Basic Information | |
---|---|
Family ID | F089822 |
Family Type | Metagenome |
Number of Sequences | 108 |
Average Sequence Length | 42 residues |
Representative Sequence | MVKDINKIIRVYDEERNGDEIFFDVYELILTKLDSESLVKET |
Number of Associated Samples | 72 |
Number of Associated Scaffolds | 108 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 18.52 % |
% of genes near scaffold ends (potentially truncated) | 16.67 % |
% of genes from short scaffolds (< 2000 bps) | 72.22 % |
Associated GOLD sequencing projects | 66 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.30 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (50.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh (16.667 % of family members) |
Environment Ontology (ENVO) | Unclassified (26.852 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Unclassified (32.407 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.57% β-sheet: 0.00% Coil/Unstructured: 61.43% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 108 Family Scaffolds |
---|---|---|
PF00239 | Resolvase | 39.81 |
PF07508 | Recombinase | 19.44 |
PF13408 | Zn_ribbon_recom | 1.85 |
PF13443 | HTH_26 | 0.93 |
PF12833 | HTH_18 | 0.93 |
PF13367 | PrsW-protease | 0.93 |
PF08241 | Methyltransf_11 | 0.93 |
PF13683 | rve_3 | 0.93 |
PF04909 | Amidohydro_2 | 0.93 |
PF00076 | RRM_1 | 0.93 |
PF13551 | HTH_29 | 0.93 |
PF00528 | BPD_transp_1 | 0.93 |
PF02780 | Transketolase_C | 0.93 |
PF00005 | ABC_tran | 0.93 |
PF00589 | Phage_integrase | 0.93 |
PF01048 | PNP_UDP_1 | 0.93 |
PF01842 | ACT | 0.93 |
PF00596 | Aldolase_II | 0.93 |
PF08531 | Bac_rhamnosid_N | 0.93 |
PF00072 | Response_reg | 0.93 |
COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
---|---|---|---|
COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 59.26 |
COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 39.81 |
COG0775 | Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnB | Nucleotide transport and metabolism [F] | 0.93 |
COG0813 | Purine-nucleoside phosphorylase | Nucleotide transport and metabolism [F] | 0.93 |
COG2820 | Uridine phosphorylase | Nucleotide transport and metabolism [F] | 0.93 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 50.93 % |
Unclassified | root | N/A | 49.07 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2124908028|beta3_all_NODE_107988_len_823_cov_6_058323 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 873 | Open in IMG/M |
2124908038|B3_all_c_ConsensusfromContig71675 | All Organisms → cellular organisms → Bacteria | 6536 | Open in IMG/M |
3300001335|ML8_10001223 | All Organisms → cellular organisms → Bacteria | 24438 | Open in IMG/M |
3300001335|ML8_10001628 | All Organisms → cellular organisms → Bacteria | 18241 | Open in IMG/M |
3300001335|ML8_10024036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → unclassified Clostridia → Clostridia bacterium | 3862 | Open in IMG/M |
3300001335|ML8_10060177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1726 | Open in IMG/M |
3300001335|ML8_10102498 | Not Available | 913 | Open in IMG/M |
3300001335|ML8_10200885 | Not Available | 546 | Open in IMG/M |
3300004149|Ga0066632_10224569 | Not Available | 586 | Open in IMG/M |
3300004212|Ga0066631_10161098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → unclassified Clostridia → Clostridia bacterium | 1041 | Open in IMG/M |
3300005077|Ga0071116_1060352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → unclassified Clostridia → Clostridia bacterium | 2265 | Open in IMG/M |
3300005254|Ga0068714_10061819 | All Organisms → cellular organisms → Bacteria | 2041 | Open in IMG/M |
3300005613|Ga0074649_1020118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → unclassified Clostridia → Clostridia bacterium | 3842 | Open in IMG/M |
3300005645|Ga0077109_1014958 | All Organisms → cellular organisms → Bacteria | 3383 | Open in IMG/M |
3300005645|Ga0077109_1026295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → unclassified Clostridia → Clostridia bacterium | 2277 | Open in IMG/M |
3300005645|Ga0077109_1059568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → unclassified Clostridia → Clostridia bacterium | 1198 | Open in IMG/M |
3300005645|Ga0077109_1067741 | Not Available | 1078 | Open in IMG/M |
3300005947|Ga0066794_10130307 | Not Available | 755 | Open in IMG/M |
3300008516|Ga0111033_1143319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → unclassified Clostridia → Clostridia bacterium | 1461 | Open in IMG/M |
3300009127|Ga0118724_1072679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → unclassified Clostridia → Clostridia bacterium | 2220 | Open in IMG/M |
3300009149|Ga0114918_10189641 | Not Available | 1200 | Open in IMG/M |
3300009149|Ga0114918_10204792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → unclassified Clostridia → Clostridia bacterium | 1144 | Open in IMG/M |
3300009149|Ga0114918_10331010 | Not Available | 844 | Open in IMG/M |
3300009320|Ga0117909_1156162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → unclassified Clostridia → Clostridia bacterium | 2041 | Open in IMG/M |
3300009499|Ga0114930_10362194 | Not Available | 679 | Open in IMG/M |
3300009529|Ga0114919_10970573 | Not Available | 572 | Open in IMG/M |
3300010319|Ga0136653_10055229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → unclassified Clostridia → Clostridia bacterium | 1984 | Open in IMG/M |
3300011118|Ga0114922_10615427 | Not Available | 894 | Open in IMG/M |
3300011118|Ga0114922_10879051 | Not Available | 730 | Open in IMG/M |
3300011118|Ga0114922_11261197 | Not Available | 597 | Open in IMG/M |
3300013090|Ga0163209_1000685 | All Organisms → cellular organisms → Bacteria | 14868 | Open in IMG/M |
3300013090|Ga0163209_1087611 | Not Available | 1073 | Open in IMG/M |
3300013091|Ga0163210_1090662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → unclassified Clostridia → Clostridia bacterium | 1105 | Open in IMG/M |
3300013091|Ga0163210_1098525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → unclassified Clostridia → Clostridia bacterium | 1054 | Open in IMG/M |
3300013091|Ga0163210_1147775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → unclassified Clostridia → Clostridia bacterium | 837 | Open in IMG/M |
(restricted) 3300013127|Ga0172365_10589449 | Not Available | 636 | Open in IMG/M |
(restricted) 3300013129|Ga0172364_10491868 | Not Available | 777 | Open in IMG/M |
(restricted) 3300013129|Ga0172364_10875194 | Not Available | 551 | Open in IMG/M |
(restricted) 3300013130|Ga0172363_10406678 | Not Available | 882 | Open in IMG/M |
(restricted) 3300013130|Ga0172363_10828564 | Not Available | 575 | Open in IMG/M |
(restricted) 3300013133|Ga0172362_10714044 | Not Available | 672 | Open in IMG/M |
(restricted) 3300013133|Ga0172362_10934686 | Not Available | 573 | Open in IMG/M |
(restricted) 3300013136|Ga0172370_10300251 | Not Available | 929 | Open in IMG/M |
(restricted) 3300013138|Ga0172371_10164350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → unclassified Clostridia → Clostridia bacterium | 1936 | Open in IMG/M |
(restricted) 3300013138|Ga0172371_10221234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → unclassified Clostridia → Clostridia bacterium | 1574 | Open in IMG/M |
3300014490|Ga0182010_10074405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia | 1662 | Open in IMG/M |
3300014494|Ga0182017_10088308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → unclassified Clostridia → Clostridia bacterium | 2037 | Open in IMG/M |
3300014494|Ga0182017_10824317 | Not Available | 559 | Open in IMG/M |
3300017989|Ga0180432_10008874 | All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon | 12386 | Open in IMG/M |
3300017990|Ga0180436_10394864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → unclassified Clostridia → Clostridia bacterium | 1016 | Open in IMG/M |
3300020074|Ga0194113_10894362 | Not Available | 600 | Open in IMG/M |
3300020074|Ga0194113_11070257 | Not Available | 534 | Open in IMG/M |
3300020083|Ga0194111_10116754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → unclassified Clostridia → Clostridia bacterium | 2103 | Open in IMG/M |
3300020084|Ga0194110_10134610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → unclassified Clostridia → Clostridia bacterium | 1971 | Open in IMG/M |
3300020084|Ga0194110_10800051 | Not Available | 571 | Open in IMG/M |
3300022556|Ga0212121_10001138 | All Organisms → cellular organisms → Bacteria | 29337 | Open in IMG/M |
3300022556|Ga0212121_10100806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → unclassified Clostridia → Clostridia bacterium | 2198 | Open in IMG/M |
3300022556|Ga0212121_10301189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → unclassified Clostridia → Clostridia bacterium | 1083 | Open in IMG/M |
3300022556|Ga0212121_10435432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → unclassified Clostridia → Clostridia bacterium | 852 | Open in IMG/M |
(restricted) 3300024054|Ga0233425_10002745 | All Organisms → cellular organisms → Bacteria | 33795 | Open in IMG/M |
3300024262|Ga0210003_1004238 | All Organisms → cellular organisms → Bacteria | 11416 | Open in IMG/M |
3300024262|Ga0210003_1109190 | Not Available | 1244 | Open in IMG/M |
3300024353|Ga0209979_1200454 | Not Available | 701 | Open in IMG/M |
3300025036|Ga0210049_1336619 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 560 | Open in IMG/M |
3300025279|Ga0208047_1100442 | Not Available | 729 | Open in IMG/M |
3300025314|Ga0209323_10116550 | Not Available | 1801 | Open in IMG/M |
3300025807|Ga0208828_1000871 | All Organisms → cellular organisms → Bacteria | 12639 | Open in IMG/M |
3300025868|Ga0210051_1134107 | Not Available | 1266 | Open in IMG/M |
3300027690|Ga0209164_1047316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → unclassified Clostridia → Clostridia bacterium | 2043 | Open in IMG/M |
3300028162|Ga0268278_1044982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → unclassified Clostridia → Clostridia bacterium | 1154 | Open in IMG/M |
3300028193|Ga0265594_1265363 | Not Available | 524 | Open in IMG/M |
3300028298|Ga0268280_1071251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → unclassified Clostridia → Clostridia bacterium | 969 | Open in IMG/M |
3300028299|Ga0268276_1066697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → unclassified Clostridia → Clostridia bacterium | 1290 | Open in IMG/M |
(restricted) 3300029268|Ga0247842_10495853 | Not Available | 622 | Open in IMG/M |
(restricted) 3300029286|Ga0247841_10390393 | Not Available | 921 | Open in IMG/M |
3300031255|Ga0315554_1029946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → unclassified Clostridia → Clostridia bacterium | 2344 | Open in IMG/M |
3300031255|Ga0315554_1203655 | Not Available | 657 | Open in IMG/M |
3300031257|Ga0315555_1046163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → unclassified Clostridia → Clostridia bacterium | 2276 | Open in IMG/M |
3300031275|Ga0307437_1004040 | Not Available | 8185 | Open in IMG/M |
3300031278|Ga0307431_1005223 | All Organisms → cellular organisms → Bacteria | 5801 | Open in IMG/M |
3300031278|Ga0307431_1013993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 3016 | Open in IMG/M |
3300031278|Ga0307431_1023905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → unclassified Clostridia → Clostridia bacterium | 2051 | Open in IMG/M |
3300031278|Ga0307431_1047300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → unclassified Clostridia → Clostridia bacterium | 1266 | Open in IMG/M |
3300031278|Ga0307431_1084599 | Not Available | 839 | Open in IMG/M |
3300031278|Ga0307431_1126751 | Not Available | 629 | Open in IMG/M |
3300031331|Ga0307432_1043622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → unclassified Clostridia → Clostridia bacterium | 1467 | Open in IMG/M |
3300031331|Ga0307432_1138345 | Not Available | 630 | Open in IMG/M |
3300031337|Ga0307430_1082883 | Not Available | 941 | Open in IMG/M |
3300031351|Ga0307427_1000035 | All Organisms → cellular organisms → Bacteria | 133008 | Open in IMG/M |
3300031355|Ga0307421_1166269 | Not Available | 672 | Open in IMG/M |
3300031355|Ga0307421_1224307 | Not Available | 553 | Open in IMG/M |
3300031357|Ga0307435_1026828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → unclassified Clostridia → Clostridia bacterium | 1598 | Open in IMG/M |
3300031365|Ga0307443_1146760 | Not Available | 605 | Open in IMG/M |
3300031368|Ga0307429_1093873 | Not Available | 855 | Open in IMG/M |
3300031369|Ga0307422_1084627 | Not Available | 980 | Open in IMG/M |
3300031369|Ga0307422_1219501 | Not Available | 502 | Open in IMG/M |
3300031539|Ga0307380_10027805 | All Organisms → cellular organisms → Bacteria | 6601 | Open in IMG/M |
3300031539|Ga0307380_10216514 | Not Available | 1836 | Open in IMG/M |
3300031553|Ga0315547_1000009 | All Organisms → cellular organisms → Bacteria | 322358 | Open in IMG/M |
3300031554|Ga0315544_1194073 | Not Available | 551 | Open in IMG/M |
3300031586|Ga0315541_1060721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → unclassified Clostridia → Clostridia bacterium | 1432 | Open in IMG/M |
3300031624|Ga0315545_1159432 | Not Available | 912 | Open in IMG/M |
3300031651|Ga0315543_1152377 | Not Available | 665 | Open in IMG/M |
3300031654|Ga0315549_1160259 | Not Available | 934 | Open in IMG/M |
3300031952|Ga0315294_11019173 | Not Available | 689 | Open in IMG/M |
3300032020|Ga0315296_10452064 | Not Available | 688 | Open in IMG/M |
3300032029|Ga0315546_1061917 | Not Available | 1026 | Open in IMG/M |
3300032156|Ga0315295_10415323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → unclassified Clostridia → Clostridia bacterium | 1369 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 16.67% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 12.04% |
Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 10.19% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 9.26% |
Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 9.26% |
Wetlands Benthic | Environmental → Aquatic → Marine → Wetlands → Unclassified → Wetlands Benthic | 5.56% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.63% |
Anoxic Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water | 4.63% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 3.70% |
Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 3.70% |
Brackish Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Brackish Water | 3.70% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 2.78% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.85% |
Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 1.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 1.85% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.85% |
Enrichment Culture | Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Enrichment Culture | 1.85% |
Sinkhole | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Sinkhole | 0.93% |
Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 0.93% |
Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 0.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.93% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908028 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3 | Environmental | Open in IMG/M |
2124908038 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3 | Environmental | Open in IMG/M |
3300001335 | Wetlands benthic microbial communities from British Columbia, Canada - ML8 | Environmental | Open in IMG/M |
3300004149 | Groundwater microbial communities from aquifer - Crystal Geyser CG03_land_8/20/14_0.80 | Environmental | Open in IMG/M |
3300004212 | Groundwater microbial communities from aquifer - Crystal Geyser CG02_land_8/20/14_3.00 | Environmental | Open in IMG/M |
3300005077 | Water filled karst sinkhole microbial communities from Little Salt Spring, North Port, Florida - Phototrophic mat 2014 | Environmental | Open in IMG/M |
3300005254 | Enrichment culture microbial communities from rom New York Harbor, USA that are MTBE-degrading - MTBE-NYH (New York Harbor Sulfidogenic) MetaG | Engineered | Open in IMG/M |
3300005613 | Saline sediment microbial communities from Etoliko Lagoon, Greece - sediment | Environmental | Open in IMG/M |
3300005645 | Brackish water microbial communities from Lake Sakinaw in Canada: eDNA_2 (120m) | Environmental | Open in IMG/M |
3300005947 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 | Environmental | Open in IMG/M |
3300008516 | Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 125 cmbsf. Combined Assembly of MM3PM3 | Environmental | Open in IMG/M |
3300009127 | Combined Assembly of Gp0137036, Gp0137038 | Environmental | Open in IMG/M |
3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
3300009320 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 900m, 250-2.7um, replicate b | Environmental | Open in IMG/M |
3300009499 | Deep subsurface microbial communities from Anholt, Denmark to uncover new lineages of life (NeLLi) - Anholt_01485 metaG | Environmental | Open in IMG/M |
3300009529 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG | Environmental | Open in IMG/M |
3300010319 | Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 275m metaG | Environmental | Open in IMG/M |
3300011118 | Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaG | Environmental | Open in IMG/M |
3300013090 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_160m | Environmental | Open in IMG/M |
3300013091 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_220m | Environmental | Open in IMG/M |
3300013127 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cm | Environmental | Open in IMG/M |
3300013129 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 10cm | Environmental | Open in IMG/M |
3300013130 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s2_kivu2a2 | Environmental | Open in IMG/M |
3300013133 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s1_kivu2a2 | Environmental | Open in IMG/M |
3300013136 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11.5m | Environmental | Open in IMG/M |
3300013138 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_12m | Environmental | Open in IMG/M |
3300014490 | Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG | Environmental | Open in IMG/M |
3300014494 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaG | Environmental | Open in IMG/M |
3300017989 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_MS_2 metaG | Environmental | Open in IMG/M |
3300017990 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_S_2 metaG | Environmental | Open in IMG/M |
3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
3300020083 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300m | Environmental | Open in IMG/M |
3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
3300022556 | Kivu_combined assembly | Environmental | Open in IMG/M |
3300024054 (restricted) | Freshwater microbial communities from Lake Towuti, South Sulawesi, Indonesia - Watercolumn_Towuti2014_140_MG | Environmental | Open in IMG/M |
3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
3300024353 | Deep subsurface microbial communities from Anholt, Denmark to uncover new lineages of life (NeLLi) - Anholt_01485 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025036 | Groundwater microbial communities from aquifer - Crystal Geyser CG06_land_8/20/14_3.00 (SPAdes) | Environmental | Open in IMG/M |
3300025279 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_220m (SPAdes) | Environmental | Open in IMG/M |
3300025314 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 2 | Environmental | Open in IMG/M |
3300025807 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_160m (SPAdes) | Environmental | Open in IMG/M |
3300025868 | Groundwater microbial communities from aquifer - Crystal Geyser CG23_combo_of_CG06-09_8/20/14_all (SPAdes) | Environmental | Open in IMG/M |
3300027690 | Enrichment culture microbial communities from rom New York Harbor, USA that are MTBE-degrading - MTBE-NYH (New York Harbor Sulfidogenic) MetaG (SPAdes) | Engineered | Open in IMG/M |
3300028162 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2010_1_5_55m | Environmental | Open in IMG/M |
3300028193 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_80m | Environmental | Open in IMG/M |
3300028298 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_40m | Environmental | Open in IMG/M |
3300028299 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2010_1_5_45m | Environmental | Open in IMG/M |
3300029268 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_19m | Environmental | Open in IMG/M |
3300029286 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_18m | Environmental | Open in IMG/M |
3300031255 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1603-70 | Environmental | Open in IMG/M |
3300031257 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1603-80 | Environmental | Open in IMG/M |
3300031275 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-90 | Environmental | Open in IMG/M |
3300031278 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-170 | Environmental | Open in IMG/M |
3300031331 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-150 | Environmental | Open in IMG/M |
3300031337 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-130 | Environmental | Open in IMG/M |
3300031351 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-190 | Environmental | Open in IMG/M |
3300031355 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1602-70 | Environmental | Open in IMG/M |
3300031357 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-70 | Environmental | Open in IMG/M |
3300031365 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - SW1601-220 | Environmental | Open in IMG/M |
3300031368 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-230 | Environmental | Open in IMG/M |
3300031369 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1602-90 | Environmental | Open in IMG/M |
3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
3300031553 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-240 | Environmental | Open in IMG/M |
3300031554 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-130 | Environmental | Open in IMG/M |
3300031586 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-190 | Environmental | Open in IMG/M |
3300031624 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1602-10 | Environmental | Open in IMG/M |
3300031651 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-210 | Environmental | Open in IMG/M |
3300031654 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-200 | Environmental | Open in IMG/M |
3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
3300032020 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_18 | Environmental | Open in IMG/M |
3300032029 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-170 | Environmental | Open in IMG/M |
3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
beta3_all_00492520 | 2124908028 | Soil | MVEEINKIIRVYDKEKNNDEIFFDVYELILAKLDNE |
B3_all_c_02396050 | 2124908038 | Soil | MVEEINKIIRVYDKEKNNDEIFFDVYELILAKLDNESLVKET |
ML8_1000122320 | 3300001335 | Wetlands Benthic | MRHKIDKTIRVYNEERNGDEIFFDIYELILEKLDSESLVKET* |
ML8_1000162824 | 3300001335 | Wetlands Benthic | MDEDINRIIRIYNEEGNDDDIFIDIYELILSKLDSELLVKDT* |
ML8_100240362 | 3300001335 | Wetlands Benthic | MAQEIKKITRFYNNENNGDEIFFDAYELILSKLEEELLVKDT* |
ML8_100601771 | 3300001335 | Wetlands Benthic | MAQEIKKISRFYDKESSGDEIFFDVYELILSKLDDELLVKEP* |
ML8_101024981 | 3300001335 | Wetlands Benthic | MAQEIEKITRSYNKENDGDEIFFDVYELILSKLEDELLVKET* |
ML8_102008852 | 3300001335 | Wetlands Benthic | MVQEIKKITRSYNKENDGDEIFFDVYELILSKLEDELLVKET* |
Ga0066632_102245691 | 3300004149 | Groundwater | MIQKTNKIIRVYNEEMNGDEIIFDIYEIILEKLDSESLVNET* |
Ga0066631_101610982 | 3300004212 | Groundwater | MIQKTNKIIRVYNEEMNGDEIIFDIYEIILEKLDSESLVKET* |
Ga0071116_10603524 | 3300005077 | Sinkhole | MAQEIKRISRFYNKENSGDEIFYDVYELILSKLDDELLVKEP* |
Ga0068714_100618192 | 3300005254 | Enrichment Culture | MAQEIKKISRLYNKENSGDEIFYDVYELILSKLDDELLVKKP* |
Ga0074649_10201184 | 3300005613 | Saline Water And Sediment | MAQEIKKITRSYDKENNGDEIFFDVYELILSKLEDELLVKEP* |
Ga0077109_10149582 | 3300005645 | Brackish Water | MRTRINKIIRVYDEERNNDEIIFDVYEVILEKLDNESLVKKS* |
Ga0077109_10262952 | 3300005645 | Brackish Water | VLTVIQGINKINRIYKKDRENDEVIFDVYDMILEKLDNESLVNKS* |
Ga0077109_10595681 | 3300005645 | Brackish Water | MVKDTNKIIRVYEEERSSDEIFFDVYELILAKLDSESLVKET* |
Ga0077109_10677412 | 3300005645 | Brackish Water | MVQEINKVTRFYEKENNGDEILFDVYELILAKLDDELLVKET* |
Ga0066794_101303072 | 3300005947 | Soil | MVEEINKIIRVYDKEKNNDEIFFDVYELILAKIDNESLVKET* |
Ga0111033_11433192 | 3300008516 | Marine Sediment | MVKDTNKIIRVYDEERNGDEIFFDVYELILTKLDSESLVKET* |
Ga0118724_10726791 | 3300009127 | Marine | MAQEIKKITRSYDKENNGDEIFFDVYELILSKLEDELLVKES* |
Ga0114918_101896412 | 3300009149 | Deep Subsurface | MRTRINKIIRVYDEERNNDEIIFDVYEMILEKLDNESLVKKS* |
Ga0114918_102047921 | 3300009149 | Deep Subsurface | MIQKTNKIIRVYNEERNGDEIIFDIYEIILEKLGSESLVKET* |
Ga0114918_103310102 | 3300009149 | Deep Subsurface | MIKDTNKIIRVYEEKKNGDEIFFDVYELILAKLDSEPLVKET* |
Ga0117909_11561621 | 3300009320 | Marine | MAQEIKKITRSYDNENNGDEIFFDVYELILSKLEDELLVKES* |
Ga0114930_103621942 | 3300009499 | Deep Subsurface | MIKDANKIIRVYEEEKNGDEIFFDVYELILAKLDSETLVKET* |
Ga0114919_109705731 | 3300009529 | Deep Subsurface | MRPEINKIIRIYDEEKGSYDEIIFDIYEIILEKLDSESLVKET* |
Ga0136653_100552291 | 3300010319 | Anoxic Lake Water | MVQEINKITRFYDKENNGDEIFFDVYELILAKLDDELLVKEP* |
Ga0114922_106154271 | 3300011118 | Deep Subsurface | MVKDTNKIIRVYNEERNGDEIIFDIYEIILEKLDSESLVKET* |
Ga0114922_108790512 | 3300011118 | Deep Subsurface | MVKDINKIIRVYDEERNGDEIFFDVYELILTKLDSESLVKET* |
Ga0114922_112611971 | 3300011118 | Deep Subsurface | MVKDTNKIIRVYEEERSSDEIFFDVYELILTKLDSESLVKET* |
Ga0163209_100068511 | 3300013090 | Freshwater | MKQEIKRIIRIYDEERDGDGIFFDVYELILAKLDSELLVKDT* |
Ga0163209_10876112 | 3300013090 | Freshwater | MAQEIKKISRFYNKENSGDEIFYDVYELILSKLDDELLVKEP* |
Ga0163210_10906621 | 3300013091 | Freshwater | MVQEINKITRIYNKENNADEIFFDVYELILAKLDDELLVKEP* |
Ga0163210_10985252 | 3300013091 | Freshwater | MAQEIKKISRFYNKENSGDEIFYDAYELILSKLDDELLVKEP* |
Ga0163210_11477751 | 3300013091 | Freshwater | FKMAQEIKKISRFYNKENSGDEIFYDVYELILSKLDDELLVKEP* |
(restricted) Ga0172365_105894491 | 3300013127 | Sediment | MKKEIKKIIRIYDEEVDGDGIFFEVYELILAKLDSELLVKDT* |
(restricted) Ga0172364_104918681 | 3300013129 | Sediment | MIQKTNKIIRVYNEERNGDEIIFDIYEIILEKLDSESLVKET* |
(restricted) Ga0172364_108751942 | 3300013129 | Sediment | MKQEIKKIIRVYDEERNSNEIFFDIYELILTKLDCELLVKDT* |
(restricted) Ga0172363_104066782 | 3300013130 | Sediment | MKQEIKKIIRVYDEEGDGDGIFFDVYELILAKLDSELLVKDT* |
(restricted) Ga0172363_108285641 | 3300013130 | Sediment | MAQEIKKISRFYNKENNGDEIFYDVYELILSKLDDELLVKEP* |
(restricted) Ga0172362_107140441 | 3300013133 | Sediment | MKQEIKKIIRVYDEEEDGDGIFFDVYELILAKLDSELLVKDT* |
(restricted) Ga0172362_109346862 | 3300013133 | Sediment | MIQKTNKIIRVYNEERNGDEIIFDIYEIILEKLDSESLVKDT* |
(restricted) Ga0172370_103002512 | 3300013136 | Freshwater | MVQEINKVTRSYDKENNGDEIFFDVYELILAKLDDELLVKKT* |
(restricted) Ga0172371_101643503 | 3300013138 | Freshwater | MVQEINKVTRSYDKENNGDEIFFDVYELILAKLDDELLVKK |
(restricted) Ga0172371_102212341 | 3300013138 | Freshwater | MVQEINKITRIYNKENNADEIFFDVYELILAKLDGELLVKEP* |
Ga0182010_100744053 | 3300014490 | Fen | MVQEINKVTRSYDKENNGDEIFFDVYELILAKLDDELFVKET* |
Ga0182017_100883081 | 3300014494 | Fen | MVQEINKVIRFYDKENNGDEIFFDVYELILAKLDDELLVKET* |
Ga0182017_108243171 | 3300014494 | Fen | MVEEINKIIRVYDKEKNSDEVFFDVYELILTKLDNEPLVKET* |
Ga0180432_100088742 | 3300017989 | Hypersaline Lake Sediment | MAQEIKKITRSYDKENNGDEIFFDVYELILSKLEDELLVKES |
Ga0180436_103948643 | 3300017990 | Hypersaline Lake Sediment | MDQEIKKITRSYDKENNGDEIFFDVYELILSKLEDELLVKES |
Ga0194113_108943621 | 3300020074 | Freshwater Lake | MAQEIKKISRFYNKENSGDEIFYDVYELILSKLDDELLVK |
Ga0194113_110702571 | 3300020074 | Freshwater Lake | LLIMAQEIKKISRFYNKENSGDEIFYDVYELILSKLDDELLVKEP |
Ga0194111_101167542 | 3300020083 | Freshwater Lake | MVQEIKKITRFYNEESNGDEIFFDVYELILSKLDEELLVKES |
Ga0194110_101346102 | 3300020084 | Freshwater Lake | MRQEINKIIRVYNEEKNGDEIIFDIYEIILEKLDSESLVKDT |
Ga0194110_108000511 | 3300020084 | Freshwater Lake | SFKMAQEIKKISRFYNKENSGDEIFYDVYELILSKLDDELLVKEP |
Ga0212121_1000113817 | 3300022556 | Anoxic Lake Water | MKQEIKRIIRIYDEERDGDGIFFDVYELILAKLDSELLVKDT |
Ga0212121_101008062 | 3300022556 | Anoxic Lake Water | MAQEIKKISRFYNKENSGDEIFYDVYELILSKLDDELLVKEP |
Ga0212121_103011892 | 3300022556 | Anoxic Lake Water | MVQEINKITRIYDKENNADEIFFDVYELILAKLDDELLVKEP |
Ga0212121_104354322 | 3300022556 | Anoxic Lake Water | KKISRFYNKENSGDEIFYDAYELILSKLDDELLVKEP |
(restricted) Ga0233425_1000274532 | 3300024054 | Freshwater | MVQEIKKISRFYNKENSGDEIFFDVYELILSKLDNGLLVKQA |
Ga0210003_10042382 | 3300024262 | Deep Subsurface | MRTRINKIIRVYDEERNNDEIIFDVYEMILEKLDNESLVKKS |
Ga0210003_11091901 | 3300024262 | Deep Subsurface | MRTRINKIIRVYDEERNNDEIIFDVYEVILEKLDNESLVKKS |
Ga0209979_12004541 | 3300024353 | Deep Subsurface | MIKDANKIIRVYEEEKNGDEIFFDVYELILAKLDSETLVKET |
Ga0210049_13366192 | 3300025036 | Groundwater | MIQKTNKITRIYNEERNGDEIIFDIYEIILEKLDSESLVKET |
Ga0208047_11004421 | 3300025279 | Freshwater | FKMAQEIKKISRFYNKENSGDEIFYDVYELILSKLDDELLVKEP |
Ga0209323_101165502 | 3300025314 | Soil | MVKDTNKIIRVYNEERNGDEIIFDVYELILAKLDSESLVKET |
Ga0208828_100087110 | 3300025807 | Freshwater | LDFMKQEIKRIIRIYDEERDGDGIFFDVYELILAKLDSELLVKDT |
Ga0210051_11341072 | 3300025868 | Groundwater | MIQKTNKIIRVYNEEMNGDEIIFDIYEIILEKLDSESLVNET |
Ga0209164_10473162 | 3300027690 | Enrichment Culture | MAQEIKKISRLYNKENSGDEIFYDVYELILSKLDDELLVKKP |
Ga0268278_10449822 | 3300028162 | Saline Water | VLTVIQEINKINRIYKKDRENDEVIFDVYDMILEKLDNESLVNKS |
Ga0265594_12653632 | 3300028193 | Saline Water | INRIYKTDRENDEVIFDVYDMILEKLDNESLVNKS |
Ga0268280_10712511 | 3300028298 | Saline Water | MVQEINKVTRFYDKEINGDEIFFDVYELILAKLDDELLVKET |
Ga0268276_10666972 | 3300028299 | Saline Water | MAQEIKKISRFYDKESSGDEIFFDVYELILSKLDDELLVKEP |
(restricted) Ga0247842_104958532 | 3300029268 | Freshwater | MVQEINKVTRFYDKENNGDEIFFDVYELILAKLDDELLVKET |
(restricted) Ga0247841_103903931 | 3300029286 | Freshwater | MVQEINKVTRFYDKENNGDEIFFDVYELILAKLDDELLVKE |
Ga0315554_10299462 | 3300031255 | Salt Marsh Sediment | MKKEINKIIRVYDEEGSSDKIFFDIYELILLKLDSELLVKDT |
Ga0315554_12036552 | 3300031255 | Salt Marsh Sediment | MVKDTNKIIRVYNEERNGDEIIFDIYEIILEKLDSESLVKET |
Ga0315555_10461632 | 3300031257 | Salt Marsh Sediment | MVKDTNKIIRVYEEERSSDEIFFDVYELILAKLDSESLVKET |
Ga0307437_10040403 | 3300031275 | Salt Marsh | MVKDDNKIIRVYDEERNGDEIFFDVYELILAKLDSESLVKET |
Ga0307431_10052232 | 3300031278 | Salt Marsh | MRHKIYRTIRVYNEERNGDEIFFDIYELILEKLDSESLVKET |
Ga0307431_10139932 | 3300031278 | Salt Marsh | MDKDINRTIRVYNEERNGDEIFFDIYELILEKLDSESLVKET |
Ga0307431_10239052 | 3300031278 | Salt Marsh | MVKDTNKIIRVYEEERISDEIFFDVYELILAKLDSESLVKET |
Ga0307431_10473001 | 3300031278 | Salt Marsh | MDDSNNRIIRIYNEKRNNDDIFIDVYELILTKLDIKSLVKDT |
Ga0307431_10845992 | 3300031278 | Salt Marsh | MRHKIDRTIRVYNEERNGDEIFYDIYELILEKLDSESLVKET |
Ga0307431_11267511 | 3300031278 | Salt Marsh | MKKEINKIVRVYDEEGSDDKIFFDIYELILSKLDSELLVKDT |
Ga0307432_10436222 | 3300031331 | Salt Marsh | VFPMVKDTNKIIRVYNEEKNGDEIIFDVYELILAKLDSESLVKET |
Ga0307432_11383452 | 3300031331 | Salt Marsh | PMDDSNNRIIRIYNEKRNNDDIFIDVYELILTKLDIKSLVKDT |
Ga0307430_10828831 | 3300031337 | Salt Marsh | MKKEIKKIVRVYDEEGSSDEIFFVIYELILLKLDSELLVKDT |
Ga0307427_1000035127 | 3300031351 | Salt Marsh | MDDNNNRIIRIYNEKRNDDDIFIDVYELILAKLDSKSLVKDT |
Ga0307421_11662691 | 3300031355 | Salt Marsh | NKIIRVYDEERNGDEIFFDVYELILAKLDSESLVKET |
Ga0307421_12243072 | 3300031355 | Salt Marsh | MVKDTNKIIRVYDEERNGDEIFFDVYELILTKLDSESLVKET |
Ga0307435_10268281 | 3300031357 | Salt Marsh | MKKEINKIIRVYDEEGNGDEIFFDIYELILSKLDSELLVKDT |
Ga0307443_11467602 | 3300031365 | Salt Marsh | NKIIRVYEEERSSDEIFFDVYELILAKLDSESLVKET |
Ga0307429_10938731 | 3300031368 | Salt Marsh | MAQEIKKITRSYDKGNNGDEIFFDVYELILSKLDDE |
Ga0307422_10846272 | 3300031369 | Salt Marsh | MDDDNNRIIRIYNEKRNDDDIFIDVYELILAKLDIKSLVKDT |
Ga0307422_12195012 | 3300031369 | Salt Marsh | MVQEINKITRIYNKENNADEIFFDVYELILAKLDDELLVKEP |
Ga0307380_100278051 | 3300031539 | Soil | MIQKTNKIIRVYDEERDSDEIFFDVYELILAKLDSESLVKET |
Ga0307380_102165143 | 3300031539 | Soil | MIQKTNKIIRVYEEEKNGDEIFFDVYELILAKLDSETLVKET |
Ga0315547_100000992 | 3300031553 | Salt Marsh Sediment | MIKDTNKIIRVYEVEKNGDGIFFDVYELILTKLDSESLVKEN |
Ga0315544_11940732 | 3300031554 | Salt Marsh Sediment | MVNDTNKIIRVYNEERNGDEIIFDIYEIILEKLDSESLVKET |
Ga0315541_10607212 | 3300031586 | Salt Marsh Sediment | MVQKTNKIIRIYDEERNSDEIFFDVYELILAKLDSESLVKET |
Ga0315545_11594322 | 3300031624 | Salt Marsh Sediment | MKQEISKIIRVYDEERSSDEIFFDVYELILSKFDSELLVKDT |
Ga0315543_11523772 | 3300031651 | Salt Marsh Sediment | MLKKKFLMKKEINKILRVYDEEGSSDEIFFDIYELILLKLDSELLVKDT |
Ga0315549_11602591 | 3300031654 | Salt Marsh Sediment | MVKDTNKIIRVYDEERNGDEIFFDVYELILTKLDSESLVKE |
Ga0315294_110191731 | 3300031952 | Sediment | NKIIRVYDKEKNKDEIFFDVYELILAKLDNESLVKET |
Ga0315296_104520642 | 3300032020 | Sediment | MIKDTNKIIRVYEEEKNGDEIFFDVYELILAKLDSETLVKET |
Ga0315546_10619172 | 3300032029 | Salt Marsh Sediment | MVQKTNKIIRIYDEERNSDEIFFDVYKLILTKLDSESLVKET |
Ga0315295_104153231 | 3300032156 | Sediment | MVQEINKVTRFYEKENNGDEIFFDVYELILAKLDDELLVKET |
⦗Top⦘ |