NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F089002

Metagenome / Metatranscriptome Family F089002

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F089002
Family Type Metagenome / Metatranscriptome
Number of Sequences 109
Average Sequence Length 53 residues
Representative Sequence LNITDANLKNIRRAVANYTKLDSKMKMQTLHRLQQQLQAKLPNTDILKKFKEL
Number of Associated Samples 93
Number of Associated Scaffolds 109

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 89.91 %
Associated GOLD sequencing projects 85
AlphaFold2 3D model prediction Yes
3D model pTM-score0.55

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (69.725 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh
(33.027 % of family members)
Environment Ontology (ENVO) Unclassified
(51.376 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(94.495 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 49.38%    β-sheet: 0.00%    Coil/Unstructured: 50.62%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.55
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 109 Family Scaffolds
PF05050Methyltransf_21 61.47
PF08241Methyltransf_11 5.50



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms83.49 %
UnclassifiedrootN/A16.51 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000115|DelMOSum2011_c10112450All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41868Open in IMG/M
3300001460|JGI24003J15210_10063566All Organisms → Viruses → Predicted Viral1178Open in IMG/M
3300002483|JGI25132J35274_1019090All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1631Open in IMG/M
3300005512|Ga0074648_1129661All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41810Open in IMG/M
3300006025|Ga0075474_10275684Not Available501Open in IMG/M
3300006026|Ga0075478_10165736Not Available685Open in IMG/M
3300006026|Ga0075478_10220096All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41576Open in IMG/M
3300006352|Ga0075448_10151845All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41717Open in IMG/M
3300006735|Ga0098038_1064242All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED411307Open in IMG/M
3300006735|Ga0098038_1112306All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41932Open in IMG/M
3300006810|Ga0070754_10278507All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41756Open in IMG/M
3300006916|Ga0070750_10112320All Organisms → Viruses → Predicted Viral1255Open in IMG/M
3300006919|Ga0070746_10305475All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41730Open in IMG/M
3300007345|Ga0070752_1373988Not Available531Open in IMG/M
3300007539|Ga0099849_1216754All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41714Open in IMG/M
3300007725|Ga0102951_1230769Not Available525Open in IMG/M
3300007778|Ga0102954_1102389All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41806Open in IMG/M
3300008012|Ga0075480_10061282All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED412178Open in IMG/M
3300009027|Ga0102957_1106457All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41980Open in IMG/M
3300009077|Ga0115552_1201514All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41816Open in IMG/M
3300009193|Ga0115551_1215101All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41859Open in IMG/M
3300009449|Ga0115558_1395373All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41540Open in IMG/M
3300009496|Ga0115570_10435949All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41554Open in IMG/M
3300009498|Ga0115568_10072865All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED411751Open in IMG/M
3300009498|Ga0115568_10372300All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41622Open in IMG/M
3300009790|Ga0115012_10145752All Organisms → cellular organisms → Bacteria → Proteobacteria1700Open in IMG/M
3300012919|Ga0160422_10495407All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41768Open in IMG/M
3300012954|Ga0163111_12265440All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41550Open in IMG/M
3300016762|Ga0182084_1322623Not Available536Open in IMG/M
3300017697|Ga0180120_10163064All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41939Open in IMG/M
3300017719|Ga0181390_1015058All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.2625Open in IMG/M
3300017730|Ga0181417_1111716All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41661Open in IMG/M
3300017732|Ga0181415_1052908All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41923Open in IMG/M
3300017737|Ga0187218_1048323All Organisms → Viruses → Predicted Viral1063Open in IMG/M
3300017743|Ga0181402_1060187All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED411013Open in IMG/M
3300017744|Ga0181397_1183873Not Available527Open in IMG/M
3300017746|Ga0181389_1055401All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED411148Open in IMG/M
3300017749|Ga0181392_1082349All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41969Open in IMG/M
3300017750|Ga0181405_1093184All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41762Open in IMG/M
3300017755|Ga0181411_1148573All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41675Open in IMG/M
3300017759|Ga0181414_1032489All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED411411Open in IMG/M
3300017771|Ga0181425_1157851All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41718Open in IMG/M
3300017771|Ga0181425_1261593All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41534Open in IMG/M
3300017818|Ga0181565_10561489All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41736Open in IMG/M
3300017824|Ga0181552_10587779Not Available518Open in IMG/M
3300017949|Ga0181584_10021028All Organisms → cellular organisms → Bacteria → Proteobacteria4770Open in IMG/M
3300017949|Ga0181584_10574490All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41685Open in IMG/M
3300017949|Ga0181584_10699150Not Available606Open in IMG/M
3300017951|Ga0181577_10223742All Organisms → Viruses → Predicted Viral1248Open in IMG/M
3300017958|Ga0181582_10270587All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED411126Open in IMG/M
3300017964|Ga0181589_10105713All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED412035Open in IMG/M
3300017964|Ga0181589_10106452All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED412025Open in IMG/M
3300017967|Ga0181590_10560599All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41787Open in IMG/M
3300017969|Ga0181585_10050945All Organisms → cellular organisms → Bacteria → Proteobacteria3237Open in IMG/M
3300017969|Ga0181585_10570678All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41752Open in IMG/M
3300017969|Ga0181585_10706139All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41659Open in IMG/M
3300017969|Ga0181585_10778516All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41621Open in IMG/M
3300017969|Ga0181585_10843854All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41591Open in IMG/M
3300018048|Ga0181606_10044658All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED413061Open in IMG/M
3300018417|Ga0181558_10593968Not Available570Open in IMG/M
3300018421|Ga0181592_10085630All Organisms → Viruses → Predicted Viral2466Open in IMG/M
3300018421|Ga0181592_10365601All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED411027Open in IMG/M
3300018423|Ga0181593_10681052Not Available731Open in IMG/M
3300018424|Ga0181591_10459025All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41937Open in IMG/M
3300018428|Ga0181568_11061960Not Available613Open in IMG/M
3300018876|Ga0181564_10205006All Organisms → Viruses → Predicted Viral1143Open in IMG/M
3300019765|Ga0194024_1107752Not Available639Open in IMG/M
3300020056|Ga0181574_10202980All Organisms → Viruses → Predicted Viral1269Open in IMG/M
3300020175|Ga0206124_10025109All Organisms → Viruses → Predicted Viral2869Open in IMG/M
3300020185|Ga0206131_10422687All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41549Open in IMG/M
3300020274|Ga0211658_1092124Not Available601Open in IMG/M
3300020347|Ga0211504_1123230All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41575Open in IMG/M
3300020379|Ga0211652_10283513All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41509Open in IMG/M
3300020385|Ga0211677_10388910All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41543Open in IMG/M
3300020388|Ga0211678_10141325All Organisms → Viruses → Predicted Viral1038Open in IMG/M
3300020404|Ga0211659_10365814All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41629Open in IMG/M
3300020410|Ga0211699_10233921All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41707Open in IMG/M
3300020421|Ga0211653_10141390All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED411064Open in IMG/M
3300020428|Ga0211521_10196685All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41923Open in IMG/M
3300020469|Ga0211577_10377050All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41881Open in IMG/M
3300021365|Ga0206123_10177166All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41961Open in IMG/M
3300021958|Ga0222718_10162557All Organisms → Viruses → Predicted Viral1250Open in IMG/M
3300021959|Ga0222716_10374001Not Available836Open in IMG/M
3300021960|Ga0222715_10269534All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41981Open in IMG/M
3300022900|Ga0255771_1186853All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41792Open in IMG/M
3300022907|Ga0255775_1048798All Organisms → Viruses → Predicted Viral2123Open in IMG/M
3300022923|Ga0255783_10129557All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED411261Open in IMG/M
3300022923|Ga0255783_10228059All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41813Open in IMG/M
3300022925|Ga0255773_10397816Not Available524Open in IMG/M
3300022934|Ga0255781_10144847All Organisms → Viruses → Predicted Viral1232Open in IMG/M
3300023115|Ga0255760_10203161All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED411056Open in IMG/M
3300023115|Ga0255760_10350199All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41704Open in IMG/M
3300023173|Ga0255776_10519910All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41601Open in IMG/M
3300023175|Ga0255777_10201868All Organisms → Viruses → Predicted Viral1192Open in IMG/M
3300024301|Ga0233451_10092387All Organisms → Viruses → Predicted Viral1540Open in IMG/M
3300024344|Ga0209992_10226360All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41785Open in IMG/M
3300025102|Ga0208666_1096084All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41737Open in IMG/M
3300025610|Ga0208149_1149586Not Available533Open in IMG/M
3300025630|Ga0208004_1102978All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41674Open in IMG/M
3300025653|Ga0208428_1069243All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED411036Open in IMG/M
3300025751|Ga0208150_1012167All Organisms → Viruses → Predicted Viral3096Open in IMG/M
3300025751|Ga0208150_1183463All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41652Open in IMG/M
3300025803|Ga0208425_1095393All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41698Open in IMG/M
3300025832|Ga0209307_1235753All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41519Open in IMG/M
3300025892|Ga0209630_10216484All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41920Open in IMG/M
3300025892|Ga0209630_10377332All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41620Open in IMG/M
3300027859|Ga0209503_10663851Not Available520Open in IMG/M
3300028111|Ga0233397_1140681All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41566Open in IMG/M
3300028132|Ga0228649_1120127Not Available642Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh33.03%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous13.76%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater11.93%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine10.09%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine6.42%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine6.42%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water2.75%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater2.75%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater1.83%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.83%
WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water1.83%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.92%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.92%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater0.92%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.92%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine0.92%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface0.92%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water0.92%
Saline Water And SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment0.92%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300001460Marine viral communities from the Pacific Ocean - LP-28EnvironmentalOpen in IMG/M
3300002483Marine viral communities from the Pacific Ocean - ETNP_6_30EnvironmentalOpen in IMG/M
3300005512Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_waterEnvironmentalOpen in IMG/M
3300006025Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006026Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006352Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNAEnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300007345Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30EnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007725Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MGEnvironmentalOpen in IMG/M
3300007778Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MGEnvironmentalOpen in IMG/M
3300008012Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300009027Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MGEnvironmentalOpen in IMG/M
3300009077Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328EnvironmentalOpen in IMG/M
3300009193Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321EnvironmentalOpen in IMG/M
3300009449Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426EnvironmentalOpen in IMG/M
3300009496Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524EnvironmentalOpen in IMG/M
3300009498Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426EnvironmentalOpen in IMG/M
3300009790Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 MetagenomeEnvironmentalOpen in IMG/M
3300012919Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaGEnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300016762Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071413CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017730Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13EnvironmentalOpen in IMG/M
3300017732Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11EnvironmentalOpen in IMG/M
3300017737Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2)EnvironmentalOpen in IMG/M
3300017743Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17EnvironmentalOpen in IMG/M
3300017744Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23EnvironmentalOpen in IMG/M
3300017746Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29EnvironmentalOpen in IMG/M
3300017749Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15EnvironmentalOpen in IMG/M
3300017750Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29EnvironmentalOpen in IMG/M
3300017755Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09EnvironmentalOpen in IMG/M
3300017759Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28EnvironmentalOpen in IMG/M
3300017771Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13EnvironmentalOpen in IMG/M
3300017818Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017824Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017949Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017958Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017964Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017967Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017969Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018048Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018417Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018421Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018423Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018424Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018428Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018876Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019765Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MGEnvironmentalOpen in IMG/M
3300020056Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101410AT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020175Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2EnvironmentalOpen in IMG/M
3300020185Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1EnvironmentalOpen in IMG/M
3300020274Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX556029-ERR598943)EnvironmentalOpen in IMG/M
3300020347Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994)EnvironmentalOpen in IMG/M
3300020379Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556001-ERR599168)EnvironmentalOpen in IMG/M
3300020385Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965)EnvironmentalOpen in IMG/M
3300020388Marine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064)EnvironmentalOpen in IMG/M
3300020404Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978)EnvironmentalOpen in IMG/M
3300020410Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148)EnvironmentalOpen in IMG/M
3300020421Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007)EnvironmentalOpen in IMG/M
3300020428Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556032-ERR599094)EnvironmentalOpen in IMG/M
3300020469Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052)EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021958Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27DEnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300021960Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9DEnvironmentalOpen in IMG/M
3300022900Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaGEnvironmentalOpen in IMG/M
3300022907Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaGEnvironmentalOpen in IMG/M
3300022923Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaGEnvironmentalOpen in IMG/M
3300022925Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaGEnvironmentalOpen in IMG/M
3300022934Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaGEnvironmentalOpen in IMG/M
3300023115Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaGEnvironmentalOpen in IMG/M
3300023173Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413AT metaGEnvironmentalOpen in IMG/M
3300023175Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaGEnvironmentalOpen in IMG/M
3300024301Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504CT (spades assembly)EnvironmentalOpen in IMG/M
3300024344Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025102Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025610Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025630Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025653Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025751Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025832Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 (SPAdes)EnvironmentalOpen in IMG/M
3300025892Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes)EnvironmentalOpen in IMG/M
3300027859Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028111Seawater microbial communities from Monterey Bay, California, United States - 35DEnvironmentalOpen in IMG/M
3300028132Seawater microbial communities from Monterey Bay, California, United States - 61DEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2011_1011245023300000115MarineIQDGNLRNIRRAVADYNKLNTRMKLQTLHRLQQQLHSKLPNTDILKKFKEL*
JGI24003J15210_1006356633300001460MarineEEHFKNLTHLERSLNITDANLKNIRRAVANYNKLNAKLKMQTLHRLQQQLQSKLPNTDIHKKFKEL*
JGI25132J35274_101909013300002483MarineNIRRSVANYDKLNSRAKMQTLHRLQQQLQSKLPNTDLLKKFKEL*
Ga0074648_112966113300005512Saline Water And SedimentERALNITDANLKNIRRSVANYNKLESRLKLQTLHRLQQQLQAKLPNTDILRKFKEL*
Ga0075474_1027568413300006025AqueousNITDANLKNIRRAVADYNNLDSKMKMQTLHRLQQQLQAKLPNTDILKKFKEL*
Ga0075478_1016573613300006026AqueousLNIQDANLKNIRRAVANYGRLESRLKLQTLHRLQQQLQAKLSNTDILKKFKEL*
Ga0075478_1022009613300006026AqueousIQDANLKNIRRAVANYTKLDSKMKMQTLHRLQQQLQAKLPNTDILKKFKEL*
Ga0075448_1015184523300006352MarineLERALNITDANYKNVRRAVANYTNLNSKIKSQTLVKLKQMLQSKLPNTDIHKKIKEL*
Ga0098038_106424213300006735MarineRSLNIRDANLKNIRRAVANYNRLDSKMKLQTLHRLKQQLQSKLPNTDILKKFKEL*
Ga0098038_111230613300006735MarineNIRRAVANYTKLNSKMKMQTLHRLQQQLQSKLPNTDILKKFKEL*
Ga0070754_1027850713300006810AqueousNIRRAVANYTKLDSKMKMQTLHRLQQQLQAKLPNTDILKKFKEL*
Ga0070750_1011232013300006916AqueousNITDANLKNIRRSVANYNRLESRLKLQTLHRLQQQLQAKLPNTDILKKFKEL*
Ga0070746_1030547513300006919AqueousIRRAVANYTKLDSKMKMQTLHRLQQQLQSKLPNTDILKKFKEL*
Ga0070752_137398813300007345AqueousKNLTHLERSLNITDANLKNIRRAVADYNNLNSKMKMQTLHRLQQQLQSKLPNTDILKKFKEL*
Ga0099849_121675413300007539AqueousSLRRNIANYNGLESRLKLQTLHRLQQQLQAKLPNTDLHKKFKEL*
Ga0102951_123076913300007725WaterYRNLTHLERSLNITDANLKNIRRAVADYNNLNSKMKMQTLHRLQQQLQAKLPNTDILKRFKEL*
Ga0102954_110238923300007778WaterTDANLKNIRRAVANYHSLNTKMKMQTLHRLQQQLQSKLPNTDILKKFKEL*
Ga0075480_1006128243300008012AqueousITDANLKNIRRSVANYNRLESRLKLQTLHRLQQQLQAKLPNTDILKKFKEL*
Ga0102957_110645723300009027Pond WaterKNIRRAVANYKSLDSKMKMQTLHRLQQQLQSKLPNTDILKKFKEL*
Ga0115552_120151413300009077Pelagic MarineLNIKDANLKNIRRAVANYTKLDSKMKMQTLHRLQQQLQSKLPNTDILKKFKEL*
Ga0115551_121510123300009193Pelagic MarineVADYNNLDSKMKMQTLHRLQQQLQAKLPNTDILKKFKEL*
Ga0115558_139537313300009449Pelagic MarineNLKNIRRAVANYTKLDSKMKMQTLHRLQQQLQAKLPNTDILKKFKEP*
Ga0115570_1043594913300009496Pelagic MarineNLKNIRRAVANYTKLDSKMKMQTLHRLQQQLQAKLPNTDILKKFKEL*
Ga0115568_1007286543300009498Pelagic MarineLERSLNITDANLKNIRRAVANYTKLNSKMKMQTLHRLQQQLQSKLPNTDILKKFKEL*
Ga0115568_1037230013300009498Pelagic MarineLRTWEDHFKNLTHLERALNIQDANLKNIRRAVANYTKLDSKMKMQTLHRLQQQLQAKLPNTDILKKFKEL*
Ga0115012_1014575243300009790MarineDYMGLNSRSKQQTVNKLKQMLQAKLPNTDIHKKFKEL*
Ga0160422_1049540713300012919SeawaterSYEDHYKNLTNLERALNINDSNLRNIRRAVANYSNLNVKMKLQTLHRLQQQLQAKLPNTDILKKFKEL*
Ga0163111_1226544013300012954Surface SeawaterHLERSLNIQDANLKNIRRAVANYTKLNSKMKMQTLHRLQQQLQAKLPNTDILKKFKEL*
Ga0182084_132262323300016762Salt MarshERALNITDANLKNIRRAVANYKSLDARMKMQTLHRLQQQLQAKLPNTDILKKFKEL
Ga0180120_1016306423300017697Freshwater To Marine Saline GradientIRDANLKNIRRAVANYTKLNSQMKMQTLHRLQQQLQSKLPNTDILKKFKEL
Ga0181390_101505863300017719SeawaterWEDHYKNLTHLERSLNINDANLKNIRRAVANYNKLDSKMKMQTLHRLQQQLQSKLPNTDILKKFKEL
Ga0181417_111171613300017730SeawaterRSWEDHFKNLTHLERALNITDANLKNIRRAVANYTKLNSKMKMQTLHRLQQQLQSKLPNTDILKKFKEL
Ga0181415_105290823300017732SeawaterRDANLKNIRRAVANYNKLDARLKMQTLHRLQQQLQSKLPNTDILKKFKEL
Ga0187218_104832313300017737SeawaterNITDANLKNIRRAVANYHSLNSKMKMQTLHRLQQQLQSKLPNTDILKKFKEL
Ga0181402_106018713300017743SeawaterHYKNLTHIERSLNIRDANLKNIRRAVANYNKLDARLKMQTLHRLQQQLQSKLPNTDILKKFKEL
Ga0181397_118387323300017744SeawaterRTWEEHYKNLTHIERSLNIRDANLKNIRRAVANYNKLDARLKMQTLHRLQQQLQSKLPNTDILKKFKDL
Ga0181389_105540113300017746SeawaterEAVANYKKLNIKSKMQTLHRLQQQLQAKLPNTDILKKFKEL
Ga0181392_108234923300017749SeawaterNLRRAVANYTKLDSKMKMQTLHRLQQQLQSKLPNTDILKKFKEL
Ga0181405_109318423300017750SeawaterRTWEDHFKILTHLERSLNITDANLKNIRRAVANYHSLNSKMKMQTLHRLQQQLQSKLPNTDILKKFKEL
Ga0181411_114857313300017755SeawaterITDANLKNIRRAVANYHSLNTKMKMQTLHRLQQQLQSKLPNTDILKKFKEL
Ga0181414_103248933300017759SeawaterNIQDANLKNIRRAVANYNKLNSKMKMQTLHRLQQQLQSKLPNTDILRKFKEL
Ga0181425_115785113300017771SeawaterEDHFKNLTHLERSLNITDANLKNIRRAVANYHSLNTKMKMQTLHRLQQQLQSKLPNTDILKKFKEL
Ga0181425_126159313300017771SeawaterEHYKNLTHIERSLNIRDANLKNIRRAVANYNKLDARLKMQTLHRLQQQLQSKLPNTDILKKFKEL
Ga0181565_1056148913300017818Salt MarshRRWEEHFKNLTHLERSLNITDANLKNIRRAVANYTKLDSKMKMQTLHRLQQQLQAKLPNTDILKKFKEL
Ga0181552_1058777923300017824Salt MarshDANLKNIRRSVANYNRLESRLKLQTLHRLQQQLQAKLPNTDILKKFKEL
Ga0181584_10021028103300017949Salt MarshHYKNLTHLERALNITDANLKNIRRAVANYKSLDARMKMQTLHRLQQQLQAKLPNTDILKKFKEL
Ga0181584_1057449013300017949Salt MarshYNRLESRLKLQTLHRLQQQLQAKLPNTDILKKFKEL
Ga0181584_1069915013300017949Salt MarshHLERSLNITDANLKNIRRAVADYNNLDSKMKMQTLHRLQQQLQAKLPNTDILKKFKEL
Ga0181577_1022374213300017951Salt MarshALNIQDANLKNIRRAVANYTKLDSRTKMQTLHRLHQQLQSKLPNTDILKKFKEL
Ga0181582_1027058713300017958Salt MarshQDANLKNIRRAVANYTKLDSKMKMQTLHRLQQQLQAKLPNTDILKKFKEL
Ga0181589_1010571313300017964Salt MarshNITDANLKNIRRSVANYNRLESRLKLQTLHRLQQQLQAKLPNTDLHRKFKEL
Ga0181589_1010645243300017964Salt MarshLTHLEMAHNITDANLKNIRRAVANYHSVNSKMKMQTLHRLQQQLQAKLPNTDILKKFKEL
Ga0181590_1056059923300017967Salt MarshANLKNIRRAVANYTKLDSKMKMQTLHRLQQQLQAKLPNTDILKKFKEL
Ga0181585_1005094513300017969Salt MarshDANLKNIRRAVANYTKLDSKMKIQTLHRLQQQLQAKLPNTDILKKFKEL
Ga0181585_1057067813300017969Salt MarshNRLESRLKLQTLHRLQQQLQAKLPNTDILKKFKEL
Ga0181585_1070613913300017969Salt MarshVANYTKLDARTKMQTLHRLQQQLQAKLPNTDILKKFKEL
Ga0181585_1077851613300017969Salt MarshVANYSKLDSKTKVQTLHMLKQQAHAKLPNTDIHKRFKEL
Ga0181585_1084385413300017969Salt MarshALNITDANLKNIRRSVANYNRLESRLKLQTLHRLQQQLQAKLPNTDILKKFKEL
Ga0181606_1004465813300018048Salt MarshNITDANLKNIRRAVANYTKLDSKMKIQTLHRLQQQLQAKLPNTDILKKFKEL
Ga0181558_1059396813300018417Salt MarshHFKNLTMLERALNITDANYKNIRRAVANFTKLNPKEKIHTITKLKNILQSKLPNTDLHKKFKEL
Ga0181592_1008563013300018421Salt MarshNLTHLERALNITDANLKNIRRAVANYTKLDSKMKMQTLHRLQQQLQAKLPNTDILKKFKE
Ga0181592_1036560113300018421Salt MarshLKNIRRSVANYNRLESRLKLQTLHRLQQQLQAKLPNTDILKKFKEL
Ga0181593_1068105223300018423Salt MarshKNIRRSVANYTRLESRLKLQTLHRLQQQLQAKLPNTDLHKKFKEL
Ga0181591_1045902523300018424Salt MarshSVANYNRLESRLKLQTLHRLQQQLQAKLPNTDILKKFKEL
Ga0181568_1106196013300018428Salt MarshDHYKNLTHLERSLNIQDANLKNIRRAVANYTKLDSKMKIQTLHRLQQQLQAKLPNTDILKKFKEL
Ga0181564_1020500633300018876Salt MarshERALNITDANLKNIRRAVANYTKLDSKMKMQTLHRLQQQLQAKLPNTDILKKFKEL
Ga0194024_110775213300019765FreshwaterNLTMLERALNITDANYKNIRRAVANFTKLNPKEKIHTITKLKNILQSKLPNTDLHKKFKE
Ga0181574_1020298013300020056Salt MarshLNITDANLKNIRRAVANYTKLDSKMKMQTLHRLQQQLQAKLPNTDILKKFKEL
Ga0206124_1002510963300020175SeawaterVANYTKLDSKMKMQTLHRLQQQLQAKLPNTDILKKFKEL
Ga0206131_1042268723300020185SeawaterTHLERSLNIQDANLKNIRRAVADYNNLNSKMKMQTLHRLQQQLQAKLPNTDILKKFKEL
Ga0211658_109212423300020274MarineVANYTKLDARMKMQTLHRLQQQLQSKLPNTDILKKFKEL
Ga0211504_112323013300020347MarineRSLNIQDGNLRNIRRAVADYNKLNAKMKLQTLHRLQQQLHSKLPNTDILKKFKEL
Ga0211652_1028351313300020379MarineEDHFKNLTHLERALNITDANLKNIRRAVANYTKLDSKMKMQTLHRLQQQLQSKLPNTDILKKFKEL
Ga0211677_1038891023300020385MarineAVANYTKLNSKMKMQTLHRLQQQLQSKLPNTDILKKFKEL
Ga0211678_1014132533300020388MarineTWEEHFKNLTHLERSLNITDANLKNIRRAVANYTKLNSKMKMQTLHRLQQQLQSKLPNTDILKKFKEL
Ga0211659_1036581423300020404MarineRDANLKNIRRAVANYTKLNSKMKMQTLHRLQQQLQSKLPNTDILKKFKEL
Ga0211699_1023392123300020410MarineINDSNLRNIRRAVANYNKLNSKMKMQTLHRLQQQLQSKLPNTDILKKFKEL
Ga0211653_1014139033300020421MarineDANLKNIRRAVANYTKLDARMKMQTLHRLQQQLQSKLPNTDILKKFKEL
Ga0211521_1019668523300020428MarineLNIQDANLKNIRRAVANYHSLNSKMKMQTLHRLQQQLQSKLPNTDILKKFKEL
Ga0211577_1037705023300020469MarineNLKNIRRAVANYGRLDARRKIQTLHRLQQQLQSKLPNTDILKKFKEL
Ga0206123_1017716623300021365SeawaterANLKNIRRAVANYSSLNSKMKMQTLHRLQQQLQSKLPNTDILKKFKEL
Ga0222718_1016255733300021958Estuarine WaterLNIQDANLKNIRRAVADYNNLDSKMKMQTLHRLQQQLQAKLPNTDILKKFKEL
Ga0222716_1037400123300021959Estuarine WaterVADYNNLDSKMKMQTLHRLQQQLQAKLPNTDILKKFKEL
Ga0222715_1026953423300021960Estuarine WaterYNNLDSKMKMQTLHRLQQQLQAKLPNTDILKKFKEL
Ga0255771_118685323300022900Salt MarshQDANLKNIRRAVANYTKLDARTKMQTLHRLQQQLQAKLPNTDILKKFKEL
Ga0255775_104879813300022907Salt MarshTWEDHYRNLTHLERALNITDANLKNIRRAVANYTKLDSKMKMQTLHRLQQQLQAKLPNTDILKKFKEL
Ga0255783_1012955733300022923Salt MarshDSNLKNIRRAVANYNKLDSRSKLQTLNRLKQQLQSKLPNTDILRKFKEL
Ga0255783_1022805923300022923Salt MarshQLERALNITDANLKNIRRSVANYNRLESRLKLQTLHRLQQQLQAKLPNTDILKKFKEL
Ga0255773_1039781623300022925Salt MarshRTWEDHYKNLTHLERSLNIQDANLKNIRRAVANYTKLDSKMKMQTLHRLQQQLQAKLPNTDILKKFKEL
Ga0255781_1014484713300022934Salt MarshYRNLTQVERALNIQDANLKNIRRAVANYTKLDARTKMQTLHRLQQQLQAKLPNTDILKKFKEL
Ga0255760_1020316113300023115Salt MarshRRSVANYNQLESRLKLQTLHRLQQQLQAKLPNTDILKKFKEL
Ga0255760_1035019933300023115Salt MarshNIRRAVANYNRLESRLKLQTLHRLQQQLQAKLPNTDILKKFKEL
Ga0255776_1051991023300023173Salt MarshVANYNRLESRLKLQTLHRLQQQLQAKLPNTDILKKFKEL
Ga0255777_1020186813300023175Salt MarshSWEDHYRNLTQVERALNIQDANLKNIRRAVANYTKLDARTKMQTLHRLQQQLQAKLPNTDILKKFKEL
Ga0233451_1009238733300024301Salt MarshMRTWEDHYKNLTHLERALNIQDANLKNIRRAVANYTKLDARTKMQTLHRLQQQLQAKLPNTDILKKFKEL
Ga0209992_1022636013300024344Deep SubsurfaceNLSQLERALNINDANLRNIRRAVANYKNLDARQKMQALQRLRQQLQSKLPNTDILKKFKE
Ga0208666_109608423300025102MarineLRTWEDHYKNLTHLERSLNIQDANLKNIRRAVANYTKLDSKMKMQTLHRLQQQLQSKLPNTDILKKFKEL
Ga0208149_114958613300025610AqueousEHFKNLTMLERALNITDANYKNIRRAVANFTKLNPKEKIHTITKLKNILQSKLPNTDLHKKFKEL
Ga0208004_110297823300025630AqueousADYNNLNSKMKMQTLHRLQQQLQSKLPNTDILKKFKEL
Ga0208428_106924323300025653AqueousLERALNITDANLKNIRRSVANYNRLESRLKLQTLHRLQQQLQAKLPNTDILKKFKEL
Ga0208150_101216773300025751AqueousLERALNIQDANLKNIRRAVANYTKLDSKMKMQTLHRLQQQLQAKLPNTDILKKFKEL
Ga0208150_118346313300025751AqueousRRSVANYNRLESRLKLQTLHRLQQQLQAKLPNTDILKKFKEL
Ga0208425_109539313300025803AqueousHFKNLTHLERSLNITDANLKNIRRAVANYTKLDVRTKMQTLHRLQQQLQAKLPNTDILKKFKEL
Ga0209307_123575313300025832Pelagic MarineTQLERSLNIQDGNLRNIRRAVADYNKLNTRMKLQTLHRLQQQLHSKLPNTDILKKFKEL
Ga0209630_1021648413300025892Pelagic MarineDATLKNIRRAVADYNNLNSKMKMQTLHRLQQQLQSKLPNTDILKKFKEL
Ga0209630_1037733223300025892Pelagic MarineNLKNIRRAVADYNNLNSKMKMQTLHRLQQQLQAKLPNTDILKKFKEL
Ga0209503_1066385113300027859MarineRSWEDHYKNLTNLERALGIQDANLRNIRRAVANYNKLDSKMKMQTLHRLQQQLQSKLPNTDILKKFKEL
Ga0233397_114068113300028111SeawaterRYMRTWEDHFKNLTHLERSLNITDANLKNIRRAVANYHSLNTKMKMQTLHRLQQQLQSKLPNTDILKKFKEL
Ga0228649_112012713300028132SeawaterLTHLERALNITDANLKNIRRAVANYTKLNSKMKMQTLHRLQQQLQSKLPNTDILKKFKEL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.