Basic Information | |
---|---|
Family ID | F089594 |
Family Type | Metagenome |
Number of Sequences | 109 |
Average Sequence Length | 40 residues |
Representative Sequence | VGAGSERQVIAVVCGSGIGDVLIELWFLFVWLDTLCE |
Number of Associated Samples | 34 |
Number of Associated Scaffolds | 109 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 39.42 % |
% of genes near scaffold ends (potentially truncated) | 66.97 % |
% of genes from short scaffolds (< 2000 bps) | 58.72 % |
Associated GOLD sequencing projects | 34 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (67.890 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water (93.578 % of family members) |
Environment Ontology (ENVO) | Unclassified (93.578 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Unclassified (93.578 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 62.16% β-sheet: 0.00% Coil/Unstructured: 37.84% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 109 Family Scaffolds |
---|---|---|
PF00078 | RVT_1 | 11.01 |
PF03810 | IBN_N | 1.83 |
PF00075 | RNase_H | 1.83 |
PF03015 | Sterile | 0.92 |
PF05637 | Glyco_transf_34 | 0.92 |
PF00463 | ICL | 0.92 |
PF08490 | DUF1744 | 0.92 |
PF00849 | PseudoU_synth_2 | 0.92 |
PF00069 | Pkinase | 0.92 |
COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
---|---|---|---|
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.67 |
COG0564 | Pseudouridine synthase RluA, 23S rRNA- or tRNA-specific | Translation, ribosomal structure and biogenesis [J] | 0.92 |
COG1187 | Pseudouridylate synthase RsuA, specific for 16S rRNA U516 and 23S rRNA U2605 | Translation, ribosomal structure and biogenesis [J] | 0.92 |
COG2224 | Isocitrate lyase | Energy production and conversion [C] | 0.92 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 67.89 % |
All Organisms | root | All Organisms | 32.11 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2140918027|contig16338 | Not Available | 623 | Open in IMG/M |
2140918027|contig18053 | Not Available | 569 | Open in IMG/M |
3300005928|Ga0075105_1022415 | Not Available | 707 | Open in IMG/M |
3300012025|Ga0136571_122005 | Not Available | 588 | Open in IMG/M |
3300012027|Ga0136609_1031368 | Not Available | 506 | Open in IMG/M |
3300012028|Ga0136584_1011691 | Not Available | 888 | Open in IMG/M |
3300028411|Ga0306911_111991 | Not Available | 618 | Open in IMG/M |
3300031209|Ga0307955_1055610 | Not Available | 736 | Open in IMG/M |
3300031210|Ga0307964_1030431 | Not Available | 1028 | Open in IMG/M |
3300031210|Ga0307964_1055271 | Not Available | 745 | Open in IMG/M |
3300031210|Ga0307964_1080219 | Not Available | 607 | Open in IMG/M |
3300031211|Ga0307974_1000509 | All Organisms → cellular organisms → Eukaryota | 23995 | Open in IMG/M |
3300031211|Ga0307974_1006139 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Chlorophyceae → CS clade → Chlamydomonadales → Dunaliellaceae → Dunaliella → Dunaliella viridis | 8457 | Open in IMG/M |
3300031211|Ga0307974_1015878 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Chlorophyceae → CS clade → Chlamydomonadales → Dunaliellaceae → Dunaliella → Dunaliella viridis | 4654 | Open in IMG/M |
3300031211|Ga0307974_1021523 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Chlorophyceae → CS clade → Chlamydomonadales → Dunaliellaceae → Dunaliella → Dunaliella viridis | 3711 | Open in IMG/M |
3300031211|Ga0307974_1021528 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Chlorophyceae → CS clade → Chlamydomonadales → Dunaliellaceae → Dunaliella → Dunaliella tertiolecta | 3710 | Open in IMG/M |
3300031211|Ga0307974_1021819 | Not Available | 3675 | Open in IMG/M |
3300031211|Ga0307974_1031680 | Not Available | 2772 | Open in IMG/M |
3300031212|Ga0307959_1103526 | Not Available | 732 | Open in IMG/M |
3300031213|Ga0307937_1088658 | Not Available | 642 | Open in IMG/M |
3300031213|Ga0307937_1099542 | Not Available | 599 | Open in IMG/M |
3300031221|Ga0307948_1000517 | All Organisms → cellular organisms → Eukaryota → Viridiplantae | 26622 | Open in IMG/M |
3300031221|Ga0307948_1013174 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Chlorophyceae → CS clade → Chlamydomonadales → Dunaliellaceae → Dunaliella → Dunaliella tertiolecta | 5626 | Open in IMG/M |
3300031221|Ga0307948_1016434 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Chlorophyceae → CS clade → Chlamydomonadales → Dunaliellaceae → Dunaliella → Dunaliella tertiolecta | 4818 | Open in IMG/M |
3300031221|Ga0307948_1119408 | Not Available | 842 | Open in IMG/M |
3300031221|Ga0307948_1126294 | Not Available | 797 | Open in IMG/M |
3300031221|Ga0307948_1191696 | Not Available | 543 | Open in IMG/M |
3300031222|Ga0307972_1001414 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Chlorophyceae → CS clade → Chlamydomonadales → Dunaliellaceae → Dunaliella → Dunaliella viridis | 12686 | Open in IMG/M |
3300031222|Ga0307972_1002224 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Chlorophyceae → CS clade → Chlamydomonadales → Dunaliellaceae → Dunaliella → Dunaliella viridis | 10249 | Open in IMG/M |
3300031222|Ga0307972_1011010 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Chlorophyceae → CS clade → Chlamydomonadales → Dunaliellaceae → Dunaliella → Dunaliella viridis | 5064 | Open in IMG/M |
3300031222|Ga0307972_1021998 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Chlorophyceae → CS clade → Chlamydomonadales → Dunaliellaceae → Dunaliella → Dunaliella viridis | 3593 | Open in IMG/M |
3300031222|Ga0307972_1024141 | Not Available | 3415 | Open in IMG/M |
3300031222|Ga0307972_1046905 | Not Available | 2246 | Open in IMG/M |
3300031222|Ga0307972_1108721 | Not Available | 1103 | Open in IMG/M |
3300031222|Ga0307972_1146514 | Not Available | 806 | Open in IMG/M |
3300031222|Ga0307972_1180427 | Not Available | 639 | Open in IMG/M |
3300031225|Ga0307942_1001943 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Chlorophyceae → CS clade → Chlamydomonadales → Dunaliellaceae → Dunaliella → Dunaliella viridis | 16733 | Open in IMG/M |
3300031225|Ga0307942_1002053 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Chlorophyceae → CS clade → Chlamydomonadales → Dunaliellaceae → Dunaliella → Dunaliella tertiolecta | 16273 | Open in IMG/M |
3300031225|Ga0307942_1018543 | Not Available | 4195 | Open in IMG/M |
3300031225|Ga0307942_1032913 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Chlorophyceae → CS clade → Chlamydomonadales → Dunaliellaceae → Dunaliella → Dunaliella viridis | 2661 | Open in IMG/M |
3300031333|Ga0307936_1173364 | Not Available | 563 | Open in IMG/M |
3300031333|Ga0307936_1195626 | Not Available | 514 | Open in IMG/M |
3300031334|Ga0307969_1067278 | Not Available | 870 | Open in IMG/M |
3300031334|Ga0307969_1127503 | Not Available | 577 | Open in IMG/M |
3300031334|Ga0307969_1138487 | Not Available | 544 | Open in IMG/M |
3300031335|Ga0307951_1007335 | Not Available | 6934 | Open in IMG/M |
3300031335|Ga0307951_1021630 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Chlorophyceae → CS clade → Chlamydomonadales → Dunaliellaceae → Dunaliella → Dunaliella viridis | 3425 | Open in IMG/M |
3300031335|Ga0307951_1029400 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Chlorophyceae → CS clade → Chlamydomonadales → Dunaliellaceae → Dunaliella → Dunaliella tertiolecta | 2644 | Open in IMG/M |
3300031335|Ga0307951_1083555 | Not Available | 926 | Open in IMG/M |
3300031339|Ga0307932_1117626 | Not Available | 692 | Open in IMG/M |
3300031339|Ga0307932_1163922 | Not Available | 569 | Open in IMG/M |
3300031343|Ga0307952_1026523 | Not Available | 2586 | Open in IMG/M |
3300031343|Ga0307952_1062304 | Not Available | 1385 | Open in IMG/M |
3300031343|Ga0307952_1066447 | Not Available | 1312 | Open in IMG/M |
3300031343|Ga0307952_1095168 | Not Available | 936 | Open in IMG/M |
3300031382|Ga0307971_1063493 | Not Available | 1190 | Open in IMG/M |
3300031382|Ga0307971_1184740 | Not Available | 583 | Open in IMG/M |
3300031382|Ga0307971_1200842 | Not Available | 551 | Open in IMG/M |
3300031387|Ga0307947_1001719 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Chlorophyceae → CS clade → Chlamydomonadales → Chlamydomonadaceae → Chlamydomonas → Chlamydomonas leiostraca | 17445 | Open in IMG/M |
3300031387|Ga0307947_1001947 | All Organisms → cellular organisms → Eukaryota → Viridiplantae | 16493 | Open in IMG/M |
3300031387|Ga0307947_1005530 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Chlorophyceae → CS clade → Chlamydomonadales | 9700 | Open in IMG/M |
3300031387|Ga0307947_1015755 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Chlorophyceae → CS clade → Chlamydomonadales → Dunaliellaceae → Dunaliella → Dunaliella viridis | 4301 | Open in IMG/M |
3300031387|Ga0307947_1020260 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Chlorophyceae → CS clade → Chlamydomonadales → Dunaliellaceae → Dunaliella → Dunaliella viridis | 3382 | Open in IMG/M |
3300031387|Ga0307947_1023186 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Chlorophyceae → CS clade → Chlamydomonadales → Dunaliellaceae → Dunaliella → Dunaliella viridis | 2964 | Open in IMG/M |
3300031391|Ga0307954_1043423 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Chlorophyceae → CS clade → Chlamydomonadales → Volvocaceae → Volvox → Volvox reticuliferus | 1664 | Open in IMG/M |
3300031391|Ga0307954_1094016 | Not Available | 875 | Open in IMG/M |
3300031391|Ga0307954_1097438 | Not Available | 844 | Open in IMG/M |
3300031392|Ga0307975_1009218 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Chlorophyceae → CS clade → Chlamydomonadales → Dunaliellaceae → Dunaliella → Dunaliella viridis | 3627 | Open in IMG/M |
3300031392|Ga0307975_1018024 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Chlorophyceae → CS clade → Chlamydomonadales → Dunaliellaceae → Dunaliella → Dunaliella viridis | 2639 | Open in IMG/M |
3300031392|Ga0307975_1062923 | Not Available | 1420 | Open in IMG/M |
3300031392|Ga0307975_1090710 | Not Available | 1138 | Open in IMG/M |
3300031392|Ga0307975_1123267 | Not Available | 919 | Open in IMG/M |
3300031392|Ga0307975_1241091 | Not Available | 512 | Open in IMG/M |
3300031393|Ga0307967_1010323 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Chlorophyceae → CS clade → Chlamydomonadales → Dunaliellaceae → Dunaliella → Dunaliella viridis | 5160 | Open in IMG/M |
3300031393|Ga0307967_1018074 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Chlorophyceae → CS clade → Chlamydomonadales | 3781 | Open in IMG/M |
3300031393|Ga0307967_1047399 | Not Available | 1981 | Open in IMG/M |
3300031393|Ga0307967_1057937 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Chlorophyceae → CS clade → Chlamydomonadales → Dunaliellaceae → Dunaliella → Dunaliella viridis | 1691 | Open in IMG/M |
3300031393|Ga0307967_1199270 | Not Available | 561 | Open in IMG/M |
3300031394|Ga0307963_1166329 | Not Available | 565 | Open in IMG/M |
3300031394|Ga0307963_1182437 | Not Available | 519 | Open in IMG/M |
3300031395|Ga0307957_1016352 | Not Available | 1767 | Open in IMG/M |
3300031395|Ga0307957_1118289 | Not Available | 541 | Open in IMG/M |
3300031396|Ga0307944_1126517 | Not Available | 657 | Open in IMG/M |
3300031396|Ga0307944_1172881 | Not Available | 528 | Open in IMG/M |
3300031397|Ga0307960_1004763 | All Organisms → cellular organisms → Eukaryota | 8370 | Open in IMG/M |
3300031397|Ga0307960_1060783 | Not Available | 1433 | Open in IMG/M |
3300031397|Ga0307960_1102714 | Not Available | 894 | Open in IMG/M |
3300031399|Ga0307968_1001945 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Chlorophyceae → CS clade → Chlamydomonadales → Dunaliellaceae → Dunaliella → Dunaliella viridis | 17048 | Open in IMG/M |
3300031399|Ga0307968_1002087 | All Organisms → cellular organisms → Eukaryota → Viridiplantae | 16502 | Open in IMG/M |
3300031399|Ga0307968_1012644 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Chlorophyceae → CS clade → Chlamydomonadales → Dunaliellaceae → Dunaliella → Dunaliella viridis | 5512 | Open in IMG/M |
3300031399|Ga0307968_1042052 | Not Available | 1787 | Open in IMG/M |
3300031404|Ga0307945_1006929 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Chlorophyceae → CS clade → Chlamydomonadales → Dunaliellaceae → Dunaliella → Dunaliella viridis | 8911 | Open in IMG/M |
3300031404|Ga0307945_1031084 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Chlorophyceae → CS clade → Chlamydomonadales → Dunaliellaceae → Dunaliella → Dunaliella viridis | 2681 | Open in IMG/M |
3300031600|Ga0307930_1092443 | Not Available | 1005 | Open in IMG/M |
3300031600|Ga0307930_1152716 | Not Available | 706 | Open in IMG/M |
3300031607|Ga0307966_1189816 | Not Available | 856 | Open in IMG/M |
3300031607|Ga0307966_1264903 | Not Available | 641 | Open in IMG/M |
3300031607|Ga0307966_1355955 | Not Available | 502 | Open in IMG/M |
3300031684|Ga0307946_1110762 | Not Available | 751 | Open in IMG/M |
3300031684|Ga0307946_1134004 | Not Available | 621 | Open in IMG/M |
3300031704|Ga0307943_1078380 | Not Available | 1236 | Open in IMG/M |
3300031704|Ga0307943_1112710 | Not Available | 916 | Open in IMG/M |
3300031704|Ga0307943_1190873 | Not Available | 563 | Open in IMG/M |
3300031704|Ga0307943_1202860 | Not Available | 531 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 93.58% |
Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 4.59% |
Hypersaline | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline | 1.83% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2140918027 | Hypersaline microbial communities from Antarctic Deep Lake - 36m 3.0um, 0.8um, 0.1um pool | Environmental | Open in IMG/M |
3300005928 | Saline lake microbial communities from Deep Lake, Antarctica - Antarctic Deep Lake Metagenome 02WF5 | Environmental | Open in IMG/M |
3300012025 | Saline lake microbial communities from Deep lake, Antarctica - Metagenome #81 | Environmental | Open in IMG/M |
3300012027 | Saline lake microbial communities from Deep Lake, Antarctica - Metagenome TFF 2006 #2 | Environmental | Open in IMG/M |
3300012028 | Saline lake microbial communities from Deep lake, Antarctica - Metagenome #401 | Environmental | Open in IMG/M |
3300028411 | Saline lake microbial communities from Deep Lake, Antarctica - Metagenome TFF #695 (v2) | Environmental | Open in IMG/M |
3300031209 | Saline water microbial communities from Organic Lake, Antarctica - #439 | Environmental | Open in IMG/M |
3300031210 | Saline water microbial communities from Organic Lake, Antarctica - #596 | Environmental | Open in IMG/M |
3300031211 | Saline water microbial communities from Organic Lake, Antarctica - #784 | Environmental | Open in IMG/M |
3300031212 | Saline water microbial communities from Organic Lake, Antarctica - #494 | Environmental | Open in IMG/M |
3300031213 | Saline water microbial communities from Organic Lake, Antarctica - #3 | Environmental | Open in IMG/M |
3300031221 | Saline water microbial communities from Organic Lake, Antarctica - #280 | Environmental | Open in IMG/M |
3300031222 | Saline water microbial communities from Organic Lake, Antarctica - #780 | Environmental | Open in IMG/M |
3300031225 | Saline water microbial communities from Organic Lake, Antarctica - #175 | Environmental | Open in IMG/M |
3300031333 | Saline water microbial communities from Organic Lake, Antarctica - #1 | Environmental | Open in IMG/M |
3300031334 | Saline water microbial communities from Organic Lake, Antarctica - #710 | Environmental | Open in IMG/M |
3300031335 | Saline water microbial communities from Organic Lake, Antarctica - #374 | Environmental | Open in IMG/M |
3300031339 | Saline water microbial communities from Organic Lake, Antarctica - #48 | Environmental | Open in IMG/M |
3300031343 | Saline water microbial communities from Organic Lake, Antarctica - #376 | Environmental | Open in IMG/M |
3300031382 | Saline water microbial communities from Organic Lake, Antarctica - #714 | Environmental | Open in IMG/M |
3300031387 | Saline water microbial communities from Organic Lake, Antarctica - #232 | Environmental | Open in IMG/M |
3300031391 | Saline water microbial communities from Organic Lake, Antarctica - #437 | Environmental | Open in IMG/M |
3300031392 | Saline water microbial communities from Organic Lake, Antarctica - #917 | Environmental | Open in IMG/M |
3300031393 | Saline water microbial communities from Organic Lake, Antarctica - #648 | Environmental | Open in IMG/M |
3300031394 | Saline water microbial communities from Organic Lake, Antarctica - #594 | Environmental | Open in IMG/M |
3300031395 | Saline water microbial communities from Organic Lake, Antarctica - #490 | Environmental | Open in IMG/M |
3300031396 | Saline water microbial communities from Organic Lake, Antarctica - #179 | Environmental | Open in IMG/M |
3300031397 | Saline water microbial communities from Organic Lake, Antarctica - #542 | Environmental | Open in IMG/M |
3300031399 | Saline water microbial communities from Organic Lake, Antarctica - #650 | Environmental | Open in IMG/M |
3300031404 | Saline water microbial communities from Organic Lake, Antarctica - #228 | Environmental | Open in IMG/M |
3300031600 | Saline water microbial communities from Organic Lake, Antarctica - #46 | Environmental | Open in IMG/M |
3300031607 | Saline water microbial communities from Organic Lake, Antarctica - #646 | Environmental | Open in IMG/M |
3300031684 | Saline water microbial communities from Organic Lake, Antarctica - #230 | Environmental | Open in IMG/M |
3300031704 | Saline water microbial communities from Organic Lake, Antarctica - #177 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
ADL36m2_01288790 | 2140918027 | Hypersaline | VYAVHALLVWSWERVASWLVGAGSERQVIAAVCGSGVGDVLIESWFLFVWLNTLCE |
ADL36m2_02256190 | 2140918027 | Hypersaline | SWERVASWSVGAGSERQVIAAVCGSGIGDVLMELWFLFVWLDTLCE |
Ga0075105_10224151 | 3300005928 | Saline Lake | ACWSWERVASWLVGAGSERQVIAAVCGSGIGDVLMEFWFLFVWLDTLCE* |
Ga0136571_1220052 | 3300012025 | Saline Lake | VGVGSERQVIAVVCGSGIGDVLIELWFLFVWLDTLCE* |
Ga0136609_10313682 | 3300012027 | Saline Lake | FVCWSWERVASWLVGAGSERQVIAVVCGSGIGDLLLELWFLFVWLDTLCE* |
Ga0136584_10116912 | 3300012028 | Saline Lake | WLVAAGSERQVIAVVCGSGIGDVLIKLWFLCNWLDALCE* |
Ga0306911_1119911 | 3300028411 | Saline Lake | VGAGSERQVTAVVYGSGIGDVLIELWLLFVWLDTL |
Ga0307955_10556102 | 3300031209 | Saline Water | LVGVGSERQVIAVVCGSGIGDVLIELWFLFVWLDTLCE |
Ga0307964_10304313 | 3300031210 | Saline Water | LGAGSERQVIAVVCGSGVGDVLIELWLFCVWLNTLCE |
Ga0307964_10552713 | 3300031210 | Saline Water | AGSERQVVAVVCGSGIDDVLIELWFLFVWLDTLCE |
Ga0307964_10802191 | 3300031210 | Saline Water | VVGLFVGAGSERRVIAVECGSGIGDVLIELWFLVVWLDTLCE |
Ga0307974_100050924 | 3300031211 | Saline Water | VGAGSEKQVIAVACGSGIGDVLIESWFLFVWFDKLSK |
Ga0307974_10061392 | 3300031211 | Saline Water | VASWLVGAGPERQVIAAVCGSGIGDVRMELWFLFVWLDTLCE |
Ga0307974_10158786 | 3300031211 | Saline Water | VVHGGCGEGVGAGSERKVIAVVCGSGIGDVLIELWFLFVWLDTLCE |
Ga0307974_10215231 | 3300031211 | Saline Water | RVASWLVGAGSERQVIAVVCGSGIGDVLIELWFLFVWLDTLCK |
Ga0307974_10215285 | 3300031211 | Saline Water | VANWLVGAGSERQVIAVACGSDIGDVLIELSFLFVWLETLCE |
Ga0307974_10218192 | 3300031211 | Saline Water | VASWLVAAGSESQVIAVVCGNDIGDVLIELWFLFVWLDTLCE |
Ga0307974_10316807 | 3300031211 | Saline Water | VASWLVGAGSERQVIAVVCGSGIGDVPIELWIPFVWLDTLCE |
Ga0307974_12131091 | 3300031211 | Saline Water | CWSWERVASWLMDAGSERQVIIAVVCGSGIGDVLIELWFLFVRLDTLCE |
Ga0307959_11035262 | 3300031212 | Saline Water | ACWSWERVASWLVGAGSQRQVVAVVCGSDIGDVLIELWFLFVWLDTLCE |
Ga0307937_10886581 | 3300031213 | Saline Water | VGAGSERQIIAVVCGSGIGDVLIELWFLFVWFDTLC |
Ga0307937_10995421 | 3300031213 | Saline Water | VGVGSERQVIAVVCGSGIGDVLIELWFLFIWLDTFCEW |
Ga0307948_100051742 | 3300031221 | Saline Water | VASWLVGAGSERQVIIAVVCGSGIGDVLIELWFLFVWMVTLCE |
Ga0307948_10131741 | 3300031221 | Saline Water | ASWLVGAGSERQVVAVVCGSGIGDVLIELWFLFVWLDTLCE |
Ga0307948_10164345 | 3300031221 | Saline Water | VGAGSERQVVAAVCGSGIGDALIELWFLFVWLDTLCE |
Ga0307948_11194082 | 3300031221 | Saline Water | RVASWLVGAGSERQVIAVVCGSGIGDVLIELWFLFVWLDTLCE |
Ga0307948_11262941 | 3300031221 | Saline Water | ASWLVGAGSERQVIAAVCGSGIGDVLMELWFLFVWLDTLCE |
Ga0307948_11916961 | 3300031221 | Saline Water | ASWLVGAGSERQVIAVVCGSGIGDVLIELWFLFVWLDTLCE |
Ga0307972_100141414 | 3300031222 | Saline Water | VGAGSERQVIAVACGSGIGDVLIELWFFFVWLDTLCE |
Ga0307972_100222421 | 3300031222 | Saline Water | ASWSVGAGSERQVIAAVCGSGIGDVLMELWFLFVWLDTLCE |
Ga0307972_10110101 | 3300031222 | Saline Water | SWLVGAVSERQVIAVVCGSGIGDVLIELWFLFVWLDTLCE |
Ga0307972_102199810 | 3300031222 | Saline Water | VASWLVGAGSERQVIAVVCGSGIGDVLIELYFLFVWLDTLCE |
Ga0307972_10241414 | 3300031222 | Saline Water | SSWLVGAGSEKQVIAVACGSGIGDVLIESWFLFVWFDKLSK |
Ga0307972_10469053 | 3300031222 | Saline Water | VGAGSERQVIAVVCGSGIGDLLLELWFLFVWLDTLCE |
Ga0307972_11087211 | 3300031222 | Saline Water | VGAGSERQVIAVVCGSGICDVLTELWFLFVGLDTLCE |
Ga0307972_11465141 | 3300031222 | Saline Water | FACWSWERVAGWLVGAGSQRQVVAVVCGSDIGDVLIELWFLFVWLDTLCE |
Ga0307972_11804271 | 3300031222 | Saline Water | VGAVSERQVIAVVCGSGIGDVLIELWFLFVWLDTLCE |
Ga0307942_100194313 | 3300031225 | Saline Water | VGAGSERQVIAVVCGNGIGDVLIELWFLFVWLDTLCE |
Ga0307942_10020531 | 3300031225 | Saline Water | VASWLVGAGSERQVIAVVCGSGIGDVLIESWFLFVWLDTLCE |
Ga0307942_10185436 | 3300031225 | Saline Water | VGAGSERQVIAVVCGSGIGDVPIELWIPFVWLDTLCE |
Ga0307942_10329133 | 3300031225 | Saline Water | VGAGSERRVIAVVCGSGNGDVLIELWFFVVWLDTLCE |
Ga0307936_11733641 | 3300031333 | Saline Water | GAGSEKQVIAVVCGGGIGDVLIELWFHFVWLDTLCE |
Ga0307936_11956261 | 3300031333 | Saline Water | LVGAGSERQVIAVICGSGIGDVLIELWFLFVWLDTLCE |
Ga0307969_10672782 | 3300031334 | Saline Water | VGAGSERQVIAVVCGSGIGDVLIELWFLFVWLDTL |
Ga0307969_11275031 | 3300031334 | Saline Water | VGAGSERQVIAVVCGSGIGDVLMELWFLFVWLDTLCE |
Ga0307969_11384872 | 3300031334 | Saline Water | VGAGSERQVIAVACGSGIGDVLIELWFLIVWLDAL |
Ga0307951_10073359 | 3300031335 | Saline Water | SWLVGAGSERQIVAVVCGSGIGDVLIELWFLFVWLDTLCE |
Ga0307951_10216301 | 3300031335 | Saline Water | GAGSERQVIAVVCGSGIGDVLIELWFLFVWLDTLCK |
Ga0307951_10294001 | 3300031335 | Saline Water | VGVGSERQVIAVVCGSGIGDVLIELWFLFVWLVTLCEW |
Ga0307951_10369383 | 3300031335 | Saline Water | ACWSWERVASWLVGAGSERQVIAAVCGSGIGDVLMEFWFLFVWLDTLCE |
Ga0307951_10835551 | 3300031335 | Saline Water | ASWLVAAGSERQVIAVVCGSGVGDVLIELWFLFVWLDTLCA |
Ga0307932_11176262 | 3300031339 | Saline Water | VGAGSERQVIAVACGSGIGDVLIELWFLFVWLDTLCE |
Ga0307932_11639221 | 3300031339 | Saline Water | SWLVGAGSERQVIAVVCGSGIGNVLIELWFLLVWLDTLCE |
Ga0307952_10265236 | 3300031343 | Saline Water | GAGSERQVVAVVCGSGIGDVLIELWFLFVWLDTLCE |
Ga0307952_10623043 | 3300031343 | Saline Water | SWLAGAGSERQVIAVVCGSGIGDVLIELWFLFVCLDTLCE |
Ga0307952_10664471 | 3300031343 | Saline Water | ASWLVGAGSERQVIAVVCGSGIGDVLIELWFLFAWLDTLCE |
Ga0307952_10951681 | 3300031343 | Saline Water | LVGAGSERQVIAAVCGSGIGDVLMELWFLFVWLDTLCE |
Ga0307952_11447921 | 3300031343 | Saline Water | WSWERVASWLVGAGSEKQVIAVVCGSGIGNVLMELWFLFVWLDILCE |
Ga0307971_10634932 | 3300031382 | Saline Water | NWLVGAGSERKVIAVVCGSGIGDVLIELWFLFVWLDTLCE |
Ga0307971_11847401 | 3300031382 | Saline Water | RVASWLVGAGSERQVIAVVCGSGIGDVLIELWFLFVWLDTL |
Ga0307971_12008421 | 3300031382 | Saline Water | VGAGSERQVIIAVVCGSGIGDVLIELWFLFDWLDT |
Ga0307947_100171924 | 3300031387 | Saline Water | CWSWERVTSWLVGAGSERQIIAVVCGSGIGDVLIELWFLFVWSDTLCE |
Ga0307947_100194729 | 3300031387 | Saline Water | GAGSERQVIAVVCGSGIGDVLIELWFLFVWLDTLCE |
Ga0307947_100553014 | 3300031387 | Saline Water | VGAGSERQVIAVVCGSGIGDVLIELWFLFVWLDTLCE |
Ga0307947_10157551 | 3300031387 | Saline Water | VGAGSERQVIAVVCGSGIGNVLIELWFLLVWLDTLCE |
Ga0307947_10202609 | 3300031387 | Saline Water | SWERVASWLVGAGSERQVIAVVCGSGIGDVLIELWFLFVWLDTLCK |
Ga0307947_10231863 | 3300031387 | Saline Water | VGAGSERQVTAVVYGSGIGDVLIELWLLFVWLDTLC |
Ga0307954_10434232 | 3300031391 | Saline Water | VGAGSERQVIAVVYGSGIGDVLIELWFLFVRLDTLCE |
Ga0307954_10940162 | 3300031391 | Saline Water | VGAGSERQVIAVVCGSDIGDVLIVLWFLFVWLDTLCE |
Ga0307954_10974381 | 3300031391 | Saline Water | VWEGVASWLVCAGSERQVIAVVCGSGVGDVLIELWFLFIWLDTLCE |
Ga0307975_10092186 | 3300031392 | Saline Water | VGVRPERQVIAVDCGSGIGDALLELWFLVVWCVGYPL |
Ga0307975_10180244 | 3300031392 | Saline Water | VCAGSERQVIAVVCGSGVGDVLIELWFLFIWLDTLCE |
Ga0307975_10629234 | 3300031392 | Saline Water | ERVASWLVGAGSERQVIAVVCGSGIGDVLMELWFLFVWLDTLCE |
Ga0307975_10907102 | 3300031392 | Saline Water | VGAGSERQVIAVVCGSGIGDVLIIELWFLFVWLDTLCE |
Ga0307975_11232671 | 3300031392 | Saline Water | AGSERQVIAVVCGSGIGDVLMELWFLFVWLDTLCE |
Ga0307975_12410911 | 3300031392 | Saline Water | VGAGSERQVIAVVCGSDIGDVLIVLWFLFVWLDTLC |
Ga0307967_10103235 | 3300031393 | Saline Water | VGVGSERQVIAVVCGSGIGDVLIELWFLFVWLDTLCE |
Ga0307967_10180746 | 3300031393 | Saline Water | VASWLVGAGSERQVIAVVCGSGIGDVLIELWFLFVWLDTL |
Ga0307967_10473996 | 3300031393 | Saline Water | SWERVASWLVGAGSERQVIAVVCGSGIGDVLIELYFLFVWLDTLCE |
Ga0307967_10579374 | 3300031393 | Saline Water | NWLVGAGSERQVIAVVCGSGVGDVLIELWFLFVWLDTLCE |
Ga0307967_11992701 | 3300031393 | Saline Water | GCGEGVGAGSERKVIAVVCGSGIGDVLIELWFLFVWLDTLCE |
Ga0307963_11663291 | 3300031394 | Saline Water | WLVGAGPERQAIAVVCGSGIGDVLIELWFLFVWLDTLCE |
Ga0307963_11824372 | 3300031394 | Saline Water | VGAGSERQVIAVVCGSGIGDVLIESWFLFVWLDTLCE |
Ga0307957_10163523 | 3300031395 | Saline Water | AGSERQIIAVVCGSGIGDVLIELWFLFVWFDTLCE |
Ga0307957_11182891 | 3300031395 | Saline Water | LVGAGSERQVVAVICGSGIGDVLIELWFLFVWLDTLCE |
Ga0307944_10813691 | 3300031396 | Saline Water | RFACWSWERVASWLVGAGSERQVIAVVCGSGIGDVLMELWFLFVWLDTLCE |
Ga0307944_11265171 | 3300031396 | Saline Water | AGSERKVIAVVCGSGIGDVLIELWFLFVWLDTLCE |
Ga0307944_11728811 | 3300031396 | Saline Water | AGSERQVVAVICGSGIGDVLIELWFLFVWLDTLCE |
Ga0307960_100476314 | 3300031397 | Saline Water | SWLVGAGSERQVIAVVCGSGIGDVLIELWFLFVWLDTLCE |
Ga0307960_10607831 | 3300031397 | Saline Water | MDAGSERQVIIAVVCGSGIGDVLIELWFLFVRLDTLCE |
Ga0307960_11027141 | 3300031397 | Saline Water | LVGAGSERQVIAVVCGSGIGDVLIELWFLFAWLDTLCE |
Ga0307968_100194523 | 3300031399 | Saline Water | VGAGSERQIIIAVVCGSGIGDVLIELWFLFVWLDTLCE |
Ga0307968_100208729 | 3300031399 | Saline Water | AGSERQVIAVVCGSGIGDVLIELWFLFVWLDTLCE |
Ga0307968_10126449 | 3300031399 | Saline Water | VAGWLVGAGSERQVIAVVCGNGIGDVLIELWFFFDWLNTLCE |
Ga0307968_10420525 | 3300031399 | Saline Water | VANWLVGAGSERKVIAVVCGSGIGDVLIELWFLFVWLDTLCE |
Ga0307945_10069292 | 3300031404 | Saline Water | VGAGSERQVIIAVVCGSGIGDVLIESWFLFVWLDTLCE |
Ga0307945_10230616 | 3300031404 | Saline Water | WSWERVASWLVGAGSERQVIAAVCGSGIGDVLMEFWFLFVWLDTLCE |
Ga0307945_10310844 | 3300031404 | Saline Water | AGWLVGAGSERQVIAVVCGNGIGDVLIELWFFFDWLNTLCE |
Ga0307930_10924432 | 3300031600 | Saline Water | VGVGSERQAIAVVCGSGIGDVLIELWFLFLRLDRYPL |
Ga0307930_11527162 | 3300031600 | Saline Water | ERVANWLVGAGSERQVIAVVCGSGVGDVLIELWLFCVWLNTLCE |
Ga0307966_11898161 | 3300031607 | Saline Water | SWERVASWLVAAGSERQVIAVVCGSGIGDVLIKLWFLCNWLDALCE |
Ga0307966_12649031 | 3300031607 | Saline Water | VASWLVGAGSEKQVIAVVCGSGIGNVLMELWFLFVWLDILCE |
Ga0307966_13559552 | 3300031607 | Saline Water | SWLVGAGSERQVIAVVCGSGIGDVLIELWFLFVWLDTLCK |
Ga0307946_11107622 | 3300031684 | Saline Water | VAAGSESQVIAVVCGNDIGDVLIELWFLFVWLDTLCE |
Ga0307946_11340041 | 3300031684 | Saline Water | MGAGSERRVIAVVCGSGIGDVLIESLFLFVWLDTLCE |
Ga0307943_10783802 | 3300031704 | Saline Water | VTSWLVGAGSERQIIAVVCGSGIGDVLIELWFLFVWFDTLCE |
Ga0307943_11127101 | 3300031704 | Saline Water | WERVASWLVGAGSERQVIAVVCGNGIGDVLIELWFLFVWLDTLCE |
Ga0307943_11908731 | 3300031704 | Saline Water | VGAGSERQVIAVVCGSGIGDVLIESWFLFVWLDTH |
Ga0307943_12028602 | 3300031704 | Saline Water | WERVASWLMDAGSERQVIIAVVCGSGIGDVLIELWFLFVRLDTLCE |
⦗Top⦘ |