NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F089080

Metagenome Family F089080

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F089080
Family Type Metagenome
Number of Sequences 109
Average Sequence Length 54 residues
Representative Sequence MPDTPLRGRRGRDRRIAERVATDFAARHAPPSPDDEVDFDVAAVDAEVED
Number of Associated Samples 97
Number of Associated Scaffolds 109

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 86.24 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 93.58 %
Associated GOLD sequencing projects 97
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(24.771 % of family members)
Environment Ontology (ENVO) Unclassified
(29.358 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.789 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 43.59%    β-sheet: 0.00%    Coil/Unstructured: 56.41%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 109 Family Scaffolds
PF01195Pept_tRNA_hydro 89.91
PF02130YbeY 6.42
PF01966HD 0.92
PF04542Sigma70_r2 0.92

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 109 Family Scaffolds
COG0193Peptidyl-tRNA hydrolaseTranslation, ribosomal structure and biogenesis [J] 89.91
COG0319ssRNA-specific RNase YbeY, 16S rRNA maturation enzymeTranslation, ribosomal structure and biogenesis [J] 6.42
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.92
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.92
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.92
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.92


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090013|LWAnNN_GHFF8UE02H89EYAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium556Open in IMG/M
2124908016|OU_2_1_1_newblercontig64858All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi783Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_100770416All Organisms → cellular organisms → Bacteria1655Open in IMG/M
3300000956|JGI10216J12902_104405219All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium567Open in IMG/M
3300001536|A1565W1_10827993All Organisms → cellular organisms → Bacteria1120Open in IMG/M
3300001991|JGI24743J22301_10067251All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi744Open in IMG/M
3300004081|Ga0063454_100483216All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi864Open in IMG/M
3300004114|Ga0062593_101043200All Organisms → cellular organisms → Bacteria843Open in IMG/M
3300004153|Ga0063455_101123161All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium582Open in IMG/M
3300004156|Ga0062589_100926972All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi805Open in IMG/M
3300004479|Ga0062595_100694195All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi816Open in IMG/M
3300004479|Ga0062595_100743214All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi797Open in IMG/M
3300004479|Ga0062595_101405969All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi636Open in IMG/M
3300004480|Ga0062592_101072291All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi743Open in IMG/M
3300005093|Ga0062594_101714454All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi657Open in IMG/M
3300005330|Ga0070690_100609551All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi830Open in IMG/M
3300005330|Ga0070690_101456971All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium552Open in IMG/M
3300005335|Ga0070666_11275894All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium548Open in IMG/M
3300005338|Ga0068868_101656870All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium602Open in IMG/M
3300005347|Ga0070668_100484929All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1068Open in IMG/M
3300005355|Ga0070671_101558938All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium585Open in IMG/M
3300005440|Ga0070705_100079089All Organisms → cellular organisms → Bacteria2013Open in IMG/M
3300005456|Ga0070678_101568582All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium618Open in IMG/M
3300005468|Ga0070707_100647672All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1019Open in IMG/M
3300005535|Ga0070684_101752448All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium586Open in IMG/M
3300005545|Ga0070695_101505037All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium560Open in IMG/M
3300005564|Ga0070664_100061551All Organisms → cellular organisms → Bacteria3199Open in IMG/M
3300005718|Ga0068866_11364818All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium517Open in IMG/M
3300005764|Ga0066903_103438101All Organisms → cellular organisms → Bacteria854Open in IMG/M
3300006237|Ga0097621_100609904All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi998Open in IMG/M
3300006876|Ga0079217_11473887All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium536Open in IMG/M
3300006894|Ga0079215_10823288All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi652Open in IMG/M
3300006903|Ga0075426_10300211All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1175Open in IMG/M
3300006904|Ga0075424_102532096All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium537Open in IMG/M
3300007004|Ga0079218_11724501All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi696Open in IMG/M
3300007004|Ga0079218_11924943All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi670Open in IMG/M
3300009093|Ga0105240_11878378All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi623Open in IMG/M
3300009147|Ga0114129_10733457All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1266Open in IMG/M
3300009789|Ga0126307_11157214All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium626Open in IMG/M
3300010375|Ga0105239_10325036All Organisms → cellular organisms → Bacteria1735Open in IMG/M
3300010403|Ga0134123_10116096All Organisms → cellular organisms → Bacteria2160Open in IMG/M
3300010403|Ga0134123_10149065All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1933Open in IMG/M
3300011264|Ga0151623_1128913All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi953Open in IMG/M
3300011431|Ga0137438_1130216All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi771Open in IMG/M
3300011439|Ga0137432_1292433All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium521Open in IMG/M
3300011991|Ga0120153_1030602All Organisms → cellular organisms → Bacteria1109Open in IMG/M
3300012094|Ga0136638_10016734All Organisms → cellular organisms → Bacteria2716Open in IMG/M
3300012204|Ga0137374_10992099All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi608Open in IMG/M
3300012895|Ga0157309_10266202All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium565Open in IMG/M
3300012901|Ga0157288_10195063All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi641Open in IMG/M
3300012908|Ga0157286_10109637All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi824Open in IMG/M
3300012955|Ga0164298_11074380All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium600Open in IMG/M
3300012984|Ga0164309_11491382All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium578Open in IMG/M
3300012985|Ga0164308_11292156All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi662Open in IMG/M
3300012985|Ga0164308_11900079All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium555Open in IMG/M
3300012986|Ga0164304_10693685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi773Open in IMG/M
3300012989|Ga0164305_11497415All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium598Open in IMG/M
3300013297|Ga0157378_11640473All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi689Open in IMG/M
3300014259|Ga0075311_1178891All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium501Open in IMG/M
3300015200|Ga0173480_10281938All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi919Open in IMG/M
3300015201|Ga0173478_10229030All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi799Open in IMG/M
3300015201|Ga0173478_10756161All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium527Open in IMG/M
3300018029|Ga0187787_10330230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium581Open in IMG/M
3300018054|Ga0184621_10183485All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi751Open in IMG/M
3300018084|Ga0184629_10123734All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1290Open in IMG/M
3300018422|Ga0190265_12649162All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium598Open in IMG/M
3300021080|Ga0210382_10206631All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi854Open in IMG/M
3300022309|Ga0224510_10502990All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi721Open in IMG/M
3300024055|Ga0247794_10261728All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium574Open in IMG/M
3300024055|Ga0247794_10280706All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium557Open in IMG/M
3300025907|Ga0207645_10817573All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi634Open in IMG/M
3300025907|Ga0207645_11012815All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium562Open in IMG/M
3300025917|Ga0207660_11515200All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium542Open in IMG/M
3300025932|Ga0207690_10121608All Organisms → cellular organisms → Bacteria1897Open in IMG/M
3300025935|Ga0207709_10680310All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi822Open in IMG/M
3300025941|Ga0207711_11304368All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi668Open in IMG/M
3300026088|Ga0207641_12026133All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium577Open in IMG/M
3300026095|Ga0207676_10849900All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium893Open in IMG/M
3300028708|Ga0307295_10121189All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi715Open in IMG/M
3300028768|Ga0307280_10351404All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium544Open in IMG/M
3300028782|Ga0307306_10098925All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi775Open in IMG/M
3300028787|Ga0307323_10168636All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi791Open in IMG/M
3300028791|Ga0307290_10103991All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1036Open in IMG/M
3300028791|Ga0307290_10222146All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi692Open in IMG/M
3300028802|Ga0307503_10559722All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi625Open in IMG/M
3300028803|Ga0307281_10013438All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2296Open in IMG/M
3300028819|Ga0307296_10473614All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi685Open in IMG/M
3300028824|Ga0307310_10324838All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi753Open in IMG/M
3300028828|Ga0307312_10057675All Organisms → cellular organisms → Bacteria2334Open in IMG/M
3300028878|Ga0307278_10115652All Organisms → cellular organisms → Bacteria1205Open in IMG/M
3300028878|Ga0307278_10478796All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium544Open in IMG/M
3300030336|Ga0247826_10227968All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes1294Open in IMG/M
3300030943|Ga0311366_10070464All Organisms → cellular organisms → Bacteria3003Open in IMG/M
3300031232|Ga0302323_100307799All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1645Open in IMG/M
3300031716|Ga0310813_10271269All Organisms → cellular organisms → Bacteria1421Open in IMG/M
3300031736|Ga0318501_10695959All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium560Open in IMG/M
3300031795|Ga0318557_10377523All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi651Open in IMG/M
3300031796|Ga0318576_10368387All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi679Open in IMG/M
3300031819|Ga0318568_10964703All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium527Open in IMG/M
3300031834|Ga0315290_10545910All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1009Open in IMG/M
3300031834|Ga0315290_11317361All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium595Open in IMG/M
3300031854|Ga0310904_10489614All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi823Open in IMG/M
3300031911|Ga0307412_10495442All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1016Open in IMG/M
3300031947|Ga0310909_11240187All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi602Open in IMG/M
3300032003|Ga0310897_10654738All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium523Open in IMG/M
3300032013|Ga0310906_10599835All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi759Open in IMG/M
3300033417|Ga0214471_10678376All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi812Open in IMG/M
3300033433|Ga0326726_11606317All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi633Open in IMG/M
3300034178|Ga0364934_0087814All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1165Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil24.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil6.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.59%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.67%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.75%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.75%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.75%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment1.83%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.83%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.83%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.83%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost1.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.83%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.83%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.83%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.83%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.83%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.83%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.83%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.92%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Sediment0.92%
SedimentEnvironmental → Aquatic → Freshwater → Groundwater → Acid Mine Drainage → Sediment0.92%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.92%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment0.92%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.92%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.92%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.92%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.92%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.92%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.92%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.92%
Environmental → Unclassified → Unclassified → Unclassified → Unclassified → 0.92%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.92%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.92%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.92%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090013Freshwater sediment microbial communities from Lake Washington, Seattle, for methane and nitrogen Cycles - SIP 13Cmethane anaerobic no nitrateEnvironmentalOpen in IMG/M
2124908016Sample 642EnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001536Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001991Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2Host-AssociatedOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011264Acid mine drainage microbial communities from Malanjkhand copper mine, India - M16 k-mer 63EnvironmentalOpen in IMG/M
3300011431Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT157_2EnvironmentalOpen in IMG/M
3300011439Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2EnvironmentalOpen in IMG/M
3300011991Permafrost microbial communities from Nunavut, Canada - A34_65cm_12MEnvironmentalOpen in IMG/M
3300012094Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ858 (22.06)EnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012895Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2EnvironmentalOpen in IMG/M
3300012901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1EnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014259Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D1EnvironmentalOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300018029Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MGEnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300022309Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_4_1EnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028708Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028782Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300028803Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300030943III_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031834Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031911Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1Host-AssociatedOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300033417Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300034178Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
LWAnNN_059196802088090013Freshwater SedimentMPTPPLRGRRGRDRRIADRVASDFAARHAPPAPGAGDAVDFDIAAVDAEVEDARRPTPTTRSP
OU_024786602124908016MPESPRPPLRGRRGRDRRIAERVAADFATRHAPPTDEALGFDVAAVDAEVEDARRDAARAPRKPP
INPhiseqgaiiFebDRAFT_10077041633300000364SoilVPDTPLRGRRGRDRRIGEKVATDFAARHAPRSADDEVDFDLAAV
JGI10216J12902_10440521913300000956SoilMADRDTPIRGRRGRDRRIAEKVAADFAARHATPTPEAEIDFDIAAVDAEVEDARRPARP
A1565W1_1082799313300001536PermafrostVPDTPLRGRRGRDRRIAERVATDFAARHAARAPESETDFDVAAVDAEVADARR
JGI24743J22301_1006725123300001991Corn, Switchgrass And Miscanthus RhizosphereMPESTPPTLRGRRGRDRRIAERVAEEFASRHAATNDEDAVDFDVAAVDAEV
Ga0063454_10048321613300004081SoilMPDTPLRGRRGRDRRIAERVATDFAARHAPPRPENETDFDV
Ga0062593_10104320023300004114SoilMPESTTPPLRGRRGRDRRIAEQVAAEFAARHAPPRDEDAIDFDIGAVDAEVEDARRAEA
Ga0063455_10112316123300004153SoilMPDTPLRGRRGRDRRIAERVATEFAERHAPPRPENETDFDVAAVDAEV
Ga0062589_10092697213300004156SoilMAGTPLRGRRGRDRRIAEQVATDFATRHAPSRPEDEVDFDVGEVDAEVADARRAE
Ga0062595_10069419513300004479SoilMPESTPPTLRGRRGRDRRIAERIAEEFASRHAAKNDEDAVDFDVAAVDAEVEDARRA
Ga0062595_10074321423300004479SoilMAGTPLRGRRGRDRRIAERVATDFATRHAPPRPEDELDFDVAEVDAE
Ga0062595_10140596913300004479SoilMPESTPPTLRGRRGRDRRIAERVAEEFATRHAPRVDEDAVDFDVAAVDAEVEDA
Ga0062592_10107229123300004480SoilVPDTPLRGRRGRDRRIAERVATDFATRHAPPSPDDEIDFDVAAVDAEVE
Ga0062594_10171445423300005093SoilMPDTPLRGRRGRDRRIAERVATDFAARHAPTPADQEVDFDVAAVDAEVD
Ga0070690_10060955123300005330Switchgrass RhizosphereMPDTPLRGRRGRDRRIAERVATDFAARHAPPSPDDEVDFDVAAVDAEVED
Ga0070690_10145697123300005330Switchgrass RhizosphereMPDTPLRGRRGRDRRIAERIATEFAERHAKPRPDAEAEVDFDVA
Ga0070666_1127589423300005335Switchgrass RhizosphereMPDTPLRGRRGRDRRISERVATDFAARHAGPSPETEIDFDVAAVDAEVE
Ga0068868_10165687013300005338Miscanthus RhizosphereMRGRRGRDRRIAERVATDFAARHAPPSPDEEVDFDVAAVDAEVEDARRVPPKPRPA
Ga0070668_10048492923300005347Switchgrass RhizosphereMRGRRGRDRRIAERVATEFAARHAPPKPEDEVDFDVAAVDAEVADA
Ga0070671_10155893813300005355Switchgrass RhizosphereMPDTPLRGRRGRDRRISERVATDFAARHAGPSPETEIDFDV
Ga0070705_10007908913300005440Corn, Switchgrass And Miscanthus RhizosphereMPESTTPPLRGRRGRDRRIAEEVARDFAARHAPPADDDVVDFDIGAVDAEVDDARRAEAG
Ga0070678_10156858213300005456Miscanthus RhizosphereMPDTPLRGRRGRDRRIAERVATDFAARHAPPSPDDEVDFDVAAVDAEVEDARRLPPK
Ga0070707_10064767213300005468Corn, Switchgrass And Miscanthus RhizosphereMPESTTPPLRGRRGRDRRIAEDVARDFAARHAPPTDDAVVDFDIGAVDAEVEDARGA
Ga0070684_10175244823300005535Corn RhizosphereMPDTPLRGRRGRDRRIAERVATDFAARHAGPPPDTEVDFDIAAVDAEVEDARRP
Ga0070695_10150503723300005545Corn, Switchgrass And Miscanthus RhizosphereMAGTPHRGRRGRDRRIAEQVATDFASRHAPPRPEDEVDFDVGEVDAEVADAR
Ga0070664_10006155143300005564Corn RhizosphereMPESTPPTLRGRRGRDRRIAERVAEEFASRHAAKNDEDAVDFDVAAVDAEVEDARRAPARATTR
Ga0068866_1136481823300005718Miscanthus RhizosphereVPETPRRGRRGRDRRIAERVATEFAARHAPPKPEDEVDFDVAAVDAEV
Ga0066903_10343810123300005764Tropical Forest SoilVPTPPLRGRRGRDRRIAERVATEFATRHAPPKPEDQVDFDVAEVDAEAEDARRAEADVGDDGA
Ga0097621_10060990413300006237Miscanthus RhizosphereMPESTPPTLRGRRGRDRRIAERVAEEFASRHAAKNDEDAVDFDVAAVDAEVEDARRAP
Ga0079217_1147388713300006876Agricultural SoilMPESTTPPLRGRRGRDRRIAEQVARDFASRHPRPKDEDAIDFDIAAVDAEIEDAR
Ga0079215_1082328813300006894Agricultural SoilMPESTTPPLRGRRGRDRRIAEQVARDFASRHPRPKDEDAIDFDIAAVDAE
Ga0075426_1030021123300006903Populus RhizosphereMPEDAQPPLRGRRGRDRRIAERVAAEFATRHAPPVEPREDALDFDVAAVDAEV
Ga0075424_10253209613300006904Populus RhizosphereMPESTPPTLRGRRGRDRRIAERVAEEFASRHAATNDEDAVDFDVAAVDAEVEDARRAPARAT
Ga0079218_1172450113300007004Agricultural SoilMPESTTPPLRGRRGRDRRIAEQVAKDFAARHPRPRDEDIVDFDIGAVDAE
Ga0079218_1192494313300007004Agricultural SoilMPESPRPPLRGRRGRDRRIAEKVAADFATRHAPTRDEDTVDFDVAAVDAE
Ga0105240_1187837823300009093Corn RhizosphereVPDTPLRGRRGRDRRIAERVATDFAARHAAPTADEMVDFDVAE
Ga0114129_1073345733300009147Populus RhizosphereMPESTPPTLRGRRGRDRRIAERVAEEFATRHAPRADEDAVDFDVAAVDAEVE
Ga0126307_1115721413300009789Serpentine SoilMPDTPLRGRRGRDRRIAERIATEFATRHAAPRPETETDFDIAAVDAEVADARRREAAATATAE
Ga0105239_1032503633300010375Corn RhizosphereMAGTPLRGRRGRDRRIAEQVATDFASRHAPPRPEDEVDFDVGEVDAEVAD
Ga0134123_1011609613300010403Terrestrial SoilMAERATPPIRGRRGRDRRLAEQAASTLAARHRPIADEDTVDFDLAAVDAEAEDARRAEAR
Ga0134123_1014906513300010403Terrestrial SoilMADAMAGTMPDSTPPTLRGRRERERRIADRVAADFASRHAPPTDDQVLDFDVAAVDAE
Ga0151623_112891323300011264SedimentVPAPTPPLRGRRGRDRRIAERVTTEFATRHAPPTREALDFDVAEVDREIEDEERRAARAAGIPR
Ga0137438_113021613300011431SoilMPTPTPPLRGRRGRDRRIAERVASDFAARHAAPAREALDFDVAE
Ga0137432_129243313300011439SoilMRGRRGRDRRIAERVATEFAARHAARSAEDQVDFDVAEVDAEVADA
Ga0120153_103060213300011991PermafrostVPDTPLRGRRGRDRRIAERVATDFAARHAARAPESETDFD
Ga0136638_1001673413300012094Polar Desert SandMPDRPGSTTPPIRGKRGRDRRIGEEVAAEWAARHAPIAEDAIDFDVAAVDAE
Ga0137374_1099209913300012204Vadose Zone SoilMPTPPLRGRRGRDRRIAEQVTSEFAARHALRNEHAIDFDVAAV
Ga0157309_1026620213300012895SoilMPDTPLRGRRGRDRRIAERVATDFAARHAPPSPDEEVDFDVAAV
Ga0157288_1019506323300012901SoilMRGRRGRDRRIAEEVAKDFAARHPRPKDEDVVDFDIGAVDAEVDDARRAA
Ga0157286_1010963723300012908SoilMRGRRGRDRRIAEQVAADFAARHAPPRDDETLDFDLGAVDAEIEDARRAEAAAAAEGAATAYDDA
Ga0164298_1107438023300012955SoilMPDTPLRGRRGRDRRIAERIATDFATRHTPPRPETETDFDVTAVDAEVADAR
Ga0164309_1149138213300012984SoilMPDTPLRGRRGRDRRIAERVATDFAARHAPPRPENETDFDIAAVDAEVADARRLD
Ga0164308_1129215623300012985SoilMPDTPLRGRRGRDRRIAERIATDFATRHTPQRPETETDFDVAAVDAEVADARRRDAKAIE
Ga0164308_1190007923300012985SoilMPESTTPPLRGRRGRDRRIAEQVAAEFAARHAPPRDEDAIDFDIGAVDAEVEDARRAEADADTAP
Ga0164304_1069368523300012986SoilMPDRPGPSTPPLRGRRGRDRRIAEQVASAFAARHAPPRDDEAIDFDVAEVDAEVAAARRGPVA
Ga0164305_1149741513300012989SoilMPDIPLRGRRGRDRRIAERIATEFAERHAKARPEAEAEVDFDVAAVDAE
Ga0157378_1164047323300013297Miscanthus RhizosphereMAGTPLRGRRGRDRRIAEQVATDFASRHAPPRPEDEVDFDVGEVDAEVADARRPEAEDGQ
Ga0075311_117889123300014259Natural And Restored WetlandsMPTPPLRGRRGRDRRIAERVAADFAARHAPPAEEAIDFDIAAVDAEVDDARRPPRPTPA
Ga0173480_1028193823300015200SoilVPDTPLRGRRGRDRRIAERVATDFAARHAPPSPDDEVDFDVGAVDAEVED
Ga0173478_1022903023300015201SoilMRGRRGRDRRIAEQVAADFAARHAAPREDETLDFDVGAVDAEVEDARRAEAAAAA
Ga0173478_1075616123300015201SoilMPDTPLRGRRGRDRRIAERVATDFAARHAPTPADQEVDFDVAAVDAEVDDARRDP
Ga0187787_1033023023300018029Tropical PeatlandMPESTTPPMRGRRGRDRRIAERVAADFAARHAPPSAEEAVDFDVAEV
Ga0184621_1018348523300018054Groundwater SedimentMPESTTPPLRGRRGRDRRIAEQVARDFAARHAPPRDDEVTDFDIGAVDAEVEDARRAE
Ga0184629_1012373433300018084Groundwater SedimentMRGRRGRDRRIAERVATEFAARHAAPSAEDEVDFDVAEVDAEVADARRATPAPRAPVKPP
Ga0190265_1264916233300018422SoilMPESTTPPLRGRRGRDRRIAEQVAKDFAARHPRPRDEDLVDFDIGALDAEVEDARRTEAP
Ga0210382_1020663123300021080Groundwater SedimentMPDRPTRATPPLRGRRGRDRRIAEQVASEFAARHAPPRDEDALDFDLAAVGAEV
Ga0224510_1050299023300022309SedimentVPDRPSSEAHRLRGRRGRDRRIGEEVAAAFAARHRGPIDVDTVDFDTAAVDGDVADAR
Ga0247794_1026172813300024055SoilMPESTPPTLRGRRGRDRRIAERVAEEFATRHAPRVDEDAVDFDVAAVDAEVEDARRETVRAPSRKRRRD
Ga0247794_1028070613300024055SoilMPESTTPPLRGRRGRDRRIAEQVAAEFAARHAPPRDEDAIDFDIGAVDAEVEDARRAEAEAESGAAARRTT
Ga0207645_1081757323300025907Miscanthus RhizosphereMAGTPLRGRRGRDRRIAEQVATDFASRHAPPRPEDEVDFDVGEVDAEV
Ga0207645_1101281513300025907Miscanthus RhizosphereVPDTPLRGRRGRDRRIAERVATDFATRHAPPSPDDEIDFDVAAVDAEVEDSRRPRPKTQP
Ga0207660_1151520013300025917Corn RhizosphereMPESTTPPLRGRRGRDRRIAEDVARDFAARHAPPTDEDVVDFDIGAVDAEVDDARRAEAGDGAP
Ga0207690_1012160813300025932Corn RhizosphereMPESTPPTLRGRRGRDRRIAERVAEEFASRHAAKNDEDAVDFDVAAVDAEVEDARRAPARAPTR
Ga0207709_1068031023300025935Miscanthus RhizosphereMPTPPLRGRRGRDRRIAEQVAGDFAARHARRDNEALDFDVAETDAEVADAARAEARAAQPARRSRR
Ga0207711_1130436813300025941Switchgrass RhizosphereMPESTPPTLRGRRGRDRRIAERVAEEFASRHAAKNDEDAVDFDVAAVDAEVEDARRAPARAPTRKRRRD
Ga0207641_1202613323300026088Switchgrass RhizosphereVPDTPLRGRRGRDRRIAERVATDFAARHAPPSADEEVDFD
Ga0207676_1084990023300026095Switchgrass RhizosphereVPDTPLRGRRGRDRRIAERVATDFAARHAPPSADEEVDFDIGAVDAEVEDARREPPKP
Ga0307295_1012118913300028708SoilMPESTTPPVRGRRGRDRRIAEDVARDFAARHAPPADEDVVDFDIGAVDAEIEDARRAEARDGAPPRK
Ga0307280_1035140423300028768SoilMPETPMRGRRGRDRRIAERVATDFAARHAAPAPDEAVDF
Ga0307306_1009892513300028782SoilMPETPMRGRRGRDRRIAERVATDFAARHAAPAPDEAVDFDTAAVDAEVEDTRRAPASPRAPA
Ga0307323_1016863623300028787SoilMPESTTPPLRGRRGRDRRIAEDVARDFAARHAPPAEDEVIDFDIGAVDHEIDDARRAEARDGAPP
Ga0307290_1010399113300028791SoilMPESTTPPLRGRRGRDRRIAEQVAKDFAARHAPPRDDEVTDFDIGALDAVVEDARR
Ga0307290_1022214613300028791SoilMPESTTPPLRGRRGRDRRIAEDVARDFAARHAPPAEDEVIDFDIGAVDQEIDDARRAEARDGAPPT
Ga0307503_1055972213300028802SoilMPDTPLRGRRGRDRRIAERVATDFAARHPRPSPETEVDFD
Ga0307281_1001343853300028803SoilMRGRRGRDRRIAERVATEFAARHAAPSAEDEVDFDVAEVDAEVA
Ga0307296_1047361413300028819SoilVPTPPLRGRRGRDRRIAERVATDFAARHAPTKPEHEIDIDAAEVDAEVE
Ga0307310_1032483823300028824SoilMPTPPLRGRRGRDRRIAERVATDFAARHATSPTNGVVDFDVAAVDAEVADAARAE
Ga0307312_1005767513300028828SoilMPESTTPPLRGRRGRDRRIAEDVARDFAARHAPPAEDEVIDFDIGAVDQEIDDARRAEARDGAPPK
Ga0307278_1011565233300028878SoilMPDRPTRATPPLRGRRGRDRRIAEQVASEFAARHAPPRDEDAVDFDVAAVDAEVEDAGRV
Ga0307278_1047879613300028878SoilMPESPRPPLRGRRGRDRRIAERVAADFASRHAPPLDENAPAFDVAAVDAE
Ga0247826_1022796813300030336SoilMPESTTPPLRGRRGRDRRIAEEVAKEFAARHPRPKDEDVVDFDIGAVDAEVDDARRAAARPD
Ga0311366_1007046443300030943FenMPPLRGRRGRDRRIGERVAADFATRHAPPTDDEGIDFDVAEVDAEVD
Ga0302323_10030779913300031232FenMPPLRGRRGRDRRIGERVAADFATRHAPPTDDESIDFDVAEVDAEIDDHR
Ga0310813_1027126913300031716SoilMPESTPPTLRGRRGRDRRIAERIAEEFASRHAAKNDEDAVDFDVAAVDAEVEDARRAPARAPT
Ga0318501_1069595923300031736SoilMAGTPLRGRRGRDRRIAERVATDFATRHAPPRPEDEVDFDVAEVDAEVADALEAQM
Ga0318557_1037752313300031795SoilMAGTPLRGRRGRDRRIAERVATDFATRHAPPRPEDE
Ga0318576_1036838723300031796SoilMAGTPLRGRRGRDRRIAERVATDFATRHAPPRPEDEVDFDVAEVDA
Ga0318568_1096470323300031819SoilMAGTPLRGRRGRDRRIAERVATDFATRHAPPRPEDEVDFDLAEVDAEVAD
Ga0315290_1054591023300031834SedimentMPTPPLRGRRGRDRRIADRVASDFAARHAPPAPGADDAIDFDIAAVDAEVEDARRPTPTTPSPA
Ga0315290_1131736113300031834SedimentMATPPLRGRRGRDRRIAERIATEFAARHSPAPPDEAVDFDVAEVDAEVADARRAPRTPT
Ga0310904_1048961413300031854SoilMPDTPLRGRRGRDRRIAERVATDFAERHARPASETEVDFDVA
Ga0307412_1049544213300031911RhizosphereMMPDQPGPTLRGRRGRDRRIAERVAADFATRHAPPTDEEAVDFDVAAVDAEVDDA
Ga0310909_1124018723300031947SoilMAGTPLRGRRGRDRRIAERVATDFATRHAPPRPEDEVDFDLAEVDA
Ga0310897_1065473823300032003SoilMPESTPPTLRGRRGRDRRIAERVAEEFASRHAAKNDEDAVDFDVAAVDAEVEDARRAPARAPTRKRRGDEARKSGHR
Ga0310906_1059983523300032013SoilMGDRTSPIRGRRGRDRRIGEKVAADFAARHAPPKDDVALDFDVAAVDAEVEDA
Ga0214471_1067837623300033417SoilVPTPPLRGRRGRDRRIAERVATDFAASHARPAGETVDFDVAAVDAEVEDAA
Ga0326726_1160631713300033433Peat SoilMPTPTPPLRGRRGRDRRIAERVATEFAARHAPPTREALDFDVAEVDREIEDERRRTSLVAVRATA
Ga0364934_0087814_2_1783300034178SedimentMPESTTPPLRGRRGRDRRIAEQVAKDFAARHAPPAEADAIDFDIGAVDAEVEDARRAEA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.