NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F089362

Metagenome / Metatranscriptome Family F089362

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F089362
Family Type Metagenome / Metatranscriptome
Number of Sequences 109
Average Sequence Length 46 residues
Representative Sequence FGVASADTRVPQPGTAGYQRYRPGVRGLRDRVARLLDAVSGPTGLGP
Number of Associated Samples 103
Number of Associated Scaffolds 109

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.08 %
% of genes from short scaffolds (< 2000 bps) 91.74 %
Associated GOLD sequencing projects 101
AlphaFold2 3D model prediction Yes
3D model pTM-score0.36

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.330 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(22.936 % of family members)
Environment Ontology (ENVO) Unclassified
(22.018 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(54.128 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 21.33%    β-sheet: 0.00%    Coil/Unstructured: 78.67%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.36
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 109 Family Scaffolds
PF01906YbjQ_1 96.33
PF00557Peptidase_M24 1.83
PF136224HBT_3 0.92

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 109 Family Scaffolds
COG0393Uncharacterized pentameric protein YbjQ, UPF0145 familyFunction unknown [S] 96.33


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.25 %
UnclassifiedrootN/A2.75 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002245|JGIcombinedJ26739_101409095All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300003296|Ga0006840J48914_120940All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300004620|Ga0068957_1007770All Organisms → cellular organisms → Bacteria → Terrabacteria group1009Open in IMG/M
3300004629|Ga0008092_11324596Not Available865Open in IMG/M
3300005338|Ga0068868_101880743All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia566Open in IMG/M
3300005364|Ga0070673_101773207All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300005444|Ga0070694_100395609All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1081Open in IMG/M
3300005529|Ga0070741_11247264All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia625Open in IMG/M
3300005566|Ga0066693_10145310All Organisms → cellular organisms → Bacteria → Terrabacteria group888Open in IMG/M
3300005574|Ga0066694_10616466All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300005586|Ga0066691_10215307All Organisms → Viruses → Predicted Viral1122Open in IMG/M
3300006052|Ga0075029_100261484All Organisms → cellular organisms → Bacteria → Terrabacteria group1095Open in IMG/M
3300006172|Ga0075018_10718522All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300006579|Ga0074054_12176915All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia912Open in IMG/M
3300006606|Ga0074062_12965587All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1013Open in IMG/M
3300006860|Ga0063829_1484514All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2132Open in IMG/M
3300006904|Ga0075424_100929909All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia927Open in IMG/M
3300006904|Ga0075424_102099683All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia595Open in IMG/M
3300009090|Ga0099827_11349480All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300009137|Ga0066709_104275873All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces521Open in IMG/M
3300009683|Ga0116224_10104511All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae → Actinospica → Actinospica robiniae1372Open in IMG/M
3300010047|Ga0126382_11254988All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300010358|Ga0126370_11740684All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300010359|Ga0126376_12722267All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300010361|Ga0126378_11698977All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300010861|Ga0126349_1042656All Organisms → cellular organisms → Bacteria769Open in IMG/M
3300010937|Ga0137776_1156190All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1489Open in IMG/M
3300011060|Ga0138583_1110029All Organisms → cellular organisms → Bacteria → Terrabacteria group995Open in IMG/M
3300011067|Ga0138594_1019216All Organisms → cellular organisms → Bacteria → Terrabacteria group1016Open in IMG/M
3300011073|Ga0138584_1057802All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii2011Open in IMG/M
3300011076|Ga0138574_1106241All Organisms → cellular organisms → Bacteria3148Open in IMG/M
3300011119|Ga0105246_10707962All Organisms → cellular organisms → Bacteria → Terrabacteria group883Open in IMG/M
3300011120|Ga0150983_11438970All Organisms → cellular organisms → Bacteria → Terrabacteria group1003Open in IMG/M
3300011120|Ga0150983_12007866All Organisms → cellular organisms → Bacteria735Open in IMG/M
3300012285|Ga0137370_10864885All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300012357|Ga0137384_10098476All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2440Open in IMG/M
3300012357|Ga0137384_10876981All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300012361|Ga0137360_11388850All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300012362|Ga0137361_11709091All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300012489|Ga0157349_1006260All Organisms → cellular organisms → Bacteria → Terrabacteria group857Open in IMG/M
3300012493|Ga0157355_1001551All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora → Catenulispora acidiphila1198Open in IMG/M
3300012957|Ga0164303_10170652All Organisms → cellular organisms → Bacteria → Terrabacteria group1174Open in IMG/M
3300013104|Ga0157370_12119413All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300015373|Ga0132257_104228053All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300017937|Ga0187809_10417716All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300017966|Ga0187776_11240966All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300018029|Ga0187787_10318250All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300018058|Ga0187766_11029617All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300018062|Ga0187784_10648598All Organisms → cellular organisms → Bacteria847Open in IMG/M
3300020004|Ga0193755_1097180All Organisms → cellular organisms → Bacteria → Terrabacteria group934Open in IMG/M
3300020078|Ga0206352_10199668All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300020170|Ga0179594_10359663All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300020582|Ga0210395_11296071All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300021361|Ga0213872_10360691All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300021432|Ga0210384_10466083All Organisms → cellular organisms → Bacteria → Terrabacteria group1137Open in IMG/M
3300021433|Ga0210391_10612985Not Available854Open in IMG/M
3300021445|Ga0182009_10681892All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300021478|Ga0210402_10294569All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora → Catenulispora acidiphila1501Open in IMG/M
3300021478|Ga0210402_10990258All Organisms → cellular organisms → Bacteria767Open in IMG/M
3300021479|Ga0210410_11269868All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300022525|Ga0242656_1033789All Organisms → cellular organisms → Bacteria829Open in IMG/M
3300022533|Ga0242662_10191233All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300022709|Ga0222756_1056614All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. DvalAA-14598Open in IMG/M
3300024279|Ga0247692_1021576All Organisms → cellular organisms → Bacteria → Terrabacteria group982Open in IMG/M
3300024290|Ga0247667_1025058All Organisms → cellular organisms → Bacteria → Terrabacteria group1145Open in IMG/M
3300024325|Ga0247678_1049107All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300025527|Ga0208714_1062080All Organisms → cellular organisms → Bacteria788Open in IMG/M
3300025907|Ga0207645_10289345All Organisms → cellular organisms → Bacteria → Terrabacteria group1089Open in IMG/M
3300025910|Ga0207684_10051250All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora → Catenulispora acidiphila3502Open in IMG/M
3300025913|Ga0207695_11434975All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300027090|Ga0208604_1000957All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2862Open in IMG/M
3300027307|Ga0209327_1008146All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora → Catenulispora acidiphila1268Open in IMG/M
3300027401|Ga0208637_1003463All Organisms → cellular organisms → Bacteria → Terrabacteria group1363Open in IMG/M
3300027692|Ga0209530_1034521All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora → Catenulispora acidiphila1503Open in IMG/M
3300027725|Ga0209178_1233869All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300027826|Ga0209060_10019101All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3645Open in IMG/M
3300027853|Ga0209274_10438838All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300027882|Ga0209590_10364220All Organisms → cellular organisms → Bacteria → Terrabacteria group932Open in IMG/M
3300027911|Ga0209698_11437420All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300028146|Ga0247682_1025373All Organisms → cellular organisms → Bacteria → Terrabacteria group1045Open in IMG/M
3300028787|Ga0307323_10019199All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2327Open in IMG/M
3300028787|Ga0307323_10127894All Organisms → cellular organisms → Bacteria → Terrabacteria group915Open in IMG/M
3300028789|Ga0302232_10151410All Organisms → cellular organisms → Bacteria → Terrabacteria group1169Open in IMG/M
3300028801|Ga0302226_10462735All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300028807|Ga0307305_10093440All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora → Catenulispora acidiphila1389Open in IMG/M
3300028881|Ga0307277_10526927All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300028906|Ga0308309_11773317All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300029636|Ga0222749_10394464All Organisms → cellular organisms → Bacteria732Open in IMG/M
3300029951|Ga0311371_12385753All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300030007|Ga0311338_10885129Not Available879Open in IMG/M
3300030503|Ga0311370_10892547All Organisms → cellular organisms → Bacteria → Terrabacteria group1008Open in IMG/M
3300030529|Ga0210284_1067268All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300030602|Ga0210254_10644648All Organisms → cellular organisms → Bacteria → Terrabacteria group988Open in IMG/M
3300030617|Ga0311356_10691897All Organisms → cellular organisms → Bacteria → Terrabacteria group977Open in IMG/M
3300030904|Ga0308198_1006338All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora → Catenulispora acidiphila1312Open in IMG/M
3300031040|Ga0265754_1008641All Organisms → cellular organisms → Bacteria768Open in IMG/M
3300031474|Ga0170818_114818581All Organisms → cellular organisms → Bacteria666Open in IMG/M
3300031572|Ga0318515_10608761All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300031640|Ga0318555_10385414All Organisms → cellular organisms → Bacteria759Open in IMG/M
3300031796|Ga0318576_10431526All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300031799|Ga0318565_10545568All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300031846|Ga0318512_10700554All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300031894|Ga0318522_10047956All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora → Catenulispora acidiphila1502Open in IMG/M
3300032008|Ga0318562_10450589All Organisms → cellular organisms → Bacteria747Open in IMG/M
3300032008|Ga0318562_10641228All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300032054|Ga0318570_10017135All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2683Open in IMG/M
3300032805|Ga0335078_12443173All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300032828|Ga0335080_11265586All Organisms → cellular organisms → Bacteria738Open in IMG/M
3300032955|Ga0335076_10252753All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora → Catenulispora acidiphila1656Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil22.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.34%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.34%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil7.34%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil5.50%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa5.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.67%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.67%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.67%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.75%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.75%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.83%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil1.83%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.83%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.83%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.83%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.92%
SedimentEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment0.92%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.92%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.92%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.92%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.92%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.92%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.92%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.92%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.92%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.92%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.92%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.92%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300003296Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 41 (Metagenome Metatranscriptome, Counting Only)EnvironmentalOpen in IMG/M
3300004620Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 49 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004629Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A01 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006579Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006606Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006860Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 63 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010861Boreal forest soil eukaryotic communities from Alaska, USA - C4-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010937Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139EnvironmentalOpen in IMG/M
3300011060Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 73 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011067Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 41 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011073Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 74 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011076Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 59 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012489Unplanted soil (control) microbial communities from North Carolina - M.Soil.5.yng.040610EnvironmentalOpen in IMG/M
3300012493Unplanted soil (control) microbial communities from North Carolina - M.Soil.10.yng.090610EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300018029Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MGEnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300020004Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2EnvironmentalOpen in IMG/M
3300020078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021361Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2Host-AssociatedOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300022525Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022533Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022709Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024279Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK33EnvironmentalOpen in IMG/M
3300024290Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08EnvironmentalOpen in IMG/M
3300024325Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK19EnvironmentalOpen in IMG/M
3300025527Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027090Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF016 (SPAdes)EnvironmentalOpen in IMG/M
3300027307Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027401Soil and rhizosphere microbial communities from Laval, Canada - mgLAC (SPAdes)EnvironmentalOpen in IMG/M
3300027692Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027826Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028146Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK23EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028789Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3EnvironmentalOpen in IMG/M
3300028801Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030529Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO740-VDE013SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030602Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR018SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030617II_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030904Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_202 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031040Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE6 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGIcombinedJ26739_10140909523300002245Forest SoilRFERGEFGVASAEARISMPGTPGHQRYRPGVRGLRDRVARLLDAVSGPTDS*
Ga0006840J48914_12094023300003296Peatlands SoilFGVASADARIPQPGMTGYQRYRPGMRGLRDRVARLLDAVSGPTGS*
Ga0068957_100777013300004620Peatlands SoilERFERGEFGVASADARIPQPGMTGYQRYRPGMRGLRDRVARLLDAVSGPTGS*
Ga0008092_1132459613300004629Tropical Rainforest SoilVASDQARVPQPGTVGYQRYRPGVRGLKDRVARLLDAVTGPTG*
Ga0068868_10188074323300005338Miscanthus RhizosphereGEFGVASADTRVPQPGTAGYQRYRPGVRGLRDRVARLLDAVSGPTGLGP*
Ga0070673_10177320723300005364Switchgrass RhizosphereGEIGAAERFERGEFGVASADTRVPQPGTAGYQRYRPGVRGLRDRVARLLDAVSGPTGLGP
Ga0070694_10039560913300005444Corn, Switchgrass And Miscanthus RhizosphereERFERGEFGVASADTRVPQPGTAGYQRYRPGVRGLRDRVARLLDAVSGPTGLGP*
Ga0070741_1124726413300005529Surface SoilGAAENPGGGEFGVASAAGRTPPVEIPAYQRYRSGVRGLRDRVARLLDAVSGPNP*
Ga0066693_1014531013300005566SoilPQPGMVGYQRYRPGMRGLRDRVARLLDVVSGPAG*
Ga0066694_1061646623300005574SoilDTRVPQPGMVGYQRYRPGMRGLRDRVARLLDVVSGPNG*
Ga0066691_1021530713300005586SoilRGEFGVVSADRRMAQSGVAEYPRYRPGVRGLRDRVARLLDVVSGPTP*
Ga0075029_10026148423300006052WatershedsEIGAAERFERGEFGVASADARIPQPGTAGYQRYRPGMRGLRDRVARLLDVVSGPTGS*
Ga0075018_1071852223300006172WatershedsIPIPGTPGYQRYRPGVRGLRDRVARLLDAVSGPTDS*
Ga0074054_1217691523300006579SoilVPQPGTAGYQRYRPGMRGLRDRVARLLDAVSGPTGLGP*
Ga0074062_1296558713300006606SoilAAWIVPQPGTAGYQRYRPGMRGLRDRVARLLDAVSGPTGLGP*
Ga0063829_148451443300006860Peatlands SoilFERGEFGVASADARIPQPGMTGYQRYRPGMRGLRDRVARLLDAVSGPTGS*
Ga0075424_10092990913300006904Populus RhizosphereVASADTRVPQPGTAGYQRYRPGVRGLRDRVARLLDAVSGPTGLGP*
Ga0075424_10209968313300006904Populus RhizosphereFGVASADTRVPQPGTAGYQRYRPGVRGLRDRVARLLDAVSGPTGLGP*
Ga0099827_1134948023300009090Vadose Zone SoilAGYQRYRPGVRGLRDRVARLLDVVSGPTGLGPRQP*
Ga0066709_10427587323300009137Grasslands SoilGAAERFERGERGEFGVASADTRVPQPGMVGYQRYRPGVRGLRDRVARLLDAVSGPTGLGP
Ga0116224_1010451113300009683Peatlands SoilAERFERGEFGVASADARIPQPGMTGYQRYRPGMRGLRDRVARLLDAVSGPTGS*
Ga0126382_1125498823300010047Tropical Forest SoilRGEFGVASEQPREPQPGMVGYQRYRPGVRGLRDRVARLLDAVSGPTGLGPP*
Ga0126370_1174068423300010358Tropical Forest SoilFERGEFGVAGADARVLQPGMAGYQRYRPGVRGLRDRVARLLDVVSGPTGLGP*
Ga0126376_1272226723300010359Tropical Forest SoilSSVGEIGAAERFERGEFGVASADARAPQPGTAGSQRYRPGVRGLRDRVARLLDAVSGPAG
Ga0126378_1169897723300010361Tropical Forest SoilVASADARVPQPGTAGSQRYRPGVRGLRDRVARLLDAVSGPTG*
Ga0126349_104265623300010861Boreal Forest SoilGAAERFERGEFGVASADTRVPQPGTAGYQRYRPGMRGLRDRVARLLDAVSGPTGLGP*
Ga0137776_115619033300010937SedimentEFGVASADARVPQPGMAGYQRHRTGMRGLRDRVARLLDAVSGPTG*
Ga0138583_111002913300011060Peatlands SoilIPQPGMTGYQRYRPGMRGLRDRVARLLDAVSGPTGS*
Ga0138594_101921613300011067Peatlands SoilRFERGEFGVASADARIPQPGMTGYQRYRPGMRGLRDRVARLLDAVSGPTGS*
Ga0138584_105780233300011073Peatlands SoilVGEIGAAERFERGEFGVASADARIPQPGMTGYQRYRPGMRGLRDRVARLLDAVSGPTGS*
Ga0138574_110624113300011076Peatlands SoilGEFGVASADARIPQPGMTRYQRYRPGMRGLRDRVARLLDAVSGPTGS*
Ga0105246_1070796213300011119Miscanthus RhizosphereQPGTAGYQRYRPGVRGLRDRVARLLDAVSGPTGLGP*
Ga0150983_1143897023300011120Forest SoilDGEFGLASAVGRGPQPGVTGYQRNRRPGVRGLRERVARLLDAVSGPTG*
Ga0150983_1200786623300011120Forest SoilASADSRVPQPGRGGYQRYRPGMRGLRDRVARLLDAVSGPTGLGP*
Ga0137370_1086488523300012285Vadose Zone SoilERFERGEFGVASTDTRVPQPGMVGYQRYRPGMRGLRDRVARLLDVVSGPNG*
Ga0137384_1009847653300012357Vadose Zone SoilAAERFERGEFGVASTDTRVPQPGMVGYQRYRPGMRGLRDRVARLLDVVSGPNG*
Ga0137384_1087698123300012357Vadose Zone SoilGVASADTRVPQPGTAGYQRYRPGVRGLRDRVARLLDAVSGPTGLDP*
Ga0137360_1138885013300012361Vadose Zone SoilTDTRVPQPGMVGYQRYRPGMRGLRDRVARLLDVVSGPNG*
Ga0137361_1170909123300012362Vadose Zone SoilRVPQPGMVGYPRYRPGVRGLRDRVARLLDVVSGPNG*
Ga0157349_100626013300012489Unplanted SoilARVPQPGMPGDQRHRTGVRGLRDRVARLLDAVSGPTGLGP*
Ga0157355_100155113300012493Unplanted SoilERFERGEFGVASADTRMPQPGTAGYQRYRPGVRGLRDRVARLLDAVSGPIGLGP*
Ga0164303_1017065213300012957SoilVGEIGAAERFERGEFGVASADTRVPQPGTAGYQRYRPGVRGLRDRVARLLDVVSGPTG*
Ga0157370_1211941323300013104Corn RhizospherePQPGMVGHQRYRPGVRGLRDRVARLLDAVSGPTGLGS*
Ga0132257_10422805323300015373Arabidopsis RhizosphereVPQPGMPGDQRHRTGVRGLRDRVARLLDAVSGPTGLGP*
Ga0187809_1041771613300017937Freshwater SedimentVGEIGAAERFERGEFGVASADARILQPGMIGYQRYRPGVRGLRDRVARLLDVVSGPTGS
Ga0187776_1124096623300017966Tropical PeatlandRFERGEFGVASADARMPQPGMVGQQRYRPGMRGLRDRVARLLDAVSGPTGSGP
Ga0187787_1031825023300018029Tropical PeatlandGEFGVASDQARVPQPGLVGYQRYRPGVRGLKDRVARLLDVVSGPTA
Ga0187766_1102961713300018058Tropical PeatlandARGPQPGMPGQQRYRPGVRGLRDRVARLLDAVSGPTG
Ga0187784_1064859813300018062Tropical PeatlandGRDAEFGVASADSRARRPGTSGYRRYRPGVRGLKDRVARLLDVVSGPNS
Ga0193755_109718013300020004SoilGVASADTRVPQPGTAGYQRYRPGMRGLRDRVARLLDAVSGPTGLGP
Ga0206352_1019966813300020078Corn, Switchgrass And Miscanthus RhizosphereRGEFGVASTDARVPQPGMAGYQRYRPGMRGLRDRVARLLDVVSGPAG
Ga0179594_1035966313300020170Vadose Zone SoilVASADTRVPQPGMVGYQRYRPGVRGLRDRVARLLDAVSGPTGLGL
Ga0210395_1129607123300020582SoilRFERGEFGVASAEARISMPGTPGHQRYRPGVRGLRDRVARLLDAVSGPTDS
Ga0213872_1036069113300021361RhizosphereASADARAARAGTTGHRRYRPGVRGLRDRLARLLDTVSGPAGQG
Ga0210384_1046608313300021432SoilFGVASADTRVPQPGTVGYQRYRPGVRGLRDRVARLLDVVSGPAG
Ga0210391_1061298523300021433SoilRGEFGVASAARQAATGTPAYQRYRPGVRGLRDRVARLLDVVSGPVP
Ga0182009_1068189213300021445SoilAETRVPQPGTAGYQRYRPGVRGLRDRVARLLDAVSGPTGLGP
Ga0210402_1029456933300021478SoilGEFGVASAEARISMPGTPGYQRYRPGVRGLRDRVARLLDAVSGPTDS
Ga0210402_1099025823300021478SoilTRVPQPGMVGYQRYRPGMRGLRDRVARLLDVVSGPNG
Ga0210410_1126986823300021479SoilGEIGAAERFERGEFGVASTDTRVPQPGMVGYQRYRPGMRGLRDRVARLLDVVSGPNG
Ga0242656_103378923300022525SoilEFGVASADSRVPQPGRVGYQRYRPGMRGLRDRVARLLDAVSGPAA
Ga0242662_1019123323300022533SoilDTRVPQPGMVGYQRYRPGMRGLRDRVARLLDVVSGPNG
Ga0222756_105661423300022709SoilGVASTDTRVPQPGMVGYQRYRPGMRGLRDRVARLLDVVSGPNG
Ga0247692_102157613300024279SoilAAERFERGEFGVASADTRVPQPGTAGYQRYRPGVRGLRDRVARLLDVVSGPTGLGP
Ga0247667_102505813300024290SoilRGEFGVASADTRVPQPGTAGYQRYRPGVRGLRDRVARLLDAVSGPTGLGP
Ga0247678_104910723300024325SoilPQPGTAGYQRYRPGVRGLRDRVARLLDAVSGPTGLGP
Ga0208714_106208023300025527Arctic Peat SoilEFGVASADARTPHPRVAGYQRYRPGVRGLRDRVARLLDAVSGPTGLGP
Ga0207645_1028934513300025907Miscanthus RhizosphereEIGAAERFERGEFGVASADTRVPQPGTAGYQRYRPGVRGLRDRVARLLDAVSGPTGLGP
Ga0207684_1005125013300025910Corn, Switchgrass And Miscanthus RhizosphereRYERREFGVASADTRVPQPGTVGYQRYRPGVRGLRDRVARLLDVVSGPTG
Ga0207695_1143497513300025913Corn RhizosphereTRVPQPGTAGYQRYRPGVRGLRDRVARLLDAVSGPTGLGP
Ga0208604_100095753300027090Forest SoilGGERRGAEEEFGVASPDSRVERPGTPGYQRYRPGVRGLRDRVAHLLDVVSGPNP
Ga0209327_100814633300027307Forest SoilQPGTPGYQRYRPGVRGLRDRVARLLDAVSGPTGLGP
Ga0208637_100346333300027401SoilGAAERFERGEFGVASADTRVPQPGTAGYQRYRPGMRGLRDRVARLLDAVSGPTGLGP
Ga0209530_103452133300027692Forest SoilDRPEGFGNAEFGVASAYGRTPPPGSQGYQRYRPGVRGLRDRVARLLDTVSGPNP
Ga0209178_123386913300027725Agricultural SoilVASTDARVPQPGMVGYQRYRPGVRGLRDRVARLLDAVSGPNG
Ga0209060_1001910113300027826Surface SoilDGPRRDQEFGVAAGRVPPPADYQRHRTGVRSLRDRVARLLDAVSGPSA
Ga0209274_1043883823300027853SoilLDRNEEFGVASGDGRVERLGTTGYQRYRPGVRGLRDRVAHLLDVVSGPPS
Ga0209590_1036422013300027882Vadose Zone SoilAGYQRYRPGVRGLRDRVARLLDVVSGPTGLGPRQP
Ga0209698_1143742023300027911WatershedsVPQPGMAGYQRYRPGVRGLRDRVARLLDAVSGPTGLDP
Ga0247682_102537323300028146SoilVGEIGAAERFERGEFGVASADTRVPQPGTAGYQRYRPGVRGLRDRVARLLDAVSGPTGLG
Ga0307323_1001919943300028787SoilGEFGVASADTRVPQPGTAGYQRYRPGVRGLRDRVARLLDAVSGPTGLGP
Ga0307323_1012789423300028787SoilVASADTRVPQPGMVGHQRYRPGVRGLRDRVARLLDAVSGPTGLGP
Ga0302232_1015141013300028789PalsaSGDSVSRHQGMPGYQRYRPGVRGLRDRVARLLDAVSGPTA
Ga0302226_1046273523300028801PalsaGPQPGVPGYQRYRRPGVRGLRERVARLLDAVSGPTG
Ga0307305_1009344013300028807SoilPGTAGYQRYRPGVRGLRDRVARLLDAVSGPTGLGP
Ga0307277_1052692713300028881SoilFERGEFGVASADTRVPQPGMVGHQRYRPGVRGLRDRVARLLDAVSGPTGLGP
Ga0308309_1177331723300028906SoilLGRDGEFGVASADGRAGRERTQPGTPGYQRYRPGVRGLKDRVAHLLDVVSGPSA
Ga0222749_1039446423300029636SoilFERGEFGVASADSRVPQPGRVGYQRYRPGMRGLRDRVARLLDAVSGPTGLAP
Ga0311371_1238575323300029951PalsaASGDGVIRHPGMPGYQRYRPGVRGLRDRVARLLDAVSGPTA
Ga0311338_1088512923300030007PalsaDGVIRHPGMPGYQRYRPGVRGLRDRVARLLDAVSGPTA
Ga0311370_1089254723300030503PalsaEFGVASGDGVIRHQGMPGYQRYRPGVRGLRDRVARLLDAVSGPTA
Ga0210284_106726823300030529SoilFERGEFGVASADARVPQPGRAGYQRYRPGVRGLRDRVARLLDAVSGPTGLDP
Ga0210254_1064464813300030602SoilGEFGLASAVGRGPQPGVTGYQRNRRPGVRGLRERVARLLDAVSGPSG
Ga0311356_1069189713300030617PalsaGVASGDSVSRHQGMPGYQRYRPGVRGLRDRVARLLDAVSGPTA
Ga0308198_100633813300030904SoilPGMVGYQRYRPGVRGLRDRVARLLDAVSGPTGLGP
Ga0265754_100864113300031040SoilRVPQPGMAGYQRYRPGVRGLRDRVARLLDAVSGPTGLGP
Ga0170818_11481858113300031474Forest SoilERGDFGVASTDARVPQPGMVGYHRYRPGVRGLRDRVARLLDVVSGPTGLGP
Ga0318515_1060876113300031572SoilTDARVPQPGTAGYPRNRTGVRGLRDRVARLLDAVSGPAG
Ga0318555_1038541413300031640SoilASTDARMPQPGTAGSPHNRTGVRGLRDRVARLLDAVSGPAG
Ga0318576_1043152613300031796SoilFERGEFGVASADARVPQPGTTGYQRRRTGVRGLRDRVARLLDAVSGPAGLGS
Ga0318565_1054556823300031799SoilELGEFGVASADARAAQPGTPGHQRYRPGVRGLRDRVARLLDVVSGPTGSLPGPEDLRS
Ga0318512_1070055413300031846SoilASADARVPQPGAAGYQRYRSGVRGLRDRVARLLDAVSGPAG
Ga0318522_1004795613300031894SoilASADARVPQPGTAGYQRHRSGMRGLRDRVARLLDAVSGPAGLGS
Ga0318562_1045058923300032008SoilARVPQPGTTGYQRRRTGVRGLRDRVARLLDAVSGPAGLGS
Ga0318562_1064122823300032008SoilVASADARVPQPGAVGYQRYRSGVRGLRDRVARLLDAVSGPAG
Ga0318570_1001713553300032054SoilFERGEFGVASADARVPQPGAAGSQRYRPGVRGLRDRVARLLDAVSGPTG
Ga0335078_1244317323300032805SoilLGEFGVASPDARAPQTGTPGYQRYRPGVRGLRDRVARLLDAVSGPTGS
Ga0335080_1126558623300032828SoilGEFGVASADTRVPQPGTVGYQRYRTGVRGLRDRVARLLDAVSGPAG
Ga0335076_1025275333300032955SoilARVPQPGMPGDQRHRTGVRGLRDRVARLLDAVSGPAGLGP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.