Basic Information | |
---|---|
Family ID | F089198 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 109 |
Average Sequence Length | 42 residues |
Representative Sequence | WVYSTADRRAYMNQLGACRVEELGVKQHAYAAQTDFGY |
Number of Associated Samples | 108 |
Number of Associated Scaffolds | 109 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 91.74 % |
Associated GOLD sequencing projects | 101 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.28 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (96.330 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (9.174 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.440 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.706 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.45% β-sheet: 0.00% Coil/Unstructured: 54.55% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 109 Family Scaffolds |
---|---|---|
PF00581 | Rhodanese | 39.45 |
PF01799 | Fer2_2 | 27.52 |
PF00111 | Fer2 | 7.34 |
PF00925 | GTP_cyclohydro2 | 6.42 |
PF02738 | MoCoBD_1 | 5.50 |
PF01315 | Ald_Xan_dh_C | 4.59 |
PF03544 | TonB_C | 1.83 |
PF07883 | Cupin_2 | 0.92 |
PF03979 | Sigma70_r1_1 | 0.92 |
PF13085 | Fer2_3 | 0.92 |
COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
---|---|---|---|
COG0807 | GTP cyclohydrolase II | Coenzyme transport and metabolism [H] | 6.42 |
COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 1.83 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.92 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 96.33 % |
Unclassified | root | N/A | 3.67 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002568|C688J35102_118011839 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300004081|Ga0063454_101998013 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300004091|Ga0062387_100162748 | All Organisms → cellular organisms → Bacteria | 1301 | Open in IMG/M |
3300004156|Ga0062589_102205475 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300005175|Ga0066673_10754670 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300005179|Ga0066684_11034562 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
3300005187|Ga0066675_11273139 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300005290|Ga0065712_10440710 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
3300005334|Ga0068869_101982076 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300005338|Ga0068868_100444598 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1126 | Open in IMG/M |
3300005468|Ga0070707_101462554 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 650 | Open in IMG/M |
3300005533|Ga0070734_10660736 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300005534|Ga0070735_10365698 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
3300005539|Ga0068853_100249063 | All Organisms → cellular organisms → Bacteria | 1630 | Open in IMG/M |
3300005554|Ga0066661_10931560 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300005555|Ga0066692_10148697 | All Organisms → cellular organisms → Bacteria | 1437 | Open in IMG/M |
3300005561|Ga0066699_10375382 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
3300005563|Ga0068855_100418240 | All Organisms → cellular organisms → Bacteria | 1466 | Open in IMG/M |
3300005564|Ga0070664_100076616 | All Organisms → cellular organisms → Bacteria | 2874 | Open in IMG/M |
3300005575|Ga0066702_10537300 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 708 | Open in IMG/M |
3300005577|Ga0068857_101419733 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
3300005587|Ga0066654_10237977 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
3300005614|Ga0068856_100182897 | Not Available | 2109 | Open in IMG/M |
3300005614|Ga0068856_101854267 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300005616|Ga0068852_100821714 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
3300005888|Ga0075289_1087335 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300005896|Ga0075282_1051726 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
3300006028|Ga0070717_10344734 | All Organisms → cellular organisms → Bacteria | 1331 | Open in IMG/M |
3300006052|Ga0075029_100574517 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
3300006176|Ga0070765_100420770 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1249 | Open in IMG/M |
3300006755|Ga0079222_11710943 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 603 | Open in IMG/M |
3300006804|Ga0079221_10215754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1063 | Open in IMG/M |
3300006954|Ga0079219_10463354 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
3300009012|Ga0066710_103188402 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300009093|Ga0105240_12333146 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300009098|Ga0105245_10552740 | Not Available | 1173 | Open in IMG/M |
3300009137|Ga0066709_102408193 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
3300009174|Ga0105241_11606757 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
3300009683|Ga0116224_10327065 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 729 | Open in IMG/M |
3300009700|Ga0116217_10089784 | All Organisms → cellular organisms → Bacteria | 2119 | Open in IMG/M |
3300010048|Ga0126373_11462563 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
3300010366|Ga0126379_10423255 | All Organisms → cellular organisms → Bacteria | 1386 | Open in IMG/M |
3300010396|Ga0134126_12664630 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300012189|Ga0137388_10120424 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2284 | Open in IMG/M |
3300012205|Ga0137362_10709410 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 864 | Open in IMG/M |
3300012208|Ga0137376_10858428 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 780 | Open in IMG/M |
3300012285|Ga0137370_10417293 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
3300012931|Ga0153915_12866613 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300012944|Ga0137410_11731203 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300012957|Ga0164303_10982708 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300012958|Ga0164299_11393518 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300012984|Ga0164309_11483371 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300012985|Ga0164308_11385778 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300013105|Ga0157369_10100095 | All Organisms → cellular organisms → Bacteria | 3090 | Open in IMG/M |
3300013307|Ga0157372_13409428 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
3300014154|Ga0134075_10287544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 715 | Open in IMG/M |
3300014165|Ga0181523_10743441 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300014325|Ga0163163_10448607 | All Organisms → cellular organisms → Bacteria | 1350 | Open in IMG/M |
3300016270|Ga0182036_11091534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 660 | Open in IMG/M |
3300017930|Ga0187825_10369755 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300017936|Ga0187821_10086814 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
3300018038|Ga0187855_10136395 | All Organisms → cellular organisms → Bacteria | 1468 | Open in IMG/M |
3300018090|Ga0187770_11270303 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
3300018433|Ga0066667_10853679 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
3300018468|Ga0066662_10670599 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
3300020012|Ga0193732_1069360 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
3300020022|Ga0193733_1101200 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
3300020581|Ga0210399_11552945 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
3300020583|Ga0210401_10469618 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
3300021403|Ga0210397_10089192 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2061 | Open in IMG/M |
3300021407|Ga0210383_10644143 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 912 | Open in IMG/M |
3300021479|Ga0210410_11729156 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
3300025898|Ga0207692_11083292 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300025905|Ga0207685_10691497 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300025916|Ga0207663_11728823 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300025920|Ga0207649_11002124 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
3300025924|Ga0207694_11795974 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300025929|Ga0207664_10070652 | All Organisms → cellular organisms → Bacteria | 2810 | Open in IMG/M |
3300025998|Ga0208651_1019984 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300026022|Ga0208649_1003226 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1189 | Open in IMG/M |
3300026142|Ga0207698_11326134 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
3300026298|Ga0209236_1239779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 607 | Open in IMG/M |
3300026309|Ga0209055_1055989 | All Organisms → cellular organisms → Bacteria | 1684 | Open in IMG/M |
3300026310|Ga0209239_1270626 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
3300026542|Ga0209805_1291766 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
3300026548|Ga0209161_10188137 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1157 | Open in IMG/M |
3300027667|Ga0209009_1064550 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 919 | Open in IMG/M |
3300027812|Ga0209656_10377759 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
3300027882|Ga0209590_10978590 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300027910|Ga0209583_10098384 | All Organisms → cellular organisms → Bacteria | 1123 | Open in IMG/M |
3300027986|Ga0209168_10255246 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 867 | Open in IMG/M |
3300028828|Ga0307312_10318881 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
3300028884|Ga0307308_10427222 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300029636|Ga0222749_10237086 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 924 | Open in IMG/M |
3300030707|Ga0310038_10059440 | All Organisms → cellular organisms → Bacteria | 2119 | Open in IMG/M |
3300030838|Ga0311335_10044717 | All Organisms → cellular organisms → Bacteria | 2750 | Open in IMG/M |
3300031057|Ga0170834_101498840 | Not Available | 702 | Open in IMG/M |
3300031231|Ga0170824_117054212 | Not Available | 696 | Open in IMG/M |
3300031820|Ga0307473_10303678 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
3300031939|Ga0308174_10184678 | All Organisms → cellular organisms → Bacteria | 1579 | Open in IMG/M |
3300031941|Ga0310912_10844568 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 706 | Open in IMG/M |
3300031945|Ga0310913_10868395 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300032174|Ga0307470_10318000 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
3300032180|Ga0307471_103530049 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300032783|Ga0335079_10273835 | All Organisms → cellular organisms → Bacteria | 1849 | Open in IMG/M |
3300032829|Ga0335070_11632523 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300032892|Ga0335081_10828254 | All Organisms → cellular organisms → Bacteria | 1101 | Open in IMG/M |
3300033412|Ga0310810_10677667 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
3300034820|Ga0373959_0191540 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.17% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.26% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.34% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 6.42% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.50% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.50% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.59% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 3.67% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.75% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.75% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.75% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.75% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.75% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.75% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.75% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.83% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.83% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.83% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.83% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.83% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.83% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.83% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.83% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.92% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.92% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.92% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.92% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.92% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.92% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.92% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.92% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.92% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.92% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.92% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.92% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.92% |
Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.92% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005888 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103 | Environmental | Open in IMG/M |
3300005896 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_204 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300020012 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s1 | Environmental | Open in IMG/M |
3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025998 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_204 (SPAdes) | Environmental | Open in IMG/M |
3300026022 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_201 (SPAdes) | Environmental | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
3300030838 | I_Fen_N1 coassembly | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
C688J35102_1180118392 | 3300002568 | Soil | AWLQRWVDGIADRKAYMNQLGACRIEDLAVKNHAYAAPTDFGY* |
Ga0063454_1019980131 | 3300004081 | Soil | RWVYGVADRAAYMNQLGACRVDELSVKQHAYAAQTDFGY* |
Ga0062387_1001627481 | 3300004091 | Bog Forest Soil | AWLDRWVYSTADRRLYMNQLGACRVEELGVKQHAYAAQADFGY* |
Ga0062589_1022054752 | 3300004156 | Soil | QRWVHDVADRQAYMDQMGGCRVEDLGVKQHAYAAQTDFGY* |
Ga0066673_107546701 | 3300005175 | Soil | ERWVYGVRDRAEYVERLGARAEELRVKQHAYAAQADFGY* |
Ga0066684_110345621 | 3300005179 | Soil | WLDRWVYGLEDRAAYMNQLGGCRVKDLAVKQHVYAAATDFGY* |
Ga0066675_112731392 | 3300005187 | Soil | DSDAWLERWIYSVPDRRAYMNQLGACRVEELAVKQHAYAAQTDYGC* |
Ga0065712_104407101 | 3300005290 | Miscanthus Rhizosphere | WLNRWVYGVSDRRAYVNQLGGCRVEELGVKQHAYAAATDYGY* |
Ga0068869_1019820761 | 3300005334 | Miscanthus Rhizosphere | NRWVYGVSDRRAYVNQLGGCRVEELGVKQHAYAVATDYGY* |
Ga0068868_1004445981 | 3300005338 | Miscanthus Rhizosphere | QYHENTKTLGDSEAWLQRWVYAVADRAGYMSQLGTCRVADLAVKHHAYAAPTEFGY* |
Ga0070707_1014625541 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | DRWVYGLEDRAAYMNQLGGCRVEDLAVKQHAYAAQTDFGY* |
Ga0070734_106607361 | 3300005533 | Surface Soil | EAWLSRWVYALSDRREYTNQLGACRVGELGVKQHAYAAQADFGY* |
Ga0070735_103656983 | 3300005534 | Surface Soil | NTWLRDWVYSLPDRQAYIEQRGTDRIGALGVKQHAYAAQADFGY* |
Ga0068853_1002490631 | 3300005539 | Corn Rhizosphere | RWVNGVADRSEYVKLLGAARVEDLGVKQHAYAAQTDYGY* |
Ga0066661_109315602 | 3300005554 | Soil | DSDAWLERWVYSVPDRRAYMNQLGACRVEELDVKQHAYAAQTDYGY* |
Ga0066692_101486971 | 3300005555 | Soil | VEDRRAYINQLGACRVEELGVKQHAYAASTDYGY* |
Ga0066699_103753821 | 3300005561 | Soil | SDSDAWLERWVYSVPDRRAYMNQLGACRVEELDVKQHAYAAQTDYGY* |
Ga0068855_1004182401 | 3300005563 | Corn Rhizosphere | TKADSEAWLNRWVYGVSDRRAYMNQIGACRLEELGVKQHAYAAATDYGY* |
Ga0070664_1000766161 | 3300005564 | Corn Rhizosphere | KTQADSDAWLQRWVHGVADRQAYVNQLGGCRVEDLGVKQHAYAAQADFGY* |
Ga0066702_105373001 | 3300005575 | Soil | WVRGVKDRKEYMNLLGGCRVEELGVKQHAYAAAADFGY* |
Ga0068857_1014197331 | 3300005577 | Corn Rhizosphere | IYGIDDCAAYARQLGSGRVDELSVKQHAYAAETDYGY* |
Ga0066654_102379771 | 3300005587 | Soil | STPDRQAYLDQLGADRVEALGVKEHAYAAQADFGY* |
Ga0068856_1001828974 | 3300005614 | Corn Rhizosphere | LDSDAWLQRWVYAVADRAGYMSQLGTCRVADLAVKHHAYAAPTEFGY* |
Ga0068856_1018542673 | 3300005614 | Corn Rhizosphere | TEAWLQRWVYGTADRSEYVNRLGKCRVEGLGVKQHAYAAATDFGY* |
Ga0068852_1008217143 | 3300005616 | Corn Rhizosphere | ETWLKRWVYEVADRKQYLSQLGACRVEELGVKQHAYAAQTDYGY* |
Ga0075289_10873352 | 3300005888 | Rice Paddy Soil | WVHGLADHRAYMNQLGACRVEALAVERHAYAAPTDFGY* |
Ga0075282_10517262 | 3300005896 | Rice Paddy Soil | WVHGVADCEHYVELLGGARVEALGVKQHAYAAATDFGY* |
Ga0070717_103447343 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | RVADRREYAKQLGSARVEDLGVKKHAYAEKTDYGY* |
Ga0075029_1005745173 | 3300006052 | Watersheds | AWLQRWVHSVADREAYMNQLGECRVEELSVKQHVFTAQTDFGY* |
Ga0070765_1004207701 | 3300006176 | Soil | TKTDSEAWLERWVYGLDDRTAYMNQLGDYRVEELAVKQHAYAAPTDFGY* |
Ga0079222_117109432 | 3300006755 | Agricultural Soil | RWVYGVEGRGAYMNQLGACRVEDLGVKQHAYAAQTDFGY* |
Ga0079221_102157543 | 3300006804 | Agricultural Soil | GVADCEQYVELLGGARVEALGVKQHAYAAATDYGY* |
Ga0079219_104633541 | 3300006954 | Agricultural Soil | WLNRWAYGVSDRRAYMNQIGACRAEELGVKQHAYAAATDYGY* |
Ga0066710_1031884021 | 3300009012 | Grasslands Soil | ADSNAWLERWVYSVADRRAYMNQLGACRVEELAVKQHAYAAQTDYGY |
Ga0105240_123331461 | 3300009093 | Corn Rhizosphere | QGDSEAWLQRWVHSMADRKAYVNQLGGCRVEELSVKQHAYAAQTDFGY* |
Ga0105245_105527401 | 3300009098 | Miscanthus Rhizosphere | EAWLQRWVYAVADRAGYMSQLGTCRVADLAVKHHAYAAPTEFGY* |
Ga0066709_1024081931 | 3300009137 | Grasslands Soil | YGVEDRRAYMNQLGACRVEELGVKQHAYAASTDYGY* |
Ga0105241_116067572 | 3300009174 | Corn Rhizosphere | WVHGFADRQAYMNQLGGCRVEDLGVKQHAYAAQADFGY* |
Ga0116224_103270652 | 3300009683 | Peatlands Soil | EAWLNHWIYNTPDRRAYMNQLGACRVEELGVKQHAYAAQADFGY* |
Ga0116217_100897843 | 3300009700 | Peatlands Soil | WVYSTADRRTYMNQLGACRVDDLGVKQHAYAAQADFGY* |
Ga0126373_114625631 | 3300010048 | Tropical Forest Soil | HGVKDREAYARLLGEDRVAELGVKSHAYAAQTDYGY* |
Ga0126379_104232553 | 3300010366 | Tropical Forest Soil | WISGVADREAYARQLGETRVADLGVKQHAYAAATDYGY* |
Ga0134126_126646301 | 3300010396 | Terrestrial Soil | KTQADSDAWLQRWVHGVADRQAYMNQLGGCRVEDLGVKQHAYAAQADFGY* |
Ga0137388_101204241 | 3300012189 | Vadose Zone Soil | AKADSDAWLQRCVYGVADRPAYMNQLGACRVEELGVKQHAYAAQTDFGY* |
Ga0137362_107094101 | 3300012205 | Vadose Zone Soil | VEDRRAYINRLGGCRLEDLGVKRHAYAAQTDFGY* |
Ga0137376_108584282 | 3300012208 | Vadose Zone Soil | RWVYGLEDRAAYMNQLGGCRVKDLAVKQHVYAAATDFGY* |
Ga0137370_104172933 | 3300012285 | Vadose Zone Soil | QTKTKADSDAWLERWIYSVPDRHAYMNQLGACRVEELSVKQHAYAVQTDYGY* |
Ga0153915_128666132 | 3300012931 | Freshwater Wetlands | AQRWVHGVTDRAGYVELLGECRVKELGVKRHAYAAAADYGY* |
Ga0137410_117312031 | 3300012944 | Vadose Zone Soil | KADGDAWLQRWIYEVEDRRAYINRLGGCRVEDLGVKRHAYAAQTDFGY* |
Ga0164303_109827083 | 3300012957 | Soil | WAYGVSDRRAYMNQIGACRAEELGVKQHAYAAATDYGY* |
Ga0164299_113935182 | 3300012958 | Soil | TKTRADNETWLKRWVYEVADRKQYLSQLGACRVEELGVKQHAYAAQTDYGY* |
Ga0164309_114833712 | 3300012984 | Soil | VHEIADRNAYINQLGACRVDGLGVKGHAYAAQADFGY* |
Ga0164308_113857781 | 3300012985 | Soil | WVHDVADRQAYMNQLGGCRVDDLGVKQHAYAAQTDFGY* |
Ga0157369_101000951 | 3300013105 | Corn Rhizosphere | TQADSDAWLQRWVHGVADRQAYMNQLGGCRIEDLGVKQHAYAAQADFGY* |
Ga0157372_134094282 | 3300013307 | Corn Rhizosphere | KWIYGVADREDYTRALGSSRVKELAVKQHAYAAATDYGY* |
Ga0134075_102875442 | 3300014154 | Grasslands Soil | WVYGVADRRAYMNQLGACRVDELSVKQHAYAAQTDFGY* |
Ga0181523_107434411 | 3300014165 | Bog | HWVYSTSDRRAYMNQLGACRVEDLGVKQHAYAAQTDFGY* |
Ga0163163_104486074 | 3300014325 | Switchgrass Rhizosphere | VSDRRAYVNQLGGCRVEELGVRQHAYAAATDYGY* |
Ga0182036_110915342 | 3300016270 | Soil | RWVYSISDRREYINRVGACRLDNLGVKQHAYAAQADFGY |
Ga0187825_103697551 | 3300017930 | Freshwater Sediment | KTKADFENWSARWIHGISDRRAYMNQLGACRVEELGVKNHAYAAATDFGY |
Ga0187821_100868144 | 3300017936 | Freshwater Sediment | LERWVYSIADRRAYMNQLGACRVDELGVKRHAFAAQTDYGY |
Ga0187855_101363951 | 3300018038 | Peatland | HWVYSTSDRRAYMNQLGACRVEDLGVKQHAYAAQTDFGY |
Ga0187770_112703031 | 3300018090 | Tropical Peatland | RWVYGLADRKAYMNRLGACRVDELGVKQHAYAAQADFGY |
Ga0066667_108536791 | 3300018433 | Grasslands Soil | KADSDAWLERWIYSVPDRHAYMNQLGACRVEELSVKQHAYAIQTDYGY |
Ga0066662_106705991 | 3300018468 | Grasslands Soil | GVGGVKDRKEYMNLLGGCRVQELGVKQHAYAAAADFGY |
Ga0193732_10693602 | 3300020012 | Soil | GVKDRKEYMNLLGGCRVEELGVKQHAYAAAADFGY |
Ga0193733_11012003 | 3300020022 | Soil | VYSVPDRRAYMNQLGACRVEELDVKQHAYAAQTDYGY |
Ga0210399_115529451 | 3300020581 | Soil | YDVADRRAYMNQLGACRVDNLGVKQHAYAAQADFGY |
Ga0210401_104696183 | 3300020583 | Soil | YKLADRRAYVNQLGTCRVDDLGVKQHAYAAQADFGY |
Ga0210397_100891924 | 3300021403 | Soil | DTEAWLKRWTHNVADRRAYMNQLGACRAEELGVKQHAYAVQTDFGY |
Ga0210383_106441431 | 3300021407 | Soil | QTKTKADSDAWLYRWVYSTADRRAYMNQLGACRVEELGVKQHAYAAQADFGY |
Ga0210410_117291561 | 3300021479 | Soil | SAVDRRAYMNQLGACRVEDLGVKQHAYAAQADFGY |
Ga0207692_110832921 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | WLQRWVYAVADRAGYMSQLGTCRVADLAVKHHAYAAPTEFGY |
Ga0207685_106914971 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | WLQRWVYGVRDRREYMNQLGACRAEELGVKQHAYAAATDYGY |
Ga0207663_117288231 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | AWLQRWVYAVADRAGYMNQLGACRVEDLAVKHHAYAAPTEFGY |
Ga0207649_110021242 | 3300025920 | Corn Rhizosphere | LQRWVHGVADRQAYMNQLGGCRVEDLGVKQHAYAAQADFGY |
Ga0207694_117959742 | 3300025924 | Corn Rhizosphere | TTTKADSEAWLNRWVYGVSDRRAYVNQLGGCRVEELGVKQHAYAAATDYGY |
Ga0207664_100706521 | 3300025929 | Agricultural Soil | GVADRGEYAKQLGAARVEELGVKQHAYAEKTDFGY |
Ga0208651_10199841 | 3300025998 | Rice Paddy Soil | WVHGVADCEHYVELLGGARVEALGVKQHAYAAATDFGY |
Ga0208649_10032261 | 3300026022 | Rice Paddy Soil | RWVYGVEDRAAYVNQLGKCRVEELGVKQHAYAAAADFGY |
Ga0207698_113261343 | 3300026142 | Corn Rhizosphere | TRADNETWLKRWVYEVADRKQYLSQLGACRVEELGVKQHAYAAQTDYGY |
Ga0209236_12397791 | 3300026298 | Grasslands Soil | WLDRWVYGLEDRAAYMNQLGGCRVKDLAVKQHVYAAATDFGY |
Ga0209055_10559894 | 3300026309 | Soil | TKTKADSDAWLERWIYSVPDRRAYMNQLGACRVEELAVKQHAYAAQTDYGY |
Ga0209239_12706261 | 3300026310 | Grasslands Soil | ADSDDWLDRWVYGLEDRTAYMNQLGGCRVEDLAVKQHAYAVATDFGY |
Ga0209805_12917662 | 3300026542 | Soil | DSDAWLERWVYSVPDRRAYMNQLGACRVEELDVKQHAYAAQTDYGY |
Ga0209161_101881371 | 3300026548 | Soil | WVYSVADRRAYMNQLGACRVEELAVKQHAYAAQTDYGY |
Ga0209009_10645501 | 3300027667 | Forest Soil | DTEAWLKRWIHNVADRRAYMNQLGACRVEELGVKQHAYAAQTDFGY |
Ga0209656_103777592 | 3300027812 | Bog Forest Soil | WVYSTADRRAYMNQLGACRVEELGVKQHAYAAQTDFGY |
Ga0209590_109785901 | 3300027882 | Vadose Zone Soil | GVEDRRAYMNQLGACRVEELGVKQHAYAASTDYGY |
Ga0209583_100983844 | 3300027910 | Watersheds | VYSVADRRAYINQLGGCRVDELGVRRHAYAAQTDFGY |
Ga0209168_102552462 | 3300027986 | Surface Soil | SNTWLRDWVYSLPDRQAYIEQRGTDRIGALGVKQHAYAAQADFGY |
Ga0307312_103188813 | 3300028828 | Soil | WVYGVADRKQYLNQLGACRVAELGVKRHAYAAQTDYGY |
Ga0307308_104272222 | 3300028884 | Soil | TKSDSDAWLERWVYSVPDRRAYMNQLGACRVEELDVKQHAYAAQTDYGY |
Ga0222749_102370861 | 3300029636 | Soil | LKRWTHNVADRRAYMNQLGACRAEELGVKQHAYAVQTDFGY |
Ga0310038_100594401 | 3300030707 | Peatlands Soil | KTKADSEAWLNHWIYNTPDRRAYMNQLGACRVEELGVKQHAYAAQADFGY |
Ga0311335_100447174 | 3300030838 | Fen | TNAWLERWVYGIGDRRAYMNQLGACRVEELGVKQHAYAAQADFGY |
Ga0170834_1014988401 | 3300031057 | Forest Soil | QYHEHTKTKPDSDAWLNRWVYSIADRRAYMNQLGACRVDELGVKQHAYAAQADFGY |
Ga0170824_1170542121 | 3300031231 | Forest Soil | HEHTKTKPDSDAWLNRWVYSIADRRAYMNQLGACRVDELGVKQHAYAAQADFGY |
Ga0307473_103036781 | 3300031820 | Hardwood Forest Soil | WLERWIYSVPDRRAYMNQLGACRVEELAVKQHAYAAQTDYGY |
Ga0308174_101846781 | 3300031939 | Soil | KRVHGVGDRDGYSKLLGSTRLQELAVKQHAYAAATDFGY |
Ga0310912_108445682 | 3300031941 | Soil | SISDRREYINRVGACRLDNLGVKQHAYAAQADFGY |
Ga0310913_108683951 | 3300031945 | Soil | SDAWLERWVYGICDRRDYMNQLGACRVDDLGVKQHAYAEKTDFGY |
Ga0307470_103180003 | 3300032174 | Hardwood Forest Soil | QADSDAWLQRWVHDVADRQAYMNQLGGCRVEDLGVKQHAYAAQTDFGY |
Ga0307471_1035300491 | 3300032180 | Hardwood Forest Soil | RWIYSVPDRRAYMNQLGACRVEELAVKQHAYAAQTDYGY |
Ga0335079_102738353 | 3300032783 | Soil | AWLERWVYGMADRRAYMNQLGACRVDELGVKQHAYAAATDYGY |
Ga0335070_116325231 | 3300032829 | Soil | WVYEIADRHAYVNQLGACRIDELGVKQHAYAAETDFGY |
Ga0335081_108282543 | 3300032892 | Soil | TQADTEAWLGRWVYNVSDRQEYMNQLGACRVEDLGVKQHAYAAQTDFGY |
Ga0310810_106776671 | 3300033412 | Soil | GVADRQAYVNQLGGCRVEDLGVKQHAYAAQADFGY |
Ga0373959_0191540_379_534 | 3300034820 | Rhizosphere Soil | TKTQADSDAWLQRWVHGFADRQAYMNQLGGCRVEDLGVKQHAYAAQADFGY |
⦗Top⦘ |