NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F088857

Metagenome / Metatranscriptome Family F088857

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F088857
Family Type Metagenome / Metatranscriptome
Number of Sequences 109
Average Sequence Length 43 residues
Representative Sequence MTTSSAPLAKLTEVSTPPTPKAEVDELDLALLRALAVDARQSQ
Number of Associated Samples 102
Number of Associated Scaffolds 109

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 57.80 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 94.50 %
Associated GOLD sequencing projects 100
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (93.578 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(33.027 % of family members)
Environment Ontology (ENVO) Unclassified
(25.688 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(38.532 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 23.94%    β-sheet: 0.00%    Coil/Unstructured: 76.06%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 109 Family Scaffolds
PF00155Aminotran_1_2 40.37
PF00106adh_short 1.83
PF07883Cupin_2 1.83
PF13404HTH_AsnC-type 0.92
PF16537T2SSB 0.92
PF01904DUF72 0.92
PF00753Lactamase_B 0.92

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 109 Family Scaffolds
COG1801Sugar isomerase-related protein YecE, UPF0759/DUF72 familyGeneral function prediction only [R] 0.92


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms93.58 %
UnclassifiedrootN/A6.42 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000156|NODE_c0287511All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria562Open in IMG/M
3300002245|JGIcombinedJ26739_100617184All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria962Open in IMG/M
3300004633|Ga0066395_10385800All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria → unclassified Kutzneria → Kutzneria sp. 744786Open in IMG/M
3300005332|Ga0066388_102863884All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia dioxanivorans881Open in IMG/M
3300005434|Ga0070709_10793012All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria743Open in IMG/M
3300005435|Ga0070714_101666556All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria623Open in IMG/M
3300005439|Ga0070711_100948558All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria736Open in IMG/M
3300005471|Ga0070698_101173665All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae717Open in IMG/M
3300005530|Ga0070679_100630354All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1015Open in IMG/M
3300005712|Ga0070764_10742930Not Available607Open in IMG/M
3300005713|Ga0066905_101596735All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria597Open in IMG/M
3300005764|Ga0066903_103158636All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria891Open in IMG/M
3300006575|Ga0074053_11926395All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia dioxanivorans1549Open in IMG/M
3300006579|Ga0074054_11955949All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia dioxanivorans1603Open in IMG/M
3300006852|Ga0075433_10153219All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia dioxanivorans2050Open in IMG/M
3300006954|Ga0079219_11978033All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria553Open in IMG/M
3300009143|Ga0099792_10964669All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria568Open in IMG/M
3300010043|Ga0126380_10498740All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria934Open in IMG/M
3300010047|Ga0126382_11015308All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria728Open in IMG/M
3300010047|Ga0126382_11926194All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria560Open in IMG/M
3300010359|Ga0126376_10998491All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria837Open in IMG/M
3300010360|Ga0126372_10050310All Organisms → cellular organisms → Bacteria → Terrabacteria group2816Open in IMG/M
3300012176|Ga0153952_1129253All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria555Open in IMG/M
3300012199|Ga0137383_11097636All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria576Open in IMG/M
3300012201|Ga0137365_11185695Not Available547Open in IMG/M
3300012206|Ga0137380_11097701All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria678Open in IMG/M
3300012207|Ga0137381_10593749All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria965Open in IMG/M
3300012356|Ga0137371_10178710All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae1663Open in IMG/M
3300012359|Ga0137385_10752037All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria812Open in IMG/M
3300012359|Ga0137385_10816957All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria774Open in IMG/M
3300013105|Ga0157369_10196283All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2119Open in IMG/M
3300013297|Ga0157378_10771006All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria986Open in IMG/M
3300015242|Ga0137412_10801886Not Available691Open in IMG/M
3300015245|Ga0137409_10697167All Organisms → cellular organisms → Bacteria849Open in IMG/M
3300015374|Ga0132255_100881320All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1337Open in IMG/M
3300017944|Ga0187786_10050632All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1249Open in IMG/M
3300018012|Ga0187810_10224716All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria767Open in IMG/M
3300020581|Ga0210399_10315863All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1304Open in IMG/M
3300020582|Ga0210395_10120989All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae1944Open in IMG/M
3300020583|Ga0210401_10704494All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria870Open in IMG/M
3300021088|Ga0210404_10915012All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria502Open in IMG/M
3300021178|Ga0210408_10144780All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia dioxanivorans1881Open in IMG/M
3300021180|Ga0210396_11493853Not Available555Open in IMG/M
3300021404|Ga0210389_10128053All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae1964Open in IMG/M
3300021405|Ga0210387_10987649All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria738Open in IMG/M
3300021405|Ga0210387_11063356All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria707Open in IMG/M
3300021406|Ga0210386_10767687All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria829Open in IMG/M
3300024179|Ga0247695_1029704All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria776Open in IMG/M
3300024245|Ga0247677_1004640All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae1826Open in IMG/M
3300024288|Ga0179589_10017827All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2289Open in IMG/M
3300025901|Ga0207688_10999001All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium529Open in IMG/M
3300025906|Ga0207699_10965237All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria630Open in IMG/M
3300025910|Ga0207684_10371455All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1230Open in IMG/M
3300025921|Ga0207652_10232502All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1661Open in IMG/M
3300025921|Ga0207652_10972520All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria747Open in IMG/M
3300025922|Ga0207646_10171500All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae1959Open in IMG/M
3300026067|Ga0207678_11721642All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria550Open in IMG/M
3300026217|Ga0209871_1056463All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria750Open in IMG/M
3300026306|Ga0209468_1098991All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria941Open in IMG/M
3300026343|Ga0209159_1163105All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria835Open in IMG/M
3300026557|Ga0179587_10698217All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria668Open in IMG/M
3300027692|Ga0209530_1166001Not Available616Open in IMG/M
3300027846|Ga0209180_10720688All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria540Open in IMG/M
3300027867|Ga0209167_10667232All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria569Open in IMG/M
3300027884|Ga0209275_10372892All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria802Open in IMG/M
3300027908|Ga0209006_10387454All Organisms → cellular organisms → Bacteria → Proteobacteria1179Open in IMG/M
3300027908|Ga0209006_10427190All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1113Open in IMG/M
3300028536|Ga0137415_11309386Not Available543Open in IMG/M
3300028906|Ga0308309_10570733All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria981Open in IMG/M
3300030013|Ga0302178_10339211All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria683Open in IMG/M
3300030618|Ga0311354_10624799All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1042Open in IMG/M
3300030979|Ga0068589_11285515All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria537Open in IMG/M
3300031234|Ga0302325_11470936All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria880Open in IMG/M
3300031469|Ga0170819_14463625All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria507Open in IMG/M
3300031549|Ga0318571_10343824All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria571Open in IMG/M
3300031564|Ga0318573_10632817All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria576Open in IMG/M
3300031572|Ga0318515_10067629All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia dioxanivorans1830Open in IMG/M
3300031640|Ga0318555_10406509All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria737Open in IMG/M
3300031680|Ga0318574_10550557All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria676Open in IMG/M
3300031681|Ga0318572_10301366All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria947Open in IMG/M
3300031681|Ga0318572_10682469All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria612Open in IMG/M
3300031715|Ga0307476_10637047All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria790Open in IMG/M
3300031719|Ga0306917_11035895All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria640Open in IMG/M
3300031744|Ga0306918_10252387All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1347Open in IMG/M
3300031764|Ga0318535_10173712All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria963Open in IMG/M
3300031765|Ga0318554_10348714All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria841Open in IMG/M
3300031779|Ga0318566_10514816All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria585Open in IMG/M
3300031781|Ga0318547_10646615All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria656Open in IMG/M
3300031796|Ga0318576_10283305All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria782Open in IMG/M
3300031820|Ga0307473_10503499All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria818Open in IMG/M
3300031879|Ga0306919_10804565All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria722Open in IMG/M
3300031910|Ga0306923_10194351All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2319Open in IMG/M
3300031946|Ga0310910_10357104All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1155Open in IMG/M
3300031981|Ga0318531_10329702All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria690Open in IMG/M
3300032001|Ga0306922_10918444All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria908Open in IMG/M
3300032008|Ga0318562_10608205All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria631Open in IMG/M
3300032035|Ga0310911_10676975All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria598Open in IMG/M
3300032052|Ga0318506_10407429All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria603Open in IMG/M
3300032063|Ga0318504_10609806All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria524Open in IMG/M
3300032064|Ga0318510_10296675All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria673Open in IMG/M
3300032064|Ga0318510_10405619All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium581Open in IMG/M
3300032065|Ga0318513_10297718All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria783Open in IMG/M
3300032180|Ga0307471_100955488All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1024Open in IMG/M
3300032895|Ga0335074_10239984All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia2148Open in IMG/M
3300032896|Ga0335075_11026882All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria736Open in IMG/M
3300033158|Ga0335077_11000371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria834Open in IMG/M
3300033289|Ga0310914_10636216All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria960Open in IMG/M
3300033290|Ga0318519_10446823All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria774Open in IMG/M
3300033548|Ga0316216_1013390Not Available649Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil33.03%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil12.84%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.50%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.59%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.67%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.67%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.75%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.75%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.75%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.75%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa2.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.83%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.92%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.92%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.92%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.92%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.92%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.92%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.92%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.92%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.92%
RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Roots0.92%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.92%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.92%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.92%
Attine Ant Fungus GardensHost-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens0.92%
Sugar Cane Bagasse Incubating BioreactorEngineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor0.92%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000156Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobicEngineeredOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006575Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006579Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300012176Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ036 MetaGHost-AssociatedOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017944Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MGEnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300024179Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36EnvironmentalOpen in IMG/M
3300024245Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK18EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026217Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes)EnvironmentalOpen in IMG/M
3300026306Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes)EnvironmentalOpen in IMG/M
3300026343Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027692Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300030013Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3EnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030979Forest soil microbial communities from France, for metatranscriptomics studies - Site 11 - Champenoux / Amance forest (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300033548Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE6Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
NODE_028751123300000156Sugar Cane Bagasse Incubating BioreactorMTTSSAPLANLTEVSTPPTPKAEVDELDLALLRALAVDARQSQRALARAM
JGIcombinedJ26739_10061718423300002245Forest SoilMTIDPAPLAKLAEVSPPPRPEVEVDDFDLALLRALAADSRQSQRALARQ
Ga0066395_1038580023300004633Tropical Forest SoilMTSVSAPLAKLAEVTAPAVPPADLDDLDLALLRALADDARQSQRA
Ga0066388_10286388413300005332Tropical Forest SoilMTTSSAPLAKLTEVSTQPTPKADVDELDLALLRVLAVDARQSQRALARA
Ga0070709_1079301223300005434Corn, Switchgrass And Miscanthus RhizosphereMAAISAPLAKLTEVSAPATPPAEVDELDLALLRSLADNARQSQR
Ga0070714_10166655613300005435Agricultural SoilMTTSSAPLAKLTEVSAPPTPKADVDELDLALLRVLAVDARQSQ
Ga0070711_10094855813300005439Corn, Switchgrass And Miscanthus RhizosphereMTSSSAPLAKLTEVSAPPTPKADLDELDLALLRVLAVDAR
Ga0070698_10117366523300005471Corn, Switchgrass And Miscanthus RhizosphereMTSSSAPLAKLTEVSAPPTPKADLDELDLALLRVLAVDARQSQRALARAIE
Ga0070679_10063035423300005530Corn RhizosphereMTSVSAPLAKLAEVTAPAVPPADLDDLDLALLRALADDARQSQ
Ga0070764_1074293023300005712SoilMTINPAPLAKLAEVSPPPRPEVEVDDLDLALLRALAA
Ga0066905_10159673523300005713Tropical Forest SoilMTTSSAPLAKLTEVSTPPTPKAEVDELDLALLRALAVDARQSQR
Ga0066903_10315863613300005764Tropical Forest SoilMTGPWQMTSSSAPLAKLTEVSAPPTPKADLDELDLA
Ga0074053_1192639523300006575SoilMTTSSAPLAKLTEVSTPPTPKAEVDELDLALLRALAVDARQSQRALARAI
Ga0074054_1195594913300006579SoilMTTSSAPLAKLTEVSTPPTPKAEVDELDLALLRALAVDARQSQRALARA
Ga0075433_1015321933300006852Populus RhizosphereMRSSSAPLAKLTEVSTPPTPKAEVDELDLALLRAL
Ga0079219_1197803323300006954Agricultural SoilMTTSSAPLAKLTEVSTQPTPKADVDELDLALLRVLAVDARQ
Ga0099792_1096466913300009143Vadose Zone SoilMATSSAPLAKLTEVAAPSSPKVEVDELDLALLRALATDA
Ga0126380_1049874013300010043Tropical Forest SoilMASISAPLARLSEVCSTAAPRVDLDDLDLALLRALAGDARQSQRALA
Ga0126382_1101530823300010047Tropical Forest SoilMDSVSAPLARLTEVAPPAAPKVEVDDSDLALLRALAADARQSQRAL
Ga0126382_1192619413300010047Tropical Forest SoilMDAVSAPLAGLAEVTSPTSPQVDVDDLDLAMLRALARDARQSQRALARAIK
Ga0126376_1099849123300010359Tropical Forest SoilMTTSSAPLAKLTEVSTPPTPKAEVDELDLALLRALAVDARQ
Ga0126372_1005031013300010360Tropical Forest SoilMDAVSAPLAGLAEVTSPTSPQVDVDDLDLALLRALARDARQS
Ga0153952_112925323300012176Attine Ant Fungus GardensLTTTSAPLARLADVASPTVQKIEVDDLDLTLLRALADDARQSQRALARA
Ga0137383_1109763623300012199Vadose Zone SoilMATVSAPLAKLAEVSSPSTPRVDVDDLDLALLCALATDARQSQRA
Ga0137365_1118569513300012201Vadose Zone SoilMDSVSAPLAGLTEVCPPAAPKVEVDDFDLALLRALASDARQ
Ga0137380_1109770113300012206Vadose Zone SoilMATVSAPLAKLAEVSSPSAPKIEVDDLDLALLRALAVD
Ga0137381_1059374923300012207Vadose Zone SoilMTTSSAPLAKLTEVSTPPTPKAEVDELDLALLRALAVDARQS
Ga0137371_1017871033300012356Vadose Zone SoilMATSSAPLAKLTEVAAPASPKVTVDELDLALRRALATDARQSHRAL
Ga0137385_1075203723300012359Vadose Zone SoilMATVSAPLAKLAEVSSPSAPKIEVDDLDLALLRALAVDARQSQRGLARKV
Ga0137385_1081695723300012359Vadose Zone SoilMESVSAPLARLTEVTSPAAAQVDVDDFDLALLRALARDARQSQRALA
Ga0157369_1019628313300013105Corn RhizosphereMESVSAPLAGLADVSGSPAPTAEVDESDLALLSALAEDARQSQRS
Ga0157378_1077100623300013297Miscanthus RhizosphereMTSSSAPLAKLTEVSTPPTPKAEVDELDLALLRALAVDAR
Ga0137412_1080188613300015242Vadose Zone SoilMTINPTPLGKLAEVSQPPRPEVEVDDFDLALLRALAADARRSQRALAR
Ga0137409_1069716723300015245Vadose Zone SoilMTTSSAPLAKLTEVSTPPTPKAEVDELDLALLRALAVDARQSQRAL
Ga0132255_10088132013300015374Arabidopsis RhizosphereMRSSSAPLAKLTEVSTPPTPKAEVDELDLALLRALAVDARQ
Ga0187786_1005063213300017944Tropical PeatlandMTTSSAPLAKLTEVSTPPTPKAEVDELDLALLRALAVDARQSQRALA
Ga0187810_1022471623300018012Freshwater SedimentMTINPAPLAKLAEVSRPPRPEVEVDDLDLALLRALAADSR
Ga0210399_1031586313300020581SoilVARSSGPLAGLAEVVTPTTPKVEVDDLDIALLRELAVDSR
Ga0210395_1012098933300020582SoilVTRISGPLAGLAEVATPTTPKVEVDDLDIALLRELAVDSRQSQRALA
Ga0210401_1070449413300020583SoilMTINPTPLGKLAEVSQPPRPEVEVDDFDLALLRALAADARRSQR
Ga0210404_1091501223300021088SoilMTTVSAPLAKLAEVSSPATPQAEVDDLDLALLRAPATDARQP
Ga0210408_1014478033300021178SoilVARSSGPLAGLAEVVTPTTPKVEVDDLDIALLRELAVDSRQSQRAL
Ga0210396_1149385323300021180SoilMAIDPAPLAKLADVSPPPRPEVEVDDLDLALQRALA
Ga0210389_1012805333300021404SoilMASISAPLAKLTEVASPSTPKAEVDELDLALLRALAADARQSL
Ga0210387_1098764923300021405SoilMTINPTPLGKLAEVSQPPRPEVEVDDFDLALLRALAADARRSQRA
Ga0210387_1106335623300021405SoilVARSSGPLAGLAEVVTPTTPKVEVDDLDIALLRELAVDSRQSQRA
Ga0210386_1076768713300021406SoilMTINPTPLGKLAEVSQPPRPEVEVDDFDLALLRALAADAR
Ga0247695_102970413300024179SoilMTSVSAPLAKLAEVTAPAVPPADLDDLDLALLRALADDARQSQRALA
Ga0247677_100464033300024245SoilMTSVSAPLAKLAEVTAPAVPPADLDDLDLALLRALADDA
Ga0179589_1001782743300024288Vadose Zone SoilMTIDPAPLAKLAEVSPPPRPEVEVDDLDLALLRALAADARQ
Ga0207688_1099900113300025901Corn, Switchgrass And Miscanthus RhizosphereMTVNPAPLAKLAEVSPPSRPEAEVDELDLALLRALAADARQSQRALA
Ga0207699_1096523723300025906Corn, Switchgrass And Miscanthus RhizosphereMAAISAPLAKLTEVSAPATPPAEVDELDLALLRSLADNA
Ga0207684_1037145523300025910Corn, Switchgrass And Miscanthus RhizosphereMATVSAPLAKLAEVSSPSAPKIEVDDLDLALLRALAVDSRQSQRGL
Ga0207652_1023250223300025921Corn RhizosphereMTVNPAPLAKLVEVSPPSTPEAEVDELDLALLRALAADARQSQRALARQ
Ga0207652_1097252023300025921Corn RhizosphereMTSVSAPLAKLAEVTAPAVPPADLDDLDLALLRALADDARQSQRAL
Ga0207646_1017150033300025922Corn, Switchgrass And Miscanthus RhizosphereMESVSAPLARLTEVSPPAAQKAEVDDFDLALLRALANDARQSQ
Ga0207678_1172164213300026067Corn RhizosphereMTTSSAPLAKLTEVSTPPTPKAEVDELDLALLRALAVDARQSQ
Ga0209871_105646323300026217Permafrost SoilMATISAPLAKLTEVSSPPTPEAGVDDLDLALLHALAV
Ga0209468_109899113300026306SoilMTSSSAPLAKLTEVSTPPTPKAEVDELDLALLRALAVDARQSQRAL
Ga0209159_116310523300026343SoilMTSSSAPLAKLTEVSTPPTPKAEVDELDLALLRALAV
Ga0179587_1069821723300026557Vadose Zone SoilMESVSAPLAGLAEVSAPPPPTVEVDEYDLALLRALAQDARQSQRAL
Ga0209530_116600123300027692Forest SoilMTINPAPLAKLAEVSQPPRPEVEVDDFDLALLRALAGDAR
Ga0209180_1072068823300027846Vadose Zone SoilMATSSAPLARLTEVAAPSSPKVEVDELDLALLRALATDARQSQRALARTV
Ga0209167_1066723213300027867Surface SoilMATSSAPLANLTEVAAPTPPKVEVDELDLALLRALATDARQSQRA
Ga0209275_1037289223300027884SoilMTINPAPLAKLAEVSPPPRPEVEVDDFDLALLRALA
Ga0209006_1038745433300027908Forest SoilMTINPAPLAKLAEVSPPPRPEVEVDDFDLALLRALAADARQSQRAL
Ga0209006_1042719013300027908Forest SoilMTINPAPLAKLAEVSPPPRPEVEVDDFDLALLRAL
Ga0137415_1130938623300028536Vadose Zone SoilMTINPTPLGKLAEVSQPPRPEVEVDDFDLALLRALAADARRSQRALARQ
Ga0308309_1057073313300028906SoilMTINPTPLGKLAEVSPPPRPEVEVDDFDLALLRAL
Ga0302178_1033921113300030013PalsaMTINPAPLAKLAEVSPPPRPEVEVDDFDLALLRALAADS
Ga0311354_1062479923300030618PalsaMTTNPTPLARLAEVSPPSRPEVEVDNLDLALLRAL
Ga0068589_1128551513300030979SoilMATVSAPLARLAEVTSAAPPKVEVDDLDLALLRALATDARQSQ
Ga0302325_1147093623300031234PalsaMETAPLATLTEVTAPPVPRIEVDDLDLALLRALATDARQSQRAL
Ga0170819_1446362523300031469Forest SoilMESVSAPLAGLADVSAPPAPTVEVDESDLALLRALAE
Ga0318571_1034382423300031549SoilMATSSAPLAKLTEVAAPSSPKVEVDELDLALLRALATDARQSQ
Ga0318573_1063281713300031564SoilMTTSSAPLAKLTEVSTPPTPKADVDELDLALLRVLADDAR
Ga0318515_1006762913300031572SoilMATSSAPLAKLAEVAAPSPPKVEVDELDLALLRAL
Ga0318555_1040650913300031640SoilMTTSPAPLAKLTEVSAPPTPKADVDELDLALLRVL
Ga0318574_1055055723300031680SoilMATSSAPLAKLTEVAAPSSPKVEVDELDLALLRALAT
Ga0318572_1030136613300031681SoilLTTTSAPFAHLADVTSPSTQKIEVDDLDLTLLRALAVDARQSQR
Ga0318572_1068246913300031681SoilMATSSAPLAKLTEVAAPSPPKVEVDELDLALLRALATDARQSQ
Ga0307476_1063704723300031715Hardwood Forest SoilMTINPAPLAKLAEVSPPPRPEVEVDDFDLALLRALAADSRQSQRALARQI
Ga0306917_1103589523300031719SoilMATSSAPLAKLAEVAAPSPPKVEVDELDLALLRALATDARQSQRA
Ga0306918_1025238713300031744SoilMATSSAPLAKLAEVAAPSPPKVEVDELDLALLRALATDA
Ga0318535_1017371223300031764SoilMTTSPAPLAKLTEVSAPPTPKADVDELDLALLRVLAEDARQS
Ga0318554_1034871413300031765SoilMTGPWQMTSSSAPLAKLTEVSAPPTPKADLDELDLALLRVLS
Ga0318566_1051481623300031779SoilMATSSAPLAKLTEVAAPSSPKVEVDELDLALLRALATDARQSQRALA
Ga0318547_1064661513300031781SoilMTTSSAPLAKLTEVSAPPTPKADVDELDLALLRAL
Ga0318576_1028330523300031796SoilMTTSSAPLAKLTEVSAPPTPKADVDELDLALLRALAVDARQSQRA
Ga0307473_1050349913300031820Hardwood Forest SoilMTSSSAPLAKLTEVSTPPTPKAEVDELDLALLRALAVDARQSQRALARAIE
Ga0306919_1080456523300031879SoilMTGPWQMTSSSAPLAKLTEVSAPPTPKADLDELDLALLRVLSVDA
Ga0306923_1019435113300031910SoilMATSSAPLAKLAEVAAPSPPKVEVDELDLALLRALATD
Ga0310910_1035710413300031946SoilMTTSPAPLAKLTEVSAPPTPKADVDELDLALLRVLAEDAR
Ga0318531_1032970223300031981SoilMATSSAPLAKLTEVAAPSPPKVEVDELDLALLRAL
Ga0306922_1091844423300032001SoilMATSSAPLAKLTEVAAPSSPKVEVDELDLALRRALATDARQSQR
Ga0318562_1060820523300032008SoilMATSSAPLAKLTEVAAPSPPKVEVDELDLALLRALATDARQ
Ga0310911_1067697523300032035SoilMATSSAPLAKLAEVAAPSPPKVEVDELDLALLRALATDARQ
Ga0318506_1040742913300032052SoilMTGPWQMTSSSAPLAKLTEVSAPPTPKADLDELDLALLR
Ga0318504_1060980613300032063SoilMTGPWQMTSSSAPLAKLTEVSAPPTPKADLDELDLALLRVLSVDARQSQRA
Ga0318510_1029667523300032064SoilMTGPWQMTSSSAPLAKLTEVSAPPTPKADLDELDLALLRVLSVDARQSQRALAR
Ga0318510_1040561913300032064SoilMTTSSAPLAKLTEVSTPPTPKADVDELDLALLRVLAVDARQSQRALARAIE
Ga0318513_1029771813300032065SoilMTTSSAPLAKLTEVSAPPTPKADVDELDLALLRALAVDARQSQRALARAIE
Ga0307471_10095548813300032180Hardwood Forest SoilMTTSSAPLAKLTDVSAPPTPKADVDELDLALLRVLAVDA
Ga0335074_1023998413300032895SoilLGNAQMTSVSTPLAKLTEVSASSTPAVEVDSLDLALLRALTSN
Ga0335075_1102688213300032896SoilMASVSAPLARLAEVTSAARPKVEVDDLDLALLHALA
Ga0335077_1100037123300033158SoilMDSVSVPRSNTANPAPLARLGEVSPPSTPTMDVDDFDLALLRALAGDARQSQRALGRK
Ga0310914_1063621623300033289SoilMTTSPAPLAKLTEVSAPPTPKADVDELDLALLRVLAE
Ga0318519_1044682313300033290SoilMATSSAPLAKLTEVAAPSPPKVEVDELDLALLRALAT
Ga0316216_101339023300033548RootsMTINPAPLAKLAEVSPPPRPEVEVDDLDLALLRALAADARLS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.