NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F089147

Metagenome / Metatranscriptome Family F089147

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F089147
Family Type Metagenome / Metatranscriptome
Number of Sequences 109
Average Sequence Length 51 residues
Representative Sequence KGIHVKRDKLPSIAYSEELISFAMSATLQSTDRRHGIVGQEGCHFQRDS
Number of Associated Samples 93
Number of Associated Scaffolds 109

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 8.33 %
% of genes near scaffold ends (potentially truncated) 92.66 %
% of genes from short scaffolds (< 2000 bps) 91.74 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction Yes
3D model pTM-score0.27

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.330 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(18.349 % of family members)
Environment Ontology (ENVO) Unclassified
(27.523 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(33.945 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 29.87%    β-sheet: 0.00%    Coil/Unstructured: 70.13%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.27
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 109 Family Scaffolds
PF09339HTH_IclR 82.57
PF13412HTH_24 5.50
PF00072Response_reg 0.92
PF14319Zn_Tnp_IS91 0.92
PF00239Resolvase 0.92
PF13546DDE_5 0.92
PF01370Epimerase 0.92
PF02867Ribonuc_red_lgC 0.92
PF13361UvrD_C 0.92

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 109 Family Scaffolds
COG0209Ribonucleotide reductase alpha subunitNucleotide transport and metabolism [F] 0.92
COG1961Site-specific DNA recombinase SpoIVCA/DNA invertase PinEReplication, recombination and repair [L] 0.92
COG2452Predicted site-specific integrase-resolvaseMobilome: prophages, transposons [X] 0.92

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.33 %
UnclassifiedrootN/A3.67 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000596|KanNP_Total_noBrdU_T14TCDRAFT_1009909All Organisms → cellular organisms → Bacteria1051Open in IMG/M
3300000597|AF_2010_repII_A1DRAFT_10141198All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300002915|JGI25387J43893_1030677All Organisms → cellular organisms → Bacteria725Open in IMG/M
3300003359|JGI26322J50206_10016All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300003987|Ga0055471_10115205All Organisms → cellular organisms → Bacteria798Open in IMG/M
3300004633|Ga0066395_10306856All Organisms → cellular organisms → Bacteria869Open in IMG/M
3300005238|Ga0073692_1008740All Organisms → cellular organisms → Bacteria1871Open in IMG/M
3300005294|Ga0065705_10544272All Organisms → cellular organisms → Bacteria744Open in IMG/M
3300005332|Ga0066388_103266263Not Available828Open in IMG/M
3300005441|Ga0070700_100111446All Organisms → cellular organisms → Bacteria1820Open in IMG/M
3300005546|Ga0070696_100729767All Organisms → cellular organisms → Bacteria810Open in IMG/M
3300005557|Ga0066704_10243689All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_61220Open in IMG/M
3300005561|Ga0066699_10099761All Organisms → cellular organisms → Bacteria1912Open in IMG/M
3300005562|Ga0058697_10031220All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_61942Open in IMG/M
3300005764|Ga0066903_100767382All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_61716Open in IMG/M
3300005764|Ga0066903_101488687All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_61277Open in IMG/M
3300005836|Ga0074470_11778026All Organisms → cellular organisms → Bacteria1822Open in IMG/M
3300005937|Ga0081455_10356939All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_61029Open in IMG/M
3300005983|Ga0081540_1060447All Organisms → cellular organisms → Bacteria1812Open in IMG/M
3300006049|Ga0075417_10050658All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_61792Open in IMG/M
3300006049|Ga0075417_10051303All Organisms → cellular organisms → Bacteria1781Open in IMG/M
3300006194|Ga0075427_10011812All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_61319Open in IMG/M
3300006791|Ga0066653_10074933All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_61476Open in IMG/M
3300006800|Ga0066660_10278344All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_61324Open in IMG/M
3300006844|Ga0075428_101166593All Organisms → cellular organisms → Bacteria812Open in IMG/M
3300006845|Ga0075421_101181197All Organisms → cellular organisms → Bacteria854Open in IMG/M
3300006852|Ga0075433_10217985All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_61695Open in IMG/M
3300006880|Ga0075429_100586385All Organisms → cellular organisms → Bacteria977Open in IMG/M
3300006880|Ga0075429_101792335All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300006904|Ga0075424_101885695Not Available632Open in IMG/M
3300016294|Ga0182041_10144029All Organisms → cellular organisms → Bacteria1828Open in IMG/M
3300016357|Ga0182032_10132476All Organisms → cellular organisms → Bacteria1817Open in IMG/M
3300018466|Ga0190268_10322830All Organisms → cellular organisms → Bacteria942Open in IMG/M
3300021086|Ga0179596_10101144All Organisms → cellular organisms → Bacteria1309Open in IMG/M
3300022886|Ga0247746_1012603All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_61763Open in IMG/M
3300023062|Ga0247791_1006223All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_61763Open in IMG/M
3300023077|Ga0247802_1031792All Organisms → cellular organisms → Bacteria783Open in IMG/M
3300023168|Ga0247748_1003747All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_61850Open in IMG/M
3300025933|Ga0207706_10742459All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis837Open in IMG/M
3300025936|Ga0207670_10369212All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_61140Open in IMG/M
3300025961|Ga0207712_10158547All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_61756Open in IMG/M
3300025961|Ga0207712_10186893All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_61632Open in IMG/M
3300025972|Ga0207668_10731672All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6871Open in IMG/M
3300025972|Ga0207668_10862052All Organisms → cellular organisms → Bacteria804Open in IMG/M
3300026016|Ga0208779_1001886All Organisms → cellular organisms → Bacteria1777Open in IMG/M
3300026277|Ga0209350_1033399All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pleurocapsales → Hyellaceae → Pleurocapsa → unclassified Pleurocapsa → Pleurocapsa sp. PCC 73191530Open in IMG/M
3300026296|Ga0209235_1062979All Organisms → cellular organisms → Bacteria1724Open in IMG/M
3300026297|Ga0209237_1150276All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6904Open in IMG/M
3300026329|Ga0209375_1067779All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1702Open in IMG/M
3300026330|Ga0209473_1049377All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_61840Open in IMG/M
3300026929|Ga0207461_1000066All Organisms → cellular organisms → Bacteria1658Open in IMG/M
3300027485|Ga0207635_1000123All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_61845Open in IMG/M
3300027552|Ga0209982_1018996All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_61053Open in IMG/M
3300027880|Ga0209481_10061513All Organisms → cellular organisms → Bacteria1759Open in IMG/M
3300027907|Ga0207428_10152754All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_61757Open in IMG/M
3300027907|Ga0207428_10157454All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_61727Open in IMG/M
3300027909|Ga0209382_10274605All Organisms → cellular organisms → Bacteria1907Open in IMG/M
3300027909|Ga0209382_10314046All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_61764Open in IMG/M
3300027909|Ga0209382_10314390All Organisms → cellular organisms → Bacteria1763Open in IMG/M
3300027909|Ga0209382_11187508All Organisms → cellular organisms → Bacteria781Open in IMG/M
3300028597|Ga0247820_10309966All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_61035Open in IMG/M
3300028705|Ga0307276_10008763All Organisms → cellular organisms → Bacteria1748Open in IMG/M
3300028705|Ga0307276_10029235All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1134Open in IMG/M
3300030516|Ga0268255_10116225All Organisms → cellular organisms → Bacteria797Open in IMG/M
3300031226|Ga0307497_10571249All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300031546|Ga0318538_10068539All Organisms → cellular organisms → Bacteria1776Open in IMG/M
3300031719|Ga0306917_10017956All Organisms → cellular organisms → Bacteria4290Open in IMG/M
3300031736|Ga0318501_10059879All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1809Open in IMG/M
3300031747|Ga0318502_10300205All Organisms → cellular organisms → Bacteria944Open in IMG/M
3300031763|Ga0318537_10030865All Organisms → cellular organisms → Bacteria1907Open in IMG/M
3300031777|Ga0318543_10099445All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_61249Open in IMG/M
3300031778|Ga0318498_10182223All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6954Open in IMG/M
3300031781|Ga0318547_10230641All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_61112Open in IMG/M
3300031781|Ga0318547_10736094All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300031797|Ga0318550_10057989All Organisms → cellular organisms → Bacteria1756Open in IMG/M
3300031833|Ga0310917_10102340All Organisms → cellular organisms → Bacteria1845Open in IMG/M
3300031847|Ga0310907_10100146All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_61249Open in IMG/M
3300031858|Ga0310892_10088899All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_61659Open in IMG/M
3300031879|Ga0306919_10095621All Organisms → cellular organisms → Bacteria2079Open in IMG/M
3300031879|Ga0306919_10123059All Organisms → cellular organisms → Bacteria1859Open in IMG/M
3300031897|Ga0318520_10423059All Organisms → cellular organisms → Bacteria816Open in IMG/M
3300031903|Ga0307407_10565890All Organisms → cellular organisms → Bacteria842Open in IMG/M
3300031910|Ga0306923_10063104All Organisms → cellular organisms → Bacteria4117Open in IMG/M
3300031910|Ga0306923_10293440All Organisms → cellular organisms → Bacteria1858Open in IMG/M
3300031941|Ga0310912_10108288All Organisms → cellular organisms → Bacteria2057Open in IMG/M
3300031942|Ga0310916_10182773All Organisms → cellular organisms → Bacteria1747Open in IMG/M
3300031943|Ga0310885_10043633All Organisms → cellular organisms → Bacteria1825Open in IMG/M
3300031945|Ga0310913_10101593All Organisms → cellular organisms → Bacteria1945Open in IMG/M
3300031947|Ga0310909_10159054All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_61861Open in IMG/M
3300031954|Ga0306926_10288398All Organisms → cellular organisms → Bacteria2032Open in IMG/M
3300031954|Ga0306926_10292239All Organisms → cellular organisms → Bacteria2017Open in IMG/M
3300031995|Ga0307409_100405175All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_61304Open in IMG/M
3300032000|Ga0310903_10343972All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6745Open in IMG/M
3300032004|Ga0307414_10918060Not Available803Open in IMG/M
3300032013|Ga0310906_10203047All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_61203Open in IMG/M
3300032042|Ga0318545_10046135All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_61466Open in IMG/M
3300032052|Ga0318506_10036914All Organisms → cellular organisms → Bacteria1910Open in IMG/M
3300032059|Ga0318533_10094493All Organisms → cellular organisms → Bacteria2060Open in IMG/M
3300032075|Ga0310890_10085932All Organisms → cellular organisms → Bacteria1927Open in IMG/M
3300032122|Ga0310895_10524915All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300032159|Ga0268251_10026146All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_61774Open in IMG/M
3300032179|Ga0310889_10020660All Organisms → cellular organisms → Bacteria2294Open in IMG/M
3300032261|Ga0306920_101082314All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_61163Open in IMG/M
3300033289|Ga0310914_10177026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_61896Open in IMG/M
3300033289|Ga0310914_10211038All Organisms → cellular organisms → Bacteria1736Open in IMG/M
3300033551|Ga0247830_10119074All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_61887Open in IMG/M
3300034661|Ga0314782_021256All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_61108Open in IMG/M
3300034663|Ga0314784_117049All Organisms → cellular organisms → Bacteria573Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil18.35%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere15.60%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil11.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil9.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.67%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.67%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.75%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere2.75%
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave2.75%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.83%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere1.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.83%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.92%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.92%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.92%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.92%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.92%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.92%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.92%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.92%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.92%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.92%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000596Amended soil microbial communities from Kansas Great Prairies, USA - Total DNA no BrdU F1.4TCEnvironmentalOpen in IMG/M
3300000597Forest soil microbial communities from Amazon forest - 2010 replicate II A1EnvironmentalOpen in IMG/M
3300002915Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cmEnvironmentalOpen in IMG/M
3300003359Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A3w-11EnvironmentalOpen in IMG/M
3300003987Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2EnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005238Microbial communities on the surface of aged kaolinite enhanced biochar from soil in Sydney, AustraliaEnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005562Agave microbial communities from Guanajuato, Mexico - As.Ma.eHost-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006194Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1Host-AssociatedOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300022886Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5EnvironmentalOpen in IMG/M
3300023062Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S081-202R-4EnvironmentalOpen in IMG/M
3300023077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S076-202R-6EnvironmentalOpen in IMG/M
3300023168Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S064-202C-5EnvironmentalOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026016Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026277Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026296Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026297Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes)EnvironmentalOpen in IMG/M
3300026330Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes)EnvironmentalOpen in IMG/M
3300026929Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05.2A3w-12 (SPAdes)EnvironmentalOpen in IMG/M
3300027485Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A3w-11 (SPAdes)EnvironmentalOpen in IMG/M
3300027552Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028597Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14EnvironmentalOpen in IMG/M
3300028705Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115EnvironmentalOpen in IMG/M
3300030516Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (v2)Host-AssociatedOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031903Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1Host-AssociatedOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032004Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3Host-AssociatedOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032042Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032122Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4EnvironmentalOpen in IMG/M
3300032159Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2)Host-AssociatedOpen in IMG/M
3300032179Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034661Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034663Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
KanNP_Total_noBrdU_T14TCDRAFT_100990913300000596SoilIIGVFNGFSARFLRRDSVSSIAYSEELISDTISTTLQSTDRHYGIVGQEPDHFQLDS*
AF_2010_repII_A1DRAFT_1014119813300000597Forest SoilGIHARRDTLLSIAYSEELISSTISATFQSTDRHHGIVGQERCHFQLDS*
JGI25387J43893_103067713300002915Grasslands SoilSIHLRRDSLSSIAYSEELISSTISATLQSMDRPYGIVGQKCSHFQLDS*
JGI26322J50206_1001623300003359SoilGIYTKRDSLLSIAYSEELISATISATLQRTDRHHGIVGQKRCHFQGDS*
Ga0055471_1011520513300003987Natural And Restored WetlandsPLTGMHIKRDTLLSIAYSEELISSTISATLQSTDRRHGIVGQECCHFQRDS*
Ga0066395_1030685613300004633Tropical Forest SoilARFLRRDSVSSIAYSEELISDTISTTLQSTDRHYGIVGQEPDYFQLDS*
Ga0073692_100874013300005238SoilARFLRRDSVSSIAYSEELISDTISATLQSTDRHYGIVDQEPDHFQRDS*
Ga0065705_1054427213300005294Switchgrass RhizosphereEGIHLRRDSLSSIAYSEELISFTISATLQSTDRHYGIVGQKHSHFQLDS*
Ga0066388_10326626313300005332Tropical Forest SoilMAIPVKRDKLPSIAYSEELIFSMSATLQSTDRHHGIVGQERC
Ga0070700_10011144623300005441Corn, Switchgrass And Miscanthus RhizosphereQVRYSPAMLYFEGIHVKRDTQLSIAYSQELIFSMSVTLQSTDRHHGIVGQEHCHFQRDS*
Ga0070696_10072976723300005546Corn, Switchgrass And Miscanthus RhizosphereTIHVKRDTQLSIAYSEELISSTISATLQSTDRHHGIVGQERCHFQLDS*
Ga0066704_1024368913300005557SoilAIPVKRDKLPSIAYSEELIFSMSATLQRTDRRHGIVGQERCYFQCDS*
Ga0066699_1009976133300005561SoilGIHLRRDKLSSIAYPEKLNSYTISTTFQGTDRRYGIVGQKSSDFQLDS*
Ga0058697_1003122043300005562AgaveRDSRWSIAYSEELISSTISVTLPSTDRHDEIVGQERWHFQRDA*
Ga0066903_10076738223300005764Tropical Forest SoilVKRDKLPSIAYSEELIFSMSATLQSTDRRHGIVGQECCHVQRDA*
Ga0066903_10148868713300005764Tropical Forest SoilRGIYVKRDTQVSIAYSEELIFPISATLQSTDRHHGIVGQERCHFQRDS*
Ga0074470_1177802623300005836Sediment (Intertidal)YNHIDDTQKTLTGIHARRDKSPSIAYSEELIFTISATLQSTDRRHGIVEQERCHFQLDS*
Ga0081455_1035693923300005937Tabebuia Heterophylla RhizosphereIHARRDTLLSIAYSEELISSTISATFQSTDRHHGIVGQERCHFQRDS*
Ga0081540_106044733300005983Tabebuia Heterophylla RhizosphereCSVVKAISGIHVKRDTLLSIAYSEELISSAISATLQSTDRHHGIVVQKRSHFQLDS*
Ga0075417_1005065823300006049Populus RhizosphereKRDKLPSIAYSEELIFSNSATLQSTDRHHGILGQERCHYQLDS*
Ga0075417_1005130313300006049Populus RhizosphereMGSAQVISLSEVGTHLRRDSRSSIAYSEELISATMSATLQSTDRHDGIVGQECCHFQRDL
Ga0075427_1001181213300006194Populus RhizospherePGIHVKRDNRRSIAYSEELIFPIAATLQSTDRHHGIVGQEYCHFQRDS*
Ga0066653_1007493313300006791SoilELDTTRCIPLLLEGIHLNRDSRWWIAYSEELISSTISATLQSADRHDGIVGQERCHLQFDS*
Ga0066660_1027834423300006800SoilKRDTQLSIAYSQELIFSMSVTLQSTDQHHGIVGQEHCHFQRDS*
Ga0075428_10116659323300006844Populus RhizosphereGIHVKRDNRRSIAYSEELIFPIAATLQSTDRHHGIVGQEYCHFQRDS*
Ga0075421_10046852813300006845Populus RhizosphereAKRDKLPSIAYSEELICAMSATLQSTDRHDEIVGQERCHF*
Ga0075421_10118119713300006845Populus RhizosphereVGEEHGERGIPTKRDKLPSIAYSEELIFSNSATLQSTDRHHGILGQE
Ga0075433_1021798513300006852Populus RhizosphereMAIPVKRDKLPSIAYSEELIFSMSATLQRTDRRHGIVGQERCHFQCDS*
Ga0075429_10058638523300006880Populus RhizosphereHVKRDNSVSVQYAEELNSITISATHQSTDRRHGIVGQKSSHFQRDS*
Ga0075429_10179233523300006880Populus RhizosphereKRDKLPSIAYSEELIFSLSVTLQSTDRRHGIVGQERCHFQRDS*
Ga0075424_10188569513300006904Populus RhizosphereMAHTAHVQVYRQLSIAGIHVKRDNRRSIAYSEELIFPIAATLQSTDRHHGIVGQEYCHFQRDS
Ga0182041_1014402913300016294SoilWGIHVKRDNRRSIAYSEELIFPIAATLQSTDRHHGIVGQEYCHFQGNS
Ga0182032_1013247613300016357SoilKRDNRRSIAYSEELIFPIAATLQSTDRHHGIVGQEYCHFQGNS
Ga0190268_1032283013300018466SoilMVEKPSPGIHVKRDTQLSIAYSEELMFSMSATLQSTDRHHGIVGQERCHFQLDS
Ga0179596_1010114423300021086Vadose Zone SoilLWRGIHLRRDNLSSIAYSEELISSTILATLQSTDRHHGIVGQKRFHFQLNS
Ga0247746_101260313300022886SoilMAGIYTKRDSLLSIAYSEELISATISATLQRTDRHHGIVGQKRCHFQGDS
Ga0247791_100622323300023062SoilLLRHSGIYTKRDSLLSIAYSEELISATISATLQRTDRHHGIVGQKRCHFQGDS
Ga0247802_103179223300023077SoilKRDSLLSIAYSEELISATISATLQRTDRHHGIVGQKRCHFQGDS
Ga0247748_100374723300023168SoilQEHCPGIYTKRDSLLSIAYSEELISATISATLQRTDRHHGIVGQKRCHFQGDS
Ga0207706_1074245923300025933Corn RhizosphereMAVFGMGEAHLLEIHVKRDNRRSIAYSEELIFPMAATLQSTDRHYGIVGQEYCHFQRDS
Ga0207670_1036921223300025936Switchgrass RhizosphereITDVQKLGFHVRRDKLPSIAYSEELISFAMSTSLQSTDRHHGIVGQEHCHFQRDS
Ga0207712_1015854713300025961Switchgrass RhizosphereLSVYLMGIHVKRDNRRSIAYSEELIFPMAATLQSTDRHYGIVGQEYCHFQRDS
Ga0207712_1018689313300025961Switchgrass RhizosphereQALHLQGIHVKRDTQLSIAYSQELIFSMSVTLQSTDRHHGIVGQEHCHFQRDS
Ga0207668_1073167213300025972Switchgrass RhizosphereRTALPDLGIHVKRDNRRSIAYSEELIFPMAATLQSTDRHYGIVGQEYCHFQRDS
Ga0207668_1086205213300025972Switchgrass RhizosphereGLGIHVKRDNRRSIAYSEELIFPISATLQSTDRHQGIVGQEYCHFQRDS
Ga0208779_100188623300026016Natural And Restored WetlandsLSGIHARRDKSPSIAYSEELIFTISATLQSTDRRHGIVEQERCHFQLDS
Ga0209350_103339913300026277Grasslands SoilARFLRRDSVSSIVYSEELISDTISATLQSTDRHYGIVDQEPDHFRRDS
Ga0209235_106297913300026296Grasslands SoilPLFLRPLHFRARFLRRDSVSSIAYSEELISDTMSATLQSTDRHYGIVDQEPDHFQLDS
Ga0209237_115027613300026297Grasslands SoilETQAIPVKRDKLPSIAYSEELIFSMSATLQRTDRRHGIVGQERCYFQCDS
Ga0209375_106777913300026329SoilALPGIHLRRDNLSSIAYSEELISSTISATLQSTDRHHGIVGQKRCHFQLNS
Ga0209473_104937713300026330SoilAPHLQKGGIHLNRDSRWWIAYSEELISSTISATLQSADRHDGIVGQERCHLQFDS
Ga0207461_100006613300026929SoilSGIYTKRDSLLSIAYSEELISATISATLQRTDRHHGIVGQKRCHFQGDS
Ga0207635_100012313300027485SoilVGIYTKRDSLLSIAYSEELISATISATLQRTDRHHGIVGQKRCHFQGDS
Ga0209982_101899623300027552Arabidopsis Thaliana RhizosphereRFLRRDTQVSIAYSEELIFPISATLQSTDRHHGIVGQERCHFQLDS
Ga0209481_1006151323300027880Populus RhizosphereAMKRASRLRRDNLSSIAYSEKLNSSTISATLQSTDRRYGIVGQKRSHFQRAS
Ga0207428_1015275413300027907Populus RhizosphereSEGIHVKRDNRRSIAYSEELIFPIAATLQSTDRHHGIVGQEYCHFQRDS
Ga0207428_1015745423300027907Populus RhizosphereRAIPVKRDKLPSIAYSEELIFSLSVTLQSTDRRHGIVGQERCHFQRDS
Ga0209382_1027460533300027909Populus RhizosphereIYIHLRRDNLSSIAYSEELISSTISATLQSTDRHHGIVGQKRFHFQRNS
Ga0209382_1031404613300027909Populus RhizosphereILGLLDQGIHVKRDNRRSIAYSEELIFPIAATLQSTDRHHGIVGQEYCHFQRDS
Ga0209382_1031439023300027909Populus RhizosphereMVDDSRASRLRRDNLSSIAYSEKLNSSTISATLQSTDRRYGIVGQKRSHFQRAS
Ga0209382_1118750823300027909Populus RhizosphereYPPPGIYAKRDKLPSIAYSEELICAMSATLQSTDRHDEIVGQERCHF
Ga0247820_1030996613300028597SoilGIYTKRDRVQSIAYSEELISATNSATLQSTDRHHGIVDQKRSHLQRDS
Ga0307276_1000876323300028705SoilPTRFASPGIHLKRDSRSSIAYSEELISSTISATLRSTDRHHGIVGQKRCHFQRDS
Ga0307276_1002923533300028705SoilMGIHLRRDNLSSIAYSEELISSTISATLQSTDRHHGIVGQKRFHFQLNS
Ga0268255_1011622513300030516AgaveVKRDTQVSIAYSEELIFPISATLQSTDRHHGIVDQERCHFQRAS
Ga0307497_1057124913300031226SoilMTTAIQVFHVWRDKLSSITYSEELIFSMSASLQSTDRHHGIVGQEYCHFQRDS
Ga0318538_1006853933300031546SoilSPGIHVKRDKLPSIAYSEELISFAMSATLQSTDRRHGIVGQEGCHFQRDS
Ga0306917_1001795643300031719SoilVPLFFSLTVVGIHVKRDKLPSIAYSEELISFAMSATLQSTDRRHGIVGQEGCHFQRDS
Ga0318501_1005987913300031736SoilIWGIHVKRDKLPSIAYSEELISFAMSATLQSTDRRHGIVGQEGCHFQRDS
Ga0318502_1030020523300031747SoilARFLRRDSVSSIAYSEELISDTISTTLQSTDRHDGIVGQEPDHLQRAS
Ga0318537_1003086533300031763SoilFIHSMSTGGIHVKRDKLPSIAYSEELISFAMSATLQSTDRRHGIVGQEGCHFQRDS
Ga0318543_1009944523300031777SoilIYLSFGNTGIHVKRDKLPSIAYSEELISFAMSATLQSTDRRHGIVGQEGCHFQRDS
Ga0318498_1018222323300031778SoilPFWGIHVKRDKLPSIAYSEELISFAMSATLQSTDRRHGIVGQEGCHFQRDS
Ga0318547_1023064123300031781SoilVVAQSMKGIHVKRDKLPSIAYSEELISFAMSATLQSTDRRHGIVGQEGCHFQRDS
Ga0318547_1073609413300031781SoilGKLGALREGIHVKRDNRRSIVYSEELIFPIAATLQSTDRHHGIVGQEYCHFQGNS
Ga0318550_1005798923300031797SoilSPGRRPILARSFLEGIHVKRDKLPSIAYSEELISFAMSATLQSTDRRHGIVGQEGCHFQRDS
Ga0310917_1010234013300031833SoilVKRDNRRSIVYSEELIFPIAATLQSTDRHHGIVGQEYCHFQGNS
Ga0310907_1010014613300031847SoilKGIHVKRDNRRSIAYSEELIFPIAATLQSTDRHHGIVGQEYCHFQRDS
Ga0310892_1008889923300031858SoilHIALPGLEHHESWGIHVKRDNRRSIAYSEELIFPIAATLQSTDRHHGIVGQEYCHFQRDS
Ga0306919_1009562123300031879SoilSLNTPQGCLDNWGIHLKRDNRRSIVYSEELIFPIAATLQSTDRHHGIVGQEYCHFQGNS
Ga0306919_1012305913300031879SoilALPRDAPLPNLGIHVKRDKLPSIAYSEELISFAMSATLQSTDRRHGIVGQEGCHFQRDS
Ga0318520_1042305923300031897SoilGSFKVPARFLRRDSVSSIAYSEELISDTISTTLQSTDRHYGIVGQEPDHLQRAS
Ga0307407_1056589023300031903RhizosphereTDMGFWGIYVKRDTQVSIAYSEELIFPISATLQSTDRHHGIVGQERCHFQRDS
Ga0306923_1006310443300031910SoilMTTEGIHLRRDSRWSIAYSEELISSTISATLQSTDRHDGIVGQEHWHFQRDS
Ga0306923_1029344033300031910SoilTTCILLSPAVLRGIHVKRDNRRSIVYSEELIFPIAATLQSTDRHHGIVGQEYCHFQGNS
Ga0310912_1010828813300031941SoilMVLENLGIHVKRDKLPSIAYSEELISFAMSATLQSTDRRHGIVGQEGCHFQRDS
Ga0310916_1018277313300031942SoilPQQGIHVKRDKLPSIAYSEELISFAMSATLQSTDRRHGIVGQEGCHFQRDS
Ga0310885_1004363333300031943SoilLVQDQSIHVKRDNSVSVQYAEELNSITISATHQSTDRRHGIVGQKSSHFQRDS
Ga0310913_1010159323300031945SoilVKRDNRRSIAYSEELIFPIAATLQSTDRHHGIVGQEYCHFQGNS
Ga0310909_1015905433300031947SoilATKVPVFHVWRDKLSSITYSEALIFSMSDSLQSTDRPDGMVGQERCHFQLAS
Ga0306926_1028839833300031954SoilSFTTARFLRRDSVSSIAYSEELISDTISTTLQSTDRHYGIVGQEPDHLQRAS
Ga0306926_1029223913300031954SoilIPQIGGIHVKRDKLPSIAYSEELISFAMSATLQSTDRRHGIVGQEGCHFQRDS
Ga0307409_10040517513300031995RhizosphereANENVEIPGIYVKRDTQVSIAYSEELIFPISATLQSTDRHHGIVGQERCHFQRDS
Ga0310903_1034397223300032000SoilPDLAIPVKRDKLPSIAYSEELIFSLSVTLQSTDRRHGIVGQERCHFQCDS
Ga0307414_1091806013300032004RhizosphereVSRLKRIPCPGIHLKRDSGSSIAYSEELISSTISATLQSTDRHHWIVGQKRSHFQRDS
Ga0310906_1020304723300032013SoilAKKAAIPVKRDKLPSIAYSEELIFSLSVTLQSTDRRHGIVGQERCHFQCDS
Ga0318545_1004613513300032042SoilVYQGEITGIHVKRDKLPSIAYSEELISFAMSATLQSTDRRHGIVGQEGCHFQRDS
Ga0318506_1003691433300032052SoilIVGIHVKRDKLPSIAYSEELISFAMSATLQSTDRRHGIVGQEGCHFQRDS
Ga0318533_1009449313300032059SoilLREGIHVKRDNRRSIVYSEELIFPIAATLQSTDRHHGIVGQEYCHFQGNS
Ga0310890_1008593223300032075SoilHDVLLASIHVKRDNSVSVQYAEELNSITISATHQSTDRRHGIVGQKSSHFQRDS
Ga0310895_1052491513300032122SoilQSTMIVMHLRGIHVKRDNRRSIAYSEELIFPISATLQSTDRHHGIVGQEYCHFQRDS
Ga0268251_1002614623300032159AgaveFIIADIPGVGFVGIHAKRDKLPSIAYSEELIFSRSATLQSTDRHHGIVGQERCHFSLDS
Ga0310889_1002066023300032179SoilMSIHVKRDNSVSVQYAEELNSITISATHQSTDRRHGIVGQKSSHFQRDS
Ga0306920_10108231413300032261SoilKGIHVKRDKLPSIAYSEELISFAMSATLQSTDRRHGIVGQEGCHFQRDS
Ga0310914_1017702633300033289SoilLRFLVFHVWRDKLSSITYSEALIFSMSDSLQSTDRHDGMVGQERCHFQLAS
Ga0310914_1021103813300033289SoilEARFLRRDSVSSIAYSEELISDTISTTLQSTDRHYGIVGQEPDHLQRAS
Ga0247830_1011907423300033551SoilPVSSSPAIPVKRDKLPSIAYSEELIFSLSVTLQSTDRRHGIVGQERCHFQRDS
Ga0314782_021256_964_11073300034661SoilGIHVKRDNRRSIAYSEELIFPIAATLQSTDRHHGIVGQEYCHFQRDS
Ga0314784_117049_422_5713300034663SoilLLGIHLKRDNRWSIAYSEELIVAMSATLQSTDRHYGIVGQERCHYQRDS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.