Basic Information | |
---|---|
Family ID | F089882 |
Family Type | Metagenome |
Number of Sequences | 108 |
Average Sequence Length | 41 residues |
Representative Sequence | DPQAMRGERTGRRALTPAQGLERGRDGGEVKVMTVTRA |
Number of Associated Samples | 37 |
Number of Associated Scaffolds | 108 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 3.70 % |
% of genes near scaffold ends (potentially truncated) | 86.11 % |
% of genes from short scaffolds (< 2000 bps) | 76.85 % |
Associated GOLD sequencing projects | 34 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.31 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (90.741 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater (39.815 % of family members) |
Environment Ontology (ENVO) | Unclassified (39.815 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Unclassified (50.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 9.09% β-sheet: 9.09% Coil/Unstructured: 81.82% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 108 Family Scaffolds |
---|---|---|
PF13424 | TPR_12 | 1.85 |
PF13639 | zf-RING_2 | 0.93 |
PF00240 | ubiquitin | 0.93 |
PF00664 | ABC_membrane | 0.93 |
PF00075 | RNase_H | 0.93 |
PF07714 | PK_Tyr_Ser-Thr | 0.93 |
PF00211 | Guanylate_cyc | 0.93 |
COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
---|---|---|---|
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.70 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.93 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 90.74 % |
All Organisms | root | All Organisms | 9.26 % |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 39.81% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 20.37% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 15.74% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 12.04% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 6.48% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.78% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.93% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.93% |
Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.93% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002447 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome | Environmental | Open in IMG/M |
3300004126 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (version 2) | Environmental | Open in IMG/M |
3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
3300007561 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3 | Environmental | Open in IMG/M |
3300007585 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-3 | Environmental | Open in IMG/M |
3300007593 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3 | Environmental | Open in IMG/M |
3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
3300008119 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA | Environmental | Open in IMG/M |
3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
3300008258 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-3-NA | Environmental | Open in IMG/M |
3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
3300020537 | Freshwater microbial communities from Lake Mendota, WI - 21SEP2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027836 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes) | Environmental | Open in IMG/M |
3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
3300031786 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
3300034095 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091 | Environmental | Open in IMG/M |
3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
3300034166 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079 | Environmental | Open in IMG/M |
3300034357 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME12May2017-rr0187 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI24768J34885_101541841 | 3300002447 | Freshwater And Sediment | RGERTDDPQTMRGGRTGHYVLTPAQGLERGRDGGEVKVMTVTRA* |
JGI24768J34885_102834862 | 3300002447 | Freshwater And Sediment | MGGERTGRQALTPAQGLERGRDGGEVKIMTVTRAGPKVE* |
JGI24768J34885_103214542 | 3300002447 | Freshwater And Sediment | MRGGSTSRRALTPAQGLERGRDGGEVKVMTVTQAGPYSRVGM |
Ga0066179_102018011 | 3300004126 | Freshwater Lake | MSMLDPQAMRGDRTGRHALTPVQGLERGRDGGEVKVMTVTRA |
Ga0070374_103725592 | 3300005517 | Freshwater Lake | MRGGRTGRYALTPAQGLERGRDGREVKVMTVTRAGPIVE* |
Ga0102914_11653581 | 3300007561 | Estuarine | VKGAGTDDPQAERGERSGRRALTPAQGLERGRDGGEVKIMTVTRA* |
Ga0102916_11862051 | 3300007585 | Estuarine | MRGGSTGSYALTPAQGLERGRDGGEVKVMTVIRA* |
Ga0102918_12094872 | 3300007593 | Estuarine | MRGGRTSHRALKPAQGLERGRDGGEVKVMTVIWAWLIV |
Ga0108970_107828841 | 3300008055 | Estuary | MRGEHTGPFALTPAQGLERGRDGGEVKVMTVIRA* |
Ga0114341_103962381 | 3300008108 | Freshwater, Plankton | MRGGRTSHHALKPAQGLERGRDGGEVKVMTVIRAWPIV |
Ga0114347_12661291 | 3300008114 | Freshwater, Plankton | QAMRGGRTSRRELKLAQGLERGRDGGEVKVMTVIRAGPIVE* |
Ga0114354_10291791 | 3300008119 | Freshwater, Plankton | ERTDDPQTMRGGRTGRYALTPAQGLERGRDGGEVKVMTVTRA* |
Ga0114354_10872633 | 3300008119 | Freshwater, Plankton | ERTDDPQTMRGGRTGRYALTPAQGLERGRDGGEVKVMTFTRA* |
Ga0114355_11309861 | 3300008120 | Freshwater, Plankton | DGSQIRRSERTSHRTLNPAQGLERGRDEGEVKVMTYIRA* |
Ga0114840_10253491 | 3300008258 | Freshwater, Plankton | KGEGTDDPQAMRGDRTGRHALTPDQGLERGRDGGEVKVMTVTRA* |
Ga0114840_10457172 | 3300008258 | Freshwater, Plankton | GERTDDPQAMRGERTGRRALTPAQGLERGRDGGEVKVMTVTRA* |
Ga0114841_10111664 | 3300008259 | Freshwater, Plankton | MRGGCTSHRALKPAQGLERGRDGGEVKVMTVIWAWLIVE* |
Ga0114841_10175511 | 3300008259 | Freshwater, Plankton | MRSGSNGSYALTPAQGLERGRDGGEVKVMTVTRA* |
Ga0114841_10187153 | 3300008259 | Freshwater, Plankton | MRGGRTSRRELKLAQGLERGRDGGEVKVMTVIRAGPIVE* |
Ga0114841_10198877 | 3300008259 | Freshwater, Plankton | MRGGRTSHRALKPAQGLERGRDGGEVKVMTVIRAGPIVE* |
Ga0114841_10308811 | 3300008259 | Freshwater, Plankton | DPQSMRGERTGRRALTPAQGLERGRDGGEVKVMTVTRA* |
Ga0114841_103967912 | 3300008259 | Freshwater, Plankton | KGERTDDPQAMRGDRTGRRALTPAQGLERGRDGGEVKVMTVTRE* |
Ga0114841_10431863 | 3300008259 | Freshwater, Plankton | KGERTDDPQAMRGDRTGRRALTPAQGLERGRDGGEVKVMTVIRA* |
Ga0114841_10437283 | 3300008259 | Freshwater, Plankton | MRGGRTSLRALKPAQGLERGRDGGEVKVITVIRVGPIVE* |
Ga0114841_10565061 | 3300008259 | Freshwater, Plankton | DPQAMRGERTGRRALTPAQGLERGRDGGEVKVMTVTRARPIVE* |
Ga0114841_11132591 | 3300008259 | Freshwater, Plankton | PQAMRGERTGRRALTPAQGLERGRDGGEVKVMTVTRAGPIIE* |
Ga0114841_11550051 | 3300008259 | Freshwater, Plankton | DPQTMRGGRTGRYALTPAQGLERGRDGGEVKVMTVTRASMIYSRGNM* |
Ga0114841_11855412 | 3300008259 | Freshwater, Plankton | KGERTDDPQAMRGERTGRRALTPAQGLERGRDGGEVKVMTVTRA* |
Ga0114841_12525162 | 3300008259 | Freshwater, Plankton | ERTDDPQAMRGERTGRRALTPAQGLERGRDGGEVKVMRVTRA* |
Ga0114841_12710441 | 3300008259 | Freshwater, Plankton | PQAMRGERTGRRALTPAQGLERGRDGGEVKVMAVIRA* |
Ga0114841_12731141 | 3300008259 | Freshwater, Plankton | GTDDPQAERGERTGRRALTPAQGLERGRDGGEVKVMTVTRA* |
Ga0164293_106127831 | 3300013004 | Freshwater | AERGERTGRRALTPAQGLERGRDGGEVKIMTVTRA* |
(restricted) Ga0172376_103053012 | 3300014720 | Freshwater | GAGTDDPHAERGERTGRCALTTAQGLERGRDGGEVKIMTITRA* |
Ga0169931_108807782 | 3300017788 | Freshwater | GTDDPQAERGERTGRRALTPAQGLERGRDGGEVKIMTVTRT |
Ga0211736_105587211 | 3300020151 | Freshwater | TKGERTDDPQTMRSGRTGHRTLKPAQGLERGRDEGEVKVMTYIRA |
Ga0208722_10274171 | 3300020537 | Freshwater | PQAERGERTSCHALTPAQGLERGRDGGEVKVMTVTRA |
Ga0209552_10822701 | 3300027563 | Freshwater Lake | MRGGRTSHRALKPAQGLERGRDGGEVKVMTVIWAWLIVELL |
Ga0209769_10220541 | 3300027679 | Freshwater Lake | AMRGDRTGRHALTPVQGLERGRDGGEVKVMTVTRA |
Ga0209769_12705931 | 3300027679 | Freshwater Lake | NLGKGERTDDPQTMRGGRTSRRALTPAQGLERGRDGGEVKVMTVTRTGPIVE |
Ga0209444_100890861 | 3300027756 | Freshwater Lake | QTMRGGRTGRYALTPAQGLERGRDGGEVKVMTVTRA |
Ga0209230_101269761 | 3300027836 | Freshwater And Sediment | DDPQAERGECTGRRALTPAQGLERGRDGGEVKVMTVTRA |
Ga0209230_101759861 | 3300027836 | Freshwater And Sediment | ERTDDPQTMRGGRNSRRALKPAQGLERGRDGGEVKVMTVTRAGPIVE |
Ga0209230_102762242 | 3300027836 | Freshwater And Sediment | DPQAMRGERTGRRALTPAQGLERGRDGGEVKVMTVTRA |
Ga0209230_102937782 | 3300027836 | Freshwater And Sediment | DPQAERGERTGRCALTPAQGLERGRDGGEVKVMTVTRAGPIVE |
Ga0209230_103168181 | 3300027836 | Freshwater And Sediment | AMRGGRTSRRALTPAQGLERGRDGGEVKVMTVTRAGPIVE |
Ga0209230_103260383 | 3300027836 | Freshwater And Sediment | DPRTMRSGSNGSYALTPAQGQERGRDGGEVKVMTVKRA |
Ga0209230_103868991 | 3300027836 | Freshwater And Sediment | KGERTDDPQTMRGGRTSHRALKPAQGLERGRDGGEVRVMTVICAWLIVE |
Ga0209230_104243182 | 3300027836 | Freshwater And Sediment | DDPQTMRGGRTGHYVLTPAQGLERGRDGGEVKVMTVTRA |
Ga0209230_104983301 | 3300027836 | Freshwater And Sediment | TDDPQSERGERTSCHALTPAQGLERGRDGGEVKVMTVTRA |
Ga0209230_105351231 | 3300027836 | Freshwater And Sediment | PRAMRGERTSRSALTAAQGLERGRDGGEVKAMTVTRAGPIAE |
Ga0209230_105435041 | 3300027836 | Freshwater And Sediment | EGTDDPQATRGERTGRRALTPAQGLERGRDGGEVKVMTVTRAFKFS |
Ga0209230_105551741 | 3300027836 | Freshwater And Sediment | MRGGRTSRRELKLAQGLERGRDGGEVKVMTVIRAGAIV |
Ga0209230_107626602 | 3300027836 | Freshwater And Sediment | KGEGTDDPQAERGERTGRRALTPAQGLERGRDGGEVKVMTVARA |
Ga0209230_107875191 | 3300027836 | Freshwater And Sediment | RRTDDPQTMRGGSTGSYALTPAQGLERGRDGGEVKVMTVIRA |
Ga0209550_104579511 | 3300027892 | Freshwater Lake | HSLSERTDDPQTMRSGRTGHRTLKPAQGLERGRDGGEVKVMVVIRA |
Ga0315907_102514261 | 3300031758 | Freshwater | QSMRGERTGRRALTPAQGLERGRDGGEVKVMTVTRA |
Ga0315907_112582931 | 3300031758 | Freshwater | MRGGRTSHRALKPAQGLERGRDGGEVKFMTVIRAWPI |
Ga0315899_100311241 | 3300031784 | Freshwater | VKGERTDDPQAMRGERTGRRALTPAQGLERGRDGGEVKVMTVTRA |
Ga0315899_100359535 | 3300031784 | Freshwater | MGDRTDDPQTMRSGRTGHRTLKPAQGLERGRDGGEVKVMVVIRA |
Ga0315899_100567075 | 3300031784 | Freshwater | ERGERTSRHALTPAQGLERGRDGGEVKVMTVTRDPGVPVLH |
Ga0315899_100591061 | 3300031784 | Freshwater | LGKGERTDDPQAMRGERTGRRALTPAQGLERGRDGGEVKVMTVTRAGPIVE |
Ga0315899_100819176 | 3300031784 | Freshwater | MRGGCTSHRALKPAQGLERGRDGGEVKVMTVIWAWLIVE |
Ga0315899_101183081 | 3300031784 | Freshwater | MRGGRTSRRALKPAQGLERGRDGGEVKVMTVTRAGPITHGFFFWASIDLI |
Ga0315899_101190734 | 3300031784 | Freshwater | ERTDDPQAMRGERTGRRALTPAQGLERGRDGGEVKVMTVTRARPTVE |
Ga0315899_101355931 | 3300031784 | Freshwater | ERTDDPQTMRSGSNGSYALTPAQGLERGRDGGEVKVMTVTRA |
Ga0315899_101433505 | 3300031784 | Freshwater | GTDDPQAERGERTGRRALTPAQGLERGRDGGEVKVMTVARA |
Ga0315899_101708741 | 3300031784 | Freshwater | VRGERTDDPQTMRSGSNGSHALTLPRVWRGRDGGEVKVMTVTRA |
Ga0315899_101982402 | 3300031784 | Freshwater | MRGGRTSLRALKPAQGLERGRDGGEVKVITVIRVGPIVE |
Ga0315899_103773432 | 3300031784 | Freshwater | MRGELTGRRALKAAQGLERGRNGGEVKVMTVTRAGPIVE |
Ga0315899_105320512 | 3300031784 | Freshwater | RTDDPQAMRGERTGRCALTPAQGLERGRDGGEVKVMTVTRA |
Ga0315899_107261501 | 3300031784 | Freshwater | RTDDPQAMRGERTGRRALTPAQGLERGRDGGEVKVMTVTRAGPIIE |
Ga0315899_108459031 | 3300031784 | Freshwater | TDDPQTMRGGSTGSYALTPAQGLERGREGGEVTVMTVIRA |
Ga0315899_114671671 | 3300031784 | Freshwater | TDDPQVMRGECTGRRALTPVQGLERGRDGGEVKVMTVIRV |
Ga0315899_117594851 | 3300031784 | Freshwater | DPQAERGERTSRRALTPAQGLERGRDGGEVKVMTVTRA |
Ga0315908_100686773 | 3300031786 | Freshwater | MRGGRTSRRELKLAQGLERGRDGGEVKVMTVIRAGPIVE |
Ga0315908_101851731 | 3300031786 | Freshwater | TDDPQAERGERTGRRALTPAQGLERGRDGGEVKIMTVTRA |
Ga0315908_102130331 | 3300031786 | Freshwater | DDPQAERGERTGRCALTPAQGLERGRDGGEVKVMTVTRAGPIVE |
Ga0315908_102229584 | 3300031786 | Freshwater | ERTDDPQTMRGERTGRCALTPAQGLERGRDGGEVKAMTVTRA |
Ga0315908_115688802 | 3300031786 | Freshwater | VKGEGTDDPQAERGERTGRRALTPAQGLERGRDGGEVKVMTVARA |
Ga0315900_110762841 | 3300031787 | Freshwater | DPQTMRGGSTGSYALTPAQGLERGRDGGEVKVMTVIRA |
Ga0315900_110942151 | 3300031787 | Freshwater | TDDPQSMRGGRTSRRALKPAQGLERGRDGGEVKIMTVTRAGPIVA |
Ga0315909_101498963 | 3300031857 | Freshwater | ERTVDPQTMRGGRTSHRALKHAQGLERGRDGGEVKIMAVIWA |
Ga0315906_109320381 | 3300032050 | Freshwater | RTDDPQTMRGGCTGRYALTPAQGLERGRDGGEVKVMTVIRA |
Ga0315906_111556381 | 3300032050 | Freshwater | GRGEHTGLRALTPAQGLERGRDGGEVKVMTVTRSGPIVE |
Ga0315905_100432671 | 3300032092 | Freshwater | EGTDDPQAERGERTGRRALTPAQGLERGRDGGEVKVMTVARA |
Ga0315905_100558455 | 3300032092 | Freshwater | TDDPQAERGERTGRRALTPAQGLERGRDGGEVKVMTVTRA |
Ga0315905_100716751 | 3300032092 | Freshwater | DDPQAMRGERTGCRALTPAQGLERGRDGGEVKVMTVTRA |
Ga0315905_102221553 | 3300032092 | Freshwater | RTDDPQAMRGESTSCRALTPAQGLERGRDGGEVKVMTVTRA |
Ga0315905_102682323 | 3300032092 | Freshwater | MRGEDHHKGERTDNPQAMRGERTSLRALTPAQGLERGRDGGEVKVMTVTRSGPIVE |
Ga0315905_102850901 | 3300032092 | Freshwater | CIQKTLRRLGKDERTGGPEVRRSGCTSHRTLNPAQGLERGRRGGEVKVMTCIWA |
Ga0315905_103955981 | 3300032092 | Freshwater | TDDPQTMRGGRNSRRALKPAQGLERGRDGGEVKVMTVTRAGPIVE |
Ga0315905_105087421 | 3300032092 | Freshwater | KGERTDDPQAMRGERKGWRALTPAQGLERGRDGGEVKVMTVTRA |
Ga0315905_106006591 | 3300032092 | Freshwater | PQAERVERTGRRALTPAQGLERGRDGGEVKVMRVTRA |
Ga0315905_110957332 | 3300032092 | Freshwater | TDDPQTMRGGRTGRYALTPAQGLERGRDGGEVKVMTVTRASMIYSRGNM |
Ga0315905_113750391 | 3300032092 | Freshwater | ERTDDPQTMRGERTGRYALTPAQGLERGRDGGEVKVMTVTRA |
Ga0315903_102418493 | 3300032116 | Freshwater | DPETERGERTGRRALTPAQGLERGRDGGEEKVMTVTRT |
Ga0315903_103735071 | 3300032116 | Freshwater | MIGDPQAEGGGRTSCHALTPAQGLERGRDGGEEKV |
Ga0315903_108827951 | 3300032116 | Freshwater | DPQTMRGGRTGRYALTPAQGLERGRDGGEVKVMTVTRA |
Ga0335019_0719999_463_570 | 3300034066 | Freshwater | MSMLDPQAMRGERTGRHALTPVQGLERGRDGGEVKV |
Ga0335019_0757034_440_550 | 3300034066 | Freshwater | MRGGRTSRRALTPAQGLERGRDGGEVKVMTVTRAGPI |
Ga0335022_0283306_1_132 | 3300034095 | Freshwater | KGESTDDPQAMRGERTGRRALTPAQGLERGRDGGEVKVVTGTE |
Ga0335022_0398994_3_116 | 3300034095 | Freshwater | PQAMRGERTGRRALKPAQGLERDRDGGEVKVMTVTRA |
Ga0335030_0895604_403_510 | 3300034103 | Freshwater | MRGGRTSRRALKPAQGLERGRDGGEVKVMTVTRAGP |
Ga0335058_0676585_2_118 | 3300034121 | Freshwater | MRGGRTSRRALKPAQGLERGRDGGEVKVMTVTRAGPIVE |
Ga0335058_0811343_400_507 | 3300034121 | Freshwater | TMRGGRTGRYALTPAQGLERGRDGGEVKVMTVTRA |
Ga0335016_0507013_3_125 | 3300034166 | Freshwater | MRGGRTSRSALKPAQGLERGRDGGEVKVMTVTRAGPITHGF |
Ga0335064_0166779_1241_1372 | 3300034357 | Freshwater | GERTDDPQTMRGGSTGSYALTPAQGLERGRDGGEVKVMTVIRA |
Ga0335064_0718624_509_616 | 3300034357 | Freshwater | AMRGERTGRRALKPAQGLERDRDGGEVKVMTVTRA |
⦗Top⦘ |