NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F088970

Metagenome / Metatranscriptome Family F088970

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F088970
Family Type Metagenome / Metatranscriptome
Number of Sequences 109
Average Sequence Length 55 residues
Representative Sequence RRSFRLPLTGAGQAVATRVLAAIADLERDALSRLDATQLAGYHAVVTALQEAC
Number of Associated Samples 102
Number of Associated Scaffolds 109

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.92 %
% of genes near scaffold ends (potentially truncated) 98.17 %
% of genes from short scaffolds (< 2000 bps) 92.66 %
Associated GOLD sequencing projects 95
AlphaFold2 3D model prediction Yes
3D model pTM-score0.62

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.083 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(22.936 % of family members)
Environment Ontology (ENVO) Unclassified
(22.936 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(45.872 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 49.38%    β-sheet: 0.00%    Coil/Unstructured: 50.62%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.62
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 109 Family Scaffolds
PF12680SnoaL_2 3.67
PF12535Nudix_N 2.75
PF13193AMP-binding_C 2.75
PF17032zinc_ribbon_15 1.83
PF00069Pkinase 1.83
PF08044DUF1707 0.92
PF13671AAA_33 0.92
PF04493Endonuclease_5 0.92
PF00376MerR 0.92
PF00701DHDPS 0.92
PF00872Transposase_mut 0.92
PF00797Acetyltransf_2 0.92
PF13358DDE_3 0.92
PF13699DUF4157 0.92
PF01243Putative_PNPOx 0.92

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 109 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 7.34
COG03294-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyaseCell wall/membrane/envelope biogenesis [M] 1.83
COG1515Deoxyinosine 3'-endonuclease (endonuclease V)Replication, recombination and repair [L] 0.92
COG2162Arylamine N-acetyltransferaseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.92
COG3328Transposase (or an inactivated derivative)Mobilome: prophages, transposons [X] 0.92


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.08 %
UnclassifiedrootN/A0.92 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002245|JGIcombinedJ26739_101653697All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria539Open in IMG/M
3300004114|Ga0062593_100408796All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1217Open in IMG/M
3300004635|Ga0062388_102419524All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia550Open in IMG/M
3300005186|Ga0066676_10682680All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → Frankia inefficax699Open in IMG/M
3300005434|Ga0070709_11204450All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia609Open in IMG/M
3300005435|Ga0070714_100895528All Organisms → cellular organisms → Bacteria861Open in IMG/M
3300005436|Ga0070713_100389088All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1300Open in IMG/M
3300005446|Ga0066686_10349130All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → Frankia inefficax1009Open in IMG/M
3300005471|Ga0070698_101973898All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia537Open in IMG/M
3300005518|Ga0070699_101149828All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia712Open in IMG/M
3300005537|Ga0070730_10687596All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia649Open in IMG/M
3300005546|Ga0070696_101768504All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → Frankia inefficax534Open in IMG/M
3300005610|Ga0070763_10110337All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1398Open in IMG/M
3300006102|Ga0075015_100421521All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia757Open in IMG/M
3300006358|Ga0068871_100287224All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1440Open in IMG/M
3300006358|Ga0068871_100849396All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia844Open in IMG/M
3300006755|Ga0079222_10484948All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia899Open in IMG/M
3300006903|Ga0075426_11144518All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia590Open in IMG/M
3300006969|Ga0075419_10059932All Organisms → cellular organisms → Bacteria2401Open in IMG/M
3300009012|Ga0066710_103310575All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria615Open in IMG/M
3300009520|Ga0116214_1129979All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia933Open in IMG/M
3300009623|Ga0116133_1179421All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia563Open in IMG/M
3300009665|Ga0116135_1314542All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia621Open in IMG/M
3300009672|Ga0116215_1179010All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia937Open in IMG/M
3300009683|Ga0116224_10408991All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria646Open in IMG/M
3300009839|Ga0116223_10204037All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1207Open in IMG/M
3300010037|Ga0126304_10196763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1317Open in IMG/M
3300010048|Ga0126373_10605078All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1149Open in IMG/M
3300010152|Ga0126318_10672707All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria651Open in IMG/M
3300010379|Ga0136449_101109386All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1258Open in IMG/M
3300010876|Ga0126361_10342304All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2413Open in IMG/M
3300011003|Ga0138514_100028720All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1043Open in IMG/M
3300012199|Ga0137383_11285856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria522Open in IMG/M
3300012202|Ga0137363_10266165All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1397Open in IMG/M
3300012210|Ga0137378_11143691All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces694Open in IMG/M
3300012211|Ga0137377_11871363All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria518Open in IMG/M
3300012351|Ga0137386_11100035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria561Open in IMG/M
3300012357|Ga0137384_10078418All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2744Open in IMG/M
3300012925|Ga0137419_11493290All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia572Open in IMG/M
3300012971|Ga0126369_12167848All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia643Open in IMG/M
3300014495|Ga0182015_10602293All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria697Open in IMG/M
3300014745|Ga0157377_10959013All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia644Open in IMG/M
3300016270|Ga0182036_10828047All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria755Open in IMG/M
3300016319|Ga0182033_11824606All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria552Open in IMG/M
3300016422|Ga0182039_11400990All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia635Open in IMG/M
3300017933|Ga0187801_10463795All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria533Open in IMG/M
3300017970|Ga0187783_10583928All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces809Open in IMG/M
3300018037|Ga0187883_10712005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria524Open in IMG/M
3300018058|Ga0187766_10615431All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria743Open in IMG/M
3300018433|Ga0066667_10677689All Organisms → cellular organisms → Bacteria864Open in IMG/M
3300020081|Ga0206354_11719303All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia605Open in IMG/M
3300020581|Ga0210399_10474339All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1041Open in IMG/M
3300020582|Ga0210395_10046944All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3162Open in IMG/M
3300021180|Ga0210396_10122556All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2345Open in IMG/M
3300021404|Ga0210389_11354396All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria544Open in IMG/M
3300021407|Ga0210383_10688680All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria879Open in IMG/M
3300021474|Ga0210390_11409864All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria554Open in IMG/M
3300024325|Ga0247678_1044690All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria711Open in IMG/M
3300025321|Ga0207656_10370185All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia717Open in IMG/M
3300025906|Ga0207699_11245332All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria551Open in IMG/M
3300025981|Ga0207640_10361054All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1170Open in IMG/M
3300026324|Ga0209470_1252599All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae706Open in IMG/M
3300027590|Ga0209116_1077441All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria727Open in IMG/M
3300027854|Ga0209517_10437300All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria726Open in IMG/M
3300027855|Ga0209693_10298877All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria785Open in IMG/M
3300027855|Ga0209693_10308480All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia771Open in IMG/M
3300027905|Ga0209415_10340524All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1257Open in IMG/M
3300028718|Ga0307307_10096655All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia898Open in IMG/M
3300028759|Ga0302224_10214308All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia764Open in IMG/M
3300028773|Ga0302234_10047666All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1945Open in IMG/M
3300028799|Ga0307284_10065537All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1306Open in IMG/M
3300029999|Ga0311339_10640561All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1051Open in IMG/M
3300030057|Ga0302176_10424023Not Available537Open in IMG/M
3300030618|Ga0311354_10047807All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5001Open in IMG/M
3300030618|Ga0311354_10552768All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1127Open in IMG/M
3300030659|Ga0316363_10093481All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia1345Open in IMG/M
3300030677|Ga0302317_10377367All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria627Open in IMG/M
3300031226|Ga0307497_10451911All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria625Open in IMG/M
3300031573|Ga0310915_11012376All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria579Open in IMG/M
3300031713|Ga0318496_10331342All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria841Open in IMG/M
3300031736|Ga0318501_10287889All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae875Open in IMG/M
3300031751|Ga0318494_10137774All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1369Open in IMG/M
3300031765|Ga0318554_10596643All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria622Open in IMG/M
3300031765|Ga0318554_10707239All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria565Open in IMG/M
3300031769|Ga0318526_10394897All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria565Open in IMG/M
3300031770|Ga0318521_10675280All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria627Open in IMG/M
3300031781|Ga0318547_10985818All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria527Open in IMG/M
3300031831|Ga0318564_10336729All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria664Open in IMG/M
3300031833|Ga0310917_10666988All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia705Open in IMG/M
3300031846|Ga0318512_10404060All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria686Open in IMG/M
3300031912|Ga0306921_11137338All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria873Open in IMG/M
3300031938|Ga0308175_102486458All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria580Open in IMG/M
3300031941|Ga0310912_11271834All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria558Open in IMG/M
3300031954|Ga0306926_10689002All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1240Open in IMG/M
3300031981|Ga0318531_10147841All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1052Open in IMG/M
3300031996|Ga0308176_10331262All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1495Open in IMG/M
3300032001|Ga0306922_10347461All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1591Open in IMG/M
3300032009|Ga0318563_10296865All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia874Open in IMG/M
3300032025|Ga0318507_10167648All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia943Open in IMG/M
3300032060|Ga0318505_10541826All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria548Open in IMG/M
3300032089|Ga0318525_10681492All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria523Open in IMG/M
3300032261|Ga0306920_101670837All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria903Open in IMG/M
3300032828|Ga0335080_11298308All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia727Open in IMG/M
3300032828|Ga0335080_11461990All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces677Open in IMG/M
3300032893|Ga0335069_10248953All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2138Open in IMG/M
3300032954|Ga0335083_10671065All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia845Open in IMG/M
3300032954|Ga0335083_11400550All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia534Open in IMG/M
3300032955|Ga0335076_10037386All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae4857Open in IMG/M
3300032955|Ga0335076_10185140All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1988Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil22.94%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil7.34%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.42%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil6.42%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa6.42%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.75%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.75%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland1.83%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.83%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.83%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.83%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.83%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.83%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere1.83%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.83%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.92%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.92%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.92%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.92%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.92%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.92%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.92%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.92%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.92%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.92%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.92%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.92%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.92%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009623Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10EnvironmentalOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300009672Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaGEnvironmentalOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010152Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011003Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015EnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300020081Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300024325Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK19EnvironmentalOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300027590Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300028718Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194EnvironmentalOpen in IMG/M
3300028759Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1EnvironmentalOpen in IMG/M
3300028773Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030057Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1EnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030659Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2)EnvironmentalOpen in IMG/M
3300030677Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_3EnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGIcombinedJ26739_10165369713300002245Forest SoilDRRSFRLPLTETGQAVADRVLAAVADLERDALARLPATQIAGYHAVITALQEACS*
Ga0062593_10040879613300004114SoilELDPADRRSFRLPLTETGQAVAARVRAAIADLERDTLSRLDATQLAGYHAVVTALQEAC*
Ga0062388_10241952413300004635Bog Forest SoilRLPLTEAGQAVATRVLTAIADLERDALSRLSAAQIAGYHAVITALQEAC*
Ga0066676_1068268013300005186SoilRELDPADRRSFRLPLTGAGQAVSARVLAAIADLERDALSRLDATQLAGYHAVVAALQEAC
Ga0070709_1120445023300005434Corn, Switchgrass And Miscanthus RhizosphereYLARELDPADRRSFRLPLTEAGQAVAARVLAAIADLERDALSRLDATQLAGYHAVITALQEAC*
Ga0070714_10089552813300005435Agricultural SoilSFRLPLTETGQAVAARVRAAIADLERDALSRLDATQLAGYHAVVTALQEAC*
Ga0070713_10038908813300005436Corn, Switchgrass And Miscanthus RhizosphereDRRSFRLPLTGAGQAVAARVLAAVADLERDALSRLDATQLAGYHAVVAALQEAC*
Ga0066686_1034913023300005446SoilRRSFRLPLTGAGQAVATRVLAAIADLERDALSRLDATQLAGYHAVVTALQEAC*
Ga0070698_10197389813300005471Corn, Switchgrass And Miscanthus RhizosphereRELDPADRRSFRLPLTESGQTVAARVLAAVADLEHKALSRLDATQLAGYRAVITALQEAC
Ga0070699_10114982823300005518Corn, Switchgrass And Miscanthus RhizosphereADRRSFRLPLTEAGQAVASRVLTAIADLERDALSRLSAAQIAGYHAVITALQEVG*
Ga0070730_1068759623300005537Surface SoilDRRSFRLPLTEAGKAAATRVLTAIADLERDALSRLSAIQIAGYHAVITALQEVS*
Ga0070696_10176850413300005546Corn, Switchgrass And Miscanthus RhizospherePLTGAGQAVAARVLAAIADLERDALSRLDATQLAGYHAVVAALQEAC*
Ga0070763_1011033743300005610SoilDRRSFRLPLTEAGQAVAARVLAAVADLEREAMAGLSATQVAGFHSVLTALQEAC*
Ga0075015_10042152113300006102WatershedsDRRSFRLPLTEAGRAVASQVLTAIADLERNALSGLPATQIAGYHAVIAALQEAC*
Ga0068871_10028722433300006358Miscanthus RhizosphereLPLTETGQAVAARVRAAIADLERDALSGLDATQLAGYHAVVTALQEAC*
Ga0068871_10084939633300006358Miscanthus RhizosphereVDPADRRSFRLPLTDRGREGAARARAAITDLERTVLSRLDAAQLAGYHAVISALEEAC*
Ga0079222_1048494823300006755Agricultural SoilADRRSFRLPLTGAGQAVAARVLAAIADLERDALSRLDAAQLAGYHAVVAALQEAC*
Ga0075426_1114451823300006903Populus RhizospherePADRRSFRLPLTGAGQAVAARVLAAIADLERDALSRLDAAQLAGYHAVVAALQEAC*
Ga0075419_1005993213300006969Populus RhizosphereRELDAFDRRSFRLALTARGRTVAARVRRAVADLERDALTTVSPRQVAGYHAVVAALQEVS
Ga0066710_10331057513300009012Grasslands SoilRRSFRLPLTGAGQAVAARVLAAIADLERDALSRLDAAQLAGYHAVVAALQEAC
Ga0116214_112997923300009520Peatlands SoilDPADRRSFRLPLTEAGQAVAARVLTAIGDLEHEALSRLSATQIAGYHAVISALQEAC*
Ga0116133_117942113300009623PeatlandGYLTRELDPADRRSFRLPLTEAGQAVAGRVLAAVADLERDALARLSATQLAGYHAVITALQEAC*
Ga0116135_131454213300009665PeatlandRELDPADRRSFRLPLTETGQAVADRVLAAVADLEREALRRLSATQLAGYHAVVTALQEAC
Ga0116215_117901023300009672Peatlands SoilGYLTRELDPADRRSFRLPLTEAGQAVATRVLTAVGDLEHEALSRLSATQIAGYHAVISALQEAS*
Ga0116224_1040899113300009683Peatlands SoilADRRSFRLPLTEAGQAVATRVLTAIGNLEHQALSRLSATQIAGYHAVISALQEAC*
Ga0116223_1020403743300009839Peatlands SoilRSFRLPLTELGQEVAERVRAAVSDIERDALARLSPTQIAGFHAVVAALQAAS*
Ga0126304_1019676333300010037Serpentine SoilGHITRELDPADRRSFRITLTTAGRAVAMQVHAAVIDLERAALAEMTDRDLAGYHAIITALQEVSS*
Ga0126373_1060507833300010048Tropical Forest SoilELDPADRRSFRLPLTKAGQAVAAQVLAAIADLERHALSGLDATQLAGYHAVITALQEAR*
Ga0126318_1067270713300010152SoilRDLDPADRRSFRLPLTETGQAVAARVRAAIADLERDALSRLDATQLAGYHAVVTALQEAC
Ga0136449_10110938613300010379Peatlands SoilRGYLTRELDPADRRSFRLPLTEAGQAVATRVLTAIGDLEHQALSRLSATQIAGYHAVISALQEAC*
Ga0126361_1034230433300010876Boreal Forest SoilLTRELDPADRRSFRLPLTEAGQAVAGRVLAAVAELERQALARLSAAQIAGYHAVITALQEVC*
Ga0138514_10002872033300011003SoilNRELDPADRRSFRLPLTEAGQATAARVLAAIADLERDALSRVDATQLAGYHAVITALQEAC*
Ga0137383_1128585613300012199Vadose Zone SoilLVRELDPADRRSFRLPLTGAGQAAAARVLTAIADLERDALSRLDATQIAGYHAVITALQEAC*
Ga0137363_1026616533300012202Vadose Zone SoilVPLTGAGQAVAARVLAAIADLECDALSRLDPTQLAGYHAVVAALQEAC*
Ga0137378_1114369113300012210Vadose Zone SoilLARELDPADRRSFRLPLTGAGQAVSARVLAAIADLERDALSRLDATQLAGYHAVVAALQEAC*
Ga0137377_1187136323300012211Vadose Zone SoilFRLPLTGAGQAAAARVLTAIADLERDALSRLDAIQIAGYHAVITALQEAC*
Ga0137386_1110003513300012351Vadose Zone SoilELDPADRRSFRLPLTETGQAVAARALAAIAALERDALSRLDATQLAGYHAVVTALQEAC*
Ga0137384_1007841863300012357Vadose Zone SoilFRLPLTETGQAVAAQALAAIAALERDALSRLDATQLAGYHAVVTALQEAC*
Ga0137419_1149329013300012925Vadose Zone SoilRSFRLTLTAPGRAAARKVRAAVTDLEADALAGVSARQLAGYHAVVSALQEVS*
Ga0126369_1216784813300012971Tropical Forest SoilDRRSFRLPLTEAGQAVSAQVLAAIADLEHNALSRLDGSQLAGYQAVITALQEAR*
Ga0182015_1060229323300014495PalsaRRSFRLPLTKDGQAVAARIHAVIGDLERDALDHLTATQMAGYHAVITALQEAC*
Ga0157377_1095901323300014745Miscanthus RhizosphereFRLPLTETGQAVAARVRAAIADLERDTLSRLDATQLAGYHAVVTALQEAC*
Ga0182036_1082804723300016270SoilTEAGQAVAARVHAAVADIERDALAGLSPAQIAGFHAVITALQAACS
Ga0182033_1182460613300016319SoilLTTAGQVAAAQVLAAIADLERNALSRLDAAQLAGYHAVITALQEA
Ga0182039_1140099023300016422SoilFRLPLTTAGQAVAAQVLAAIADLERNALSRLDAAQLAGYHAVITALQEAC
Ga0187801_1046379513300017933Freshwater SedimentRLPLTEAGQAVAAQVHAAVADLERNALANLSAAQIAGFHAVITALQETS
Ga0187783_1058392833300017970Tropical PeatlandLPLTEAGQQVARRVAAAIADLERDALAHLSATQIAGFHAVIMALQAAS
Ga0187883_1071200513300018037PeatlandDPADRRSFRLPLTEPGQAVAMRVLAAVSDLERQALARLSATQIAGYHAVITALQEVC
Ga0187766_1061543113300018058Tropical PeatlandTEAGQATATRVLAAIADLERDALSRLSAEQIAGYHAVITALEEAS
Ga0066667_1067768933300018433Grasslands SoilFRTPVTGAGQALAARVLAAGADLERAALYRLDATQLAGYHAVVAALQEAC
Ga0206354_1171930323300020081Corn, Switchgrass And Miscanthus RhizospherePLTETGQAVAARVRAAIADLERDALSRLDATQLAGYHAVVTALQEVC
Ga0210399_1047433923300020581SoilSRELDPADRRSFRLPLTEAGQAVAARVLTAIADLERDALSRLSAAQIAGYHAVVTALQEA
Ga0210395_1004694413300020582SoilLDPADRRSFRLPLTEAGQAVAARVLTAIADLERDALSRLSAAQIAGYHAVVTALQEAC
Ga0210396_1012255643300021180SoilLDPTDRRSFRLPLTEAGQAVAGRVRAAVADLERETQIAGFHAVVAALQTAS
Ga0210389_1135439623300021404SoilLEHRGYVARELDPADRRSFRLPLTEPGQTVAARVLAAVADLEHDALSRLDATQLAGYHAVITALQEAC
Ga0210383_1068868013300021407SoilLDPTDRRSFRLPLTEAGQAVAGRVRTAVADLELDAAARLSETQIAGFHAVVAALQAAS
Ga0210390_1140986423300021474SoilTDRRSFRLPLTEAGQAVAGRVRAAVADLERDATARLSETQIAGFHAVVAALQTAS
Ga0247678_104469013300024325SoilSFRLPLTETGQAVAARVRAAIADLERDALSGLDATQLAGYHAVVTALQEAC
Ga0207656_1037018533300025321Corn RhizospherePLTETGQAVAARVRAAIANLERDALSRLDATQLAGYHAVVTALQEVC
Ga0207699_1124533213300025906Corn, Switchgrass And Miscanthus RhizospherePLTEAGQATAARVLAAIADLERDALSRLDATQLAGYHAVITALQEAC
Ga0207640_1036105413300025981Corn RhizosphereRLPLSETGQAVAARVRAAIADLERDALSGLDATQLAGYHAVVTALQEAC
Ga0209470_125259913300026324SoilYLTRELDPADRRSFRLPLTGAGQAVSARVLAAIADLERDALSRLDATQLAGYHAVVAALQEAC
Ga0209116_107744113300027590Forest SoilELDPADRRSFRLALTEAGQAVAARVLTAVADLERDALARLSATQLAGYHAVMTALQEAC
Ga0209517_1043730013300027854Peatlands SoilDPADRRSFRLPLTEAGQAVATRVLTAIGDLEHEALSRLSATQIAGYHAVISALQEAC
Ga0209693_1029887713300027855SoilLDPSDRRSFRLPLTEAGQAVAARVLAAVADLEREAMAGLSATQVAGFHSVLTALQEAC
Ga0209693_1030848013300027855SoilRRSFRLPLTEAGQAVSTRVLTAIADLERDALSGLSAAQIAGYHAVVTALQEAC
Ga0209415_1034052433300027905Peatlands SoilRELDPADRRSFRLPLTEAGQAVATRVLTAIGDLEHEALSRLSATQIAGYHAVISALQEAC
Ga0307307_1009665513300028718SoilDRRSFRLPLTETGRAVASRALAAIADLERDALSRLDATQLAGYHAVVAALQEAC
Ga0302224_1021430813300028759PalsaVPRAATVFPVSGPSGSLARELDPADRRSFRLPLTDAGQAVAGRVLAAVADLEHEALAPPFRHPAGGYHAVITAPQEAC
Ga0302234_1004766633300028773PalsaSGSLARELDPADRRSFRLPLTDAGQAVAGRVLAAVADLEHEALAPPFRHPAGGYHAVITAPQEAC
Ga0307284_1006553733300028799SoilELDPADRRSFRLPLTETGQAVAARVRAAIADLERDALTRLDATQLAGYHAVITALQEAC
Ga0311339_1064056113300029999PalsaLTEDGQAVAARVHAVIADLERHALDHLTATQIAGYHAVISALQEAC
Ga0302176_1042402323300030057PalsaVFPVSGPSGSLARELDPADRRSFRLPLTDAGQAVAGRVLAAVADLEHEALAPPFRHPAGGYHAVITAPQEAC
Ga0311354_1004780773300030618PalsaLADRRSFRLPLTEAGQAVARRVRAAVADLERGALGRLSATQLAGYHAVTTALQEAC
Ga0311354_1055276823300030618PalsaTRELDPADRRSFRLPLTEAGQAVAGRVLAAVADLERGALGRLSATQLAGYHAVITALQEA
Ga0316363_1009348133300030659Peatlands SoilPADRRSFRLPLTEAGQAVATRVLTAIGDLEHEALSRLSATQIAGYHAVISALQEACYRG
Ga0302317_1037736713300030677PalsaLTAAGQAVAGRVLAAVADLEHEALGRLSPTQLAGYHAVITALQEAC
Ga0307497_1045191113300031226SoilLARELDPADRRSFRLPLTETGQAVAARVLAAIAALERDALSRLDATQLAGYHAVVTALQEAC
Ga0310915_1101237613300031573SoilATDRRSFRLRLTEAGQGAAARVRAAVADIEHDALASLSATQVAGFRAVITALQEACT
Ga0318496_1033134213300031713SoilYLVRELDPADRRSFRLPLTKAGQAVAARVLAAVAELERNALSRLDATQIAGYHAVITALQEAC
Ga0318501_1028788933300031736SoilRSFRLRLTEAGQGAAARVRAAVADIEHDALASLSATQVAGFHAVITALQEACT
Ga0318494_1013777413300031751SoilSFRLPLTGAGQAVAARVLAAIAEVERGALARLSATQIAGFHAVITALQEAC
Ga0318554_1059664323300031765SoilSFRLPLTEAGQAVAARVHAAVADIERDALAGLSPAQIAGFHAVITALQAACS
Ga0318554_1070723923300031765SoilLPLTEAGQEVAARALTAIADLERSALSGLGAAQLGGFHAVLAALQEAC
Ga0318526_1039489713300031769SoilRSFRLPLTEAGQQVAERVQAAVADLERDALARLSATQIAGFHAVVAALQAAS
Ga0318521_1067528023300031770SoilRLTEAGQGAAARVRAAVADIEHDALASLSATQVAGFHAVITALQEACT
Ga0318547_1098581823300031781SoilRSFRLPLTAAGQAAAAQVLAAIADLERTALSRLDATQLAGYHAVITALQEAS
Ga0318564_1033672913300031831SoilARELDPADRRSFRLPLTKAGQAVAAQVLAAIADLERNALSRLDAAQLAGYHAVITALQEA
Ga0310917_1066698823300031833SoilLPLTTAGQAVAAQVLAAIADLERNALSRLDAAQLAGYHAVITALQEAC
Ga0318512_1040406023300031846SoilRLPLTEAGQGAAARVRAAVADIEHDALASLSATQVAGFHAVITALQEACT
Ga0306921_1113733833300031912SoilARELDPADRRSFRLPLTAAGQAAAAQVLAAIADLERTALSRLDATQLAGYHAVITALQEA
Ga0308175_10248645813300031938SoilYLVREVDPADRRSFRLPLTGQGREVAARARAAIADLERTALSRLDATQLAGYHAVITALQEAC
Ga0310912_1127183423300031941SoilLTKAGQAVAAQVLAAIADLERNALSRLDAAQLAGYHAVITALQEAR
Ga0306926_1068900233300031954SoilRRSFRLPLTTAGQVAAAQVLAAIADLERNALSRLDAAQLAGYHAVITALQEA
Ga0318531_1014784133300031981SoilRLPLTEAGQGVAARVLAAIADLERDALSRLDATQLAGFHAVITALQEAC
Ga0308176_1033126243300031996SoilLPLTAQGQEAAARARAAIADLERTALSRLDATQLAGYHAVITALQEAC
Ga0306922_1034746113300032001SoilDRRSFRLPLTEAGQRVAERVRAAVADLERDALARLSATQIAGFHAVVAALQAVS
Ga0318563_1029686533300032009SoilRRSFRLPLTEAGQAVATRVLTAIADLEREALSGLSGTQIAGYHAVLTALQEAC
Ga0318507_1016764813300032025SoilSFRLPLTEAGQGVAARVLAAIADLERDALSRLDATQLAGFHAVITALQEAC
Ga0318505_1054182623300032060SoilTREPDATDRRSFRLPLTEAGQGAAARVRAAVADIEHDALASLSATQVAGFRAVITALQEACT
Ga0318525_1068149223300032089SoilPLTTAGQAVAAQVLAAIADLERNALSRLDAAQLAGYHAVITALQEA
Ga0306920_10167083733300032261SoilSFRLPLTTAGQAVAAQVLAAIADLERNALSRLDAAQLAGYHAVITALQEAC
Ga0335080_1129830823300032828SoilLARELDSADRRSFRLPLTTAGQAVAAQVLAAIADLERNALSRLDAAQLAGYHAVITALQEAC
Ga0335080_1146199013300032828SoilDPADRRSFRLPLTKAGQAVGAQVLAAIADLERNALARLDASQLAGYHAVIAALQDAR
Ga0335069_1024895353300032893SoilRELDPADRRSFRLPLTTAGQAVAAQVLAAIADLERNALSRLDATQLAGYHAVITALQEAC
Ga0335083_1067106513300032954SoilPLTKAGQAVAARVLAAVADLERNAFSRLDATQIAGYHAVITALQEAC
Ga0335083_1140055023300032954SoilLARELDPADRRSFRLPLTKAGQTAADQVLAAVADLERSALSRLDATQLAGYHAVITALQE
Ga0335076_1003738613300032955SoilRSFRLPLTEAGQAAADRVLTAIAELERGALSGLSATQIAGYHAVITALQEAS
Ga0335076_1018514043300032955SoilDRRSFRLPLTEAGQAVSAQVLAAIADLEHNALSRLDATQLAGYQAVITALQEAR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.