103731441 | 3300022756 | Groundwater Sediment | AGVSTFATGFVHPIAVVADASGGLLVADYGRGVVYRITKK |
Ga0222622_112388361 | 3300022756 | Groundwater Sediment | SFASGFAHPLALLVDKRGGLLVADWGRGVVYRIQARGKP |
Ga0247745_10512243 | 3300022898 | Soil | GPPKRVTTFARGFDHPLALVVDKSGALLVADWGTGVIYRIQSAGG |
Ga0207645_101308571 | 3300025907 | Miscanthus Rhizosphere | TASRVTVFASGFAHPLALLADRGGGLLVADWGRGIVYRIQARATRRS |
Ga0207646_112224592 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | RRGRVTTFATGFDHPLALAVDPSGGLLVADWGRGVIYEIRKR |
Ga0207650_102724253 | 3300025925 | Switchgrass Rhizosphere | FARGFDHPIAVLADPAGGLLVADWGRGTIYRIRPPVS |
Ga0207664_103075191 | 3300025929 | Agricultural Soil | GRGCARRVVSFASGFEHPLALLIDRRGGLLVADWGSGIVYRMQADGHP |
Ga0207686_103642361 | 3300025934 | Miscanthus Rhizosphere | AQSRVSVFARGFDHPIAVLADPAGGLLVADWGRGTIYLIRAPVS |
Ga0207669_101527231 | 3300025937 | Miscanthus Rhizosphere | GFGHPLALLVDPGGGLLVADWGRGVVYRIQARGHS |
Ga0207639_106652141 | 3300026041 | Corn Rhizosphere | SRVTVFASGFAHPLALLADRGGGLLVADWGRGIVYRIQARATRRS |
Ga0207678_105009731 | 3300026067 | Corn Rhizosphere | NGTARKVSVFASGFAHPLALLPDRAGGLLVADWGRGIVYRIHGS |
Ga0207702_115188641 | 3300026078 | Corn Rhizosphere | GGHATTFATGFDHPLALAVGPSRDLLVADWGRGAIYSIAKRP |
Ga0207547_1058562 | 3300026807 | Soil | QPGPPKRVTTFARGFDHPLALVVDKSGALLVADWGTGVIYRIQSAGG |
Ga0207428_100706491 | 3300027907 | Populus Rhizosphere | VVLRPGRPAAVSTFATGFDHPIAVTVDQRGALLVADYGRGVVYRIQARGKR |
Ga0207428_105271473 | 3300027907 | Populus Rhizosphere | TSASGWSKPRRVTTFARGFDHPLALVVDKSGALLVADWGRGAIYGIQSTGR |
Ga0247689_10418071 | 3300028281 | Soil | LRPNGTARRVSVFASGFAHPLALLADQRGGLLVADWGRGAVYRIS |
Ga0307291_11499142 | 3300028707 | Soil | SFASGFAHPLALLVDRRGGLLVADWGRGVVYRIQADGHR |
Ga0307295_100140421 | 3300028708 | Soil | ASNVTTFASGFAHPLALLVDRGGGLLVADWGRGVVYRIQAASRG |
Ga0307293_102722392 | 3300028711 | Soil | SATTFASGFDHPLALAVDRLGGLLVGDWGRGVIYRIQAKGKP |
Ga0307307_101903121 | 3300028718 | Soil | DGTARRVSVFASGFAHPLALLVDHRGGLLVADWGRGTVYRIQARGRR |
Ga0307301_101920152 | 3300028719 | Soil | ARKAVTTFARGFDHPLALVVDPKGGLLVADWGRGVIYRIQSRGG |
Ga0307318_101172412 | 3300028744 | Soil | TTFARGFDHPLALVVDPNGGLLVADWGRGVIYRIQSRGG |
Ga0307288_101703381 | 3300028778 | Soil | AEGFAHPLALLVDRNGGLLVADWGRGVVYRIQARGRT |
Ga0307288_104696622 | 3300028778 | Soil | TTFASGFAHPLALLLDRKGGLLVADWGRGVVYRIQKP |
Ga0307282_1000079214 | 3300028784 | Soil | VTTFARGFDHPLALVVDPNGGLLVADWGRGVIYRIQSRGG |
Ga0307290_103085491 | 3300028791 | Soil | TARRVTVFASGFAHPLALLVDHRGGLLVADWGRGTVYRIQARGRL |
Ga0307287_101506752 | 3300028796 | Soil | TRFASGFDHPLALAVDRSGGLLVADWGRGVIYRIQSRGG |
Ga0307284_101301162 | 3300028799 | Soil | GVTTFARGFDHPLALVVDPNGGLLVADWGRGVIYRIQSRGG |
Ga0307292_100701281 | 3300028811 | Soil | ARVVSFASGFAHPLALLVDRRGGLLVADWGRGVVYRIQADGHR |
Ga0307292_102059092 | 3300028811 | Soil | VTTFADGFAHPLALLVDRDGGLLVADWGRGVVYRIQARGRT |
Ga0307302_100653001 | 3300028814 | Soil | AAGFDHPLALLIDPDGGLLVADWGRGVIYRIQARGKP |
Ga0307296_103641342 | 3300028819 | Soil | RRATVFASGFAHPLALLVDHRGGLLVADWGRGTVYRIQARGRL |
Ga0307312_105614591 | 3300028828 | Soil | LELRPDGTARRVTVFASGFAHPLALLVDHRGGLLVADWGRGTVYRIQARGRR |
Ga0307314_100656872 | 3300028872 | Soil | SFASGFAHPLALLAGLGGGLLVADWGRGVVFRITRN |
Ga0307289_104445482 | 3300028875 | Soil | ARRVSVFASGFAHPLALLVDHRGGLLVADWGRGIVYRIQARGRP |
Ga0307286_103088341 | 3300028876 | Soil | SGKTSTFARGFDHPLALVVDKTGALLVADWGTGVIYRIQSGG |
Ga0307278_100957943 | 3300028878 | Soil | TARRVSVFASGFAHPLALLVDHRGGLLAADWGRGTVYRIQARGRL |
Ga0307277_103562071 | 3300028881 | Soil | DGFAHPLAVLVDRNGGLLVADWGPGVVYRIQARGRP |
Ga0247826_109737583 | 3300030336 | Soil | RVTVFASGFAHPLALLADRGGGLLVADWGRGIVYRIQARATRRS |
Ga0306918_108373222 | 3300031744 | Soil | KADTFATGFSHPLALAVGPAGDLLVADWSRGVIYAIRKG |
Ga0308175_1022358451 | 3300031938 | Soil | VATTFATGFDHPLALTVGPSGDLLVADWGRGAIYAIRRL |
⦗Top⦘ |