Metagenome / Metatranscriptome Family F088838

Basic Information
Family ID	F088838
Family Type	Metagenome / Metatranscriptome
Number of Sequences	109
Average Sequence Length	40 residues
Representative Sequence	TLGALARAGTRVDAVDLRYRNGFAARIPGFREKNAKPAA
Number of Associated Samples	104
Number of Associated Scaffolds	109

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	0.00 %
% of genes near scaffold ends (potentially truncated)	98.17 %
% of genes from short scaffolds (< 2000 bps)	88.99 %
Associated GOLD sequencing projects	101
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.44

Most Common Taxonomy
Group	Bacteria (59.633 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (10.092 % of family members)
Environment Ontology (ENVO)	Unclassified (33.028 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (37.615 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 10.45% β-sheet: 8.96% Coil/Unstructured: 80.60%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 109 Family Scaffolds
PF02491	SHS2_FTSA	51.38
PF14450	FtsA	38.53
PF12327	FtsZ_C	3.67
PF00091	Tubulin	1.83
PF01548	DEDD_Tnp_IS110	0.92
PF06723	MreB_Mbl	0.92

COG ID	Name	Functional Category	% Frequency in 109 Family Scaffolds
COG1077	Cell shape-determining ATPase MreB, actin-like superfamily	Cell cycle control, cell division, chromosome partitioning [D]	0.92
COG3547	Transposase	Mobilome: prophages, transposons [X]	0.92

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	80.73 %
Unclassified	root	N/A	19.27 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	80.73 %
Unclassified	root	N/A	19.27 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	59.63 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	21.10 %
Unclassified	root	N/A	19.27 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	40.37 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	21.10 %
Unclassified	root	N/A	19.27 %

Name	Rank	Taxonomy	Distribution
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	40.37 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	21.10 %
Unclassified	root	N/A	19.27 %

Name	Rank	Taxonomy	Distribution
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	21.10 %
Unclassified	root	N/A	19.27 %
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	3.67 %
Neisseriales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales	2.75 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.92 %

Name	Rank	Taxonomy	Distribution
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	21.10 %
Unclassified	root	N/A	19.27 %
Chromobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae	2.75 %
Sulfuricellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae	1.83 %
Alcaligenaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae	0.92 %

Name	Rank	Taxonomy	Distribution
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	21.10 %
Unclassified	root	N/A	19.27 %
Chromobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae	2.75 %
Sulfurirhabdus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfurirhabdus	1.83 %
Achromobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Achromobacter	0.92 %

Name	Rank	Taxonomy	Distribution
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	21.10 %
Unclassified	root	N/A	19.27 %
Chromobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae	2.75 %
Sulfurirhabdus autotrophica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfurirhabdus → Sulfurirhabdus autotrophica	1.83 %
Achromobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Achromobacter	0.92 %

Name	Rank	Taxonomy	Distribution
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	21.10 %
Unclassified	root	N/A	19.27 %
Chromobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae	2.75 %
Sulfurirhabdus autotrophica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfurirhabdus → Sulfurirhabdus autotrophica	1.83 %
Achromobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Achromobacter	0.92 %

Name	Rank	Taxonomy	Distribution
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	21.10 %
Unclassified	root	N/A	19.27 %
Chromobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae	2.75 %
Sulfurirhabdus autotrophica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfurirhabdus → Sulfurirhabdus autotrophica	1.83 %
Achromobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Achromobacter	0.92 %

Name	Rank	Taxonomy	Distribution
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	21.10 %
Unclassified	root	N/A	19.27 %
Chromobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae	2.75 %
Sulfurirhabdus autotrophica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfurirhabdus → Sulfurirhabdus autotrophica	1.83 %
Achromobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Achromobacter	0.92 %

Name	Rank	Taxonomy	Distribution
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	21.10 %
Unclassified	root	N/A	19.27 %
Chromobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae	2.75 %
Sulfurirhabdus autotrophica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfurirhabdus → Sulfurirhabdus autotrophica	1.83 %
Achromobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Achromobacter	0.92 %

Name	Rank	Taxonomy	Distribution
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	21.10 %
Unclassified	root	N/A	19.27 %
Chromobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae	2.75 %
Sulfurirhabdus autotrophica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfurirhabdus → Sulfurirhabdus autotrophica	1.83 %
Achromobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Achromobacter	0.92 %

Name	Rank	Taxonomy	Distribution
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	21.10 %
Unclassified	root	N/A	19.27 %
Chromobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae	2.75 %
Sulfurirhabdus autotrophica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfurirhabdus → Sulfurirhabdus autotrophica	1.83 %
Achromobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Achromobacter	0.92 %

Name	Rank	Taxonomy	Distribution
asterids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids	21.10 %
Unclassified	root	N/A	19.27 %
Chromobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae	2.75 %
Sulfurirhabdus autotrophica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfurirhabdus → Sulfurirhabdus autotrophica	1.83 %
Achromobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Achromobacter	0.92 %

Name	Rank	Taxonomy	Distribution
campanulids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids	21.10 %
Unclassified	root	N/A	19.27 %
Chromobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae	2.75 %
Sulfurirhabdus autotrophica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfurirhabdus → Sulfurirhabdus autotrophica	1.83 %
Achromobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Achromobacter	0.92 %

Name	Rank	Taxonomy	Distribution
Asterales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales	21.10 %
Unclassified	root	N/A	19.27 %
Chromobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae	2.75 %
Sulfurirhabdus autotrophica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfurirhabdus → Sulfurirhabdus autotrophica	1.83 %
Achromobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Achromobacter	0.92 %

Name	Rank	Taxonomy	Distribution
Asteraceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae	21.10 %
Unclassified	root	N/A	19.27 %
Chromobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae	2.75 %
Sulfurirhabdus autotrophica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfurirhabdus → Sulfurirhabdus autotrophica	1.83 %
Achromobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Achromobacter	0.92 %

Name	Rank	Taxonomy	Distribution
Asteroideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae	21.10 %
Unclassified	root	N/A	19.27 %
Chromobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae	2.75 %
Sulfurirhabdus autotrophica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfurirhabdus → Sulfurirhabdus autotrophica	1.83 %
Achromobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Achromobacter	0.92 %

Name	Rank	Taxonomy	Distribution
Anthemideae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae	21.10 %
Unclassified	root	N/A	19.27 %
Chromobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae	2.75 %
Sulfurirhabdus autotrophica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfurirhabdus → Sulfurirhabdus autotrophica	1.83 %
Achromobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Achromobacter	0.92 %

Name	Rank	Taxonomy	Distribution
Anthemidinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae	21.10 %
Unclassified	root	N/A	19.27 %
Chromobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae	2.75 %
Sulfurirhabdus autotrophica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfurirhabdus → Sulfurirhabdus autotrophica	1.83 %
Achromobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Achromobacter	0.92 %

Name	Rank	Taxonomy	Distribution
Tanacetum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum	21.10 %
Unclassified	root	N/A	19.27 %
Chromobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae	2.75 %
Sulfurirhabdus autotrophica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfurirhabdus → Sulfurirhabdus autotrophica	1.83 %
Achromobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Achromobacter	0.92 %

Name	Rank	Taxonomy	Distribution
Tanacetum cinerariifolium	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	21.10 %
Unclassified	root	N/A	19.27 %
Chromobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae	2.75 %
Sulfurirhabdus autotrophica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfurirhabdus → Sulfurirhabdus autotrophica	1.83 %
Achromobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Achromobacter	0.92 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300004156\|Ga0062589_100423434	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	1091	Open in IMG/M
3300004479\|Ga0062595_102004514	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	559	Open in IMG/M
3300005333\|Ga0070677_10243037	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	890	Open in IMG/M
3300005435\|Ga0070714_102387880	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	514	Open in IMG/M
3300005438\|Ga0070701_11062482	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae	568	Open in IMG/M
3300005439\|Ga0070711_100610772	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	911	Open in IMG/M
3300005459\|Ga0068867_100474042	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae	1071	Open in IMG/M
3300005561\|Ga0066699_10998346	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	580	Open in IMG/M
3300005616\|Ga0068852_101283369	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae	754	Open in IMG/M
3300006034\|Ga0066656_10687873	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	658	Open in IMG/M
3300006606\|Ga0074062_12737139	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	530	Open in IMG/M
3300006871\|Ga0075434_102063590	Not Available	575	Open in IMG/M
3300006903\|Ga0075426_10114376	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1937	Open in IMG/M
3300006904\|Ga0075424_100431706	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1405	Open in IMG/M
3300009101\|Ga0105247_10891965	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	686	Open in IMG/M
3300009131\|Ga0115027_10157050	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1400	Open in IMG/M
3300009147\|Ga0114129_10486100	All Organisms → cellular organisms → Bacteria	1615	Open in IMG/M
3300009688\|Ga0116176_10639826	Not Available	514	Open in IMG/M
3300009804\|Ga0105063_1092194	All Organisms → cellular organisms → Bacteria	500	Open in IMG/M
3300010359\|Ga0126376_10853107	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	895	Open in IMG/M
3300010362\|Ga0126377_12668824	All Organisms → cellular organisms → Bacteria	575	Open in IMG/M
3300010373\|Ga0134128_12217777	Not Available	605	Open in IMG/M
3300010400\|Ga0134122_12347846	Not Available	580	Open in IMG/M
3300011421\|Ga0137462_1070500	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	792	Open in IMG/M
3300012210\|Ga0137378_11804133	Not Available	515	Open in IMG/M
3300012361\|Ga0137360_10564427	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	973	Open in IMG/M
3300012486\|Ga0157331_1010730	All Organisms → cellular organisms → Bacteria	675	Open in IMG/M
3300012923\|Ga0137359_10042582	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	3935	Open in IMG/M
3300012929\|Ga0137404_11067840	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	740	Open in IMG/M
3300012989\|Ga0164305_10734128	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	811	Open in IMG/M
3300013104\|Ga0157370_11959825	All Organisms → cellular organisms → Bacteria	525	Open in IMG/M
3300013296\|Ga0157374_12682915	Not Available	526	Open in IMG/M
3300013307\|Ga0157372_13468178	Not Available	501	Open in IMG/M
3300013763\|Ga0120179_1059036	All Organisms → cellular organisms → Bacteria	868	Open in IMG/M
3300013769\|Ga0119887_1013751	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2498	Open in IMG/M
3300014166\|Ga0134079_10634954	Not Available	536	Open in IMG/M
3300014166\|Ga0134079_10750608	Not Available	503	Open in IMG/M
3300014296\|Ga0075344_1153300	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	512	Open in IMG/M
3300014325\|Ga0163163_12873352	All Organisms → cellular organisms → Bacteria	537	Open in IMG/M
3300015158\|Ga0167622_1042380	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	857	Open in IMG/M
3300015257\|Ga0180067_1159759	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	516	Open in IMG/M
3300015372\|Ga0132256_102592129	All Organisms → cellular organisms → Bacteria	607	Open in IMG/M
3300015373\|Ga0132257_101609731	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	831	Open in IMG/M
3300017947\|Ga0187785_10705626	All Organisms → cellular organisms → Bacteria	530	Open in IMG/M
3300018063\|Ga0184637_10609591	All Organisms → cellular organisms → Bacteria	615	Open in IMG/M
3300018071\|Ga0184618_10319582	All Organisms → cellular organisms → Bacteria	662	Open in IMG/M
3300018469\|Ga0190270_12811318	All Organisms → cellular organisms → Bacteria	549	Open in IMG/M
3300018469\|Ga0190270_13317785	All Organisms → cellular organisms → Bacteria	510	Open in IMG/M
3300018476\|Ga0190274_13557987	All Organisms → cellular organisms → Bacteria	526	Open in IMG/M
3300018481\|Ga0190271_12117484	All Organisms → cellular organisms → Bacteria	670	Open in IMG/M
3300019888\|Ga0193751_1222951	All Organisms → cellular organisms → Bacteria	609	Open in IMG/M
3300021082\|Ga0210380_10389905	Not Available	637	Open in IMG/M
3300021363\|Ga0193699_10254107	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	732	Open in IMG/M
3300021413\|Ga0193750_1009375	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2493	Open in IMG/M
3300022534\|Ga0224452_1281591	Not Available	508	Open in IMG/M
3300023069\|Ga0247751_1055487	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	670	Open in IMG/M
3300025913\|Ga0207695_10046481	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	4602	Open in IMG/M
3300025916\|Ga0207663_10656551	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	828	Open in IMG/M
3300025917\|Ga0207660_11675039	Not Available	512	Open in IMG/M
3300025927\|Ga0207687_11206653	All Organisms → cellular organisms → Bacteria	650	Open in IMG/M
3300025932\|Ga0207690_11160438	All Organisms → cellular organisms → Bacteria	644	Open in IMG/M
3300025942\|Ga0207689_11044905	Not Available	689	Open in IMG/M
3300025949\|Ga0207667_10538782	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	1181	Open in IMG/M
3300025981\|Ga0207640_12036615	Not Available	520	Open in IMG/M
3300025986\|Ga0207658_10463981	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1123	Open in IMG/M
3300026023\|Ga0207677_10113194	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2025	Open in IMG/M
3300026088\|Ga0207641_10522020	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	1155	Open in IMG/M
3300026476\|Ga0256808_1047369	Not Available	624	Open in IMG/M
3300026501\|Ga0256806_1001945	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2736	Open in IMG/M
3300026542\|Ga0209805_1078097	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	1601	Open in IMG/M
3300026550\|Ga0209474_10770927	All Organisms → cellular organisms → Bacteria	502	Open in IMG/M
3300027360\|Ga0209969_1050187	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	654	Open in IMG/M
3300027682\|Ga0209971_1021214	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1545	Open in IMG/M
3300027842\|Ga0209580_10232829	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	915	Open in IMG/M
3300027871\|Ga0209397_10028212	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1870	Open in IMG/M
3300027876\|Ga0209974_10023332	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2047	Open in IMG/M
3300027915\|Ga0209069_10362456	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Achromobacter	785	Open in IMG/M
3300028379\|Ga0268266_10572103	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1084	Open in IMG/M
3300028589\|Ga0247818_10251573	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1168	Open in IMG/M
3300030000\|Ga0311337_11172700	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	671	Open in IMG/M
3300030003\|Ga0302172_10054027	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1195	Open in IMG/M
3300030019\|Ga0311348_10330120	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	1137	Open in IMG/M
3300030114\|Ga0311333_10052370	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfurirhabdus → Sulfurirhabdus autotrophica	2927	Open in IMG/M
3300030114\|Ga0311333_11543177	All Organisms → cellular organisms → Bacteria	573	Open in IMG/M
3300030838\|Ga0311335_10047937	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfurirhabdus → Sulfurirhabdus autotrophica	2660	Open in IMG/M
3300031170\|Ga0307498_10399620	All Organisms → cellular organisms → Bacteria	540	Open in IMG/M
3300031231\|Ga0170824_116607361	Not Available	556	Open in IMG/M
3300031736\|Ga0318501_10466898	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	686	Open in IMG/M
3300031765\|Ga0318554_10607193	Not Available	616	Open in IMG/M
3300031805\|Ga0318497_10422156	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	746	Open in IMG/M
3300031824\|Ga0307413_10067821	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2232	Open in IMG/M
3300031890\|Ga0306925_10553087	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1220	Open in IMG/M
3300031902\|Ga0302322_101841991	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	742	Open in IMG/M
3300031938\|Ga0308175_101032698	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	909	Open in IMG/M
3300031941\|Ga0310912_10055425	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2802	Open in IMG/M
3300031943\|Ga0310885_10007309	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	3636	Open in IMG/M
3300032008\|Ga0318562_10072975	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	1916	Open in IMG/M
3300032008\|Ga0318562_10361912	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	843	Open in IMG/M
3300032017\|Ga0310899_10687029	Not Available	519	Open in IMG/M
3300032054\|Ga0318570_10204992	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	891	Open in IMG/M
3300032068\|Ga0318553_10167640	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1141	Open in IMG/M
3300032397\|Ga0315287_11087719	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	926	Open in IMG/M
3300032421\|Ga0310812_10233820	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	805	Open in IMG/M
3300033416\|Ga0316622_102952566	Not Available	542	Open in IMG/M
3300033485\|Ga0316626_10487681	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1046	Open in IMG/M
3300034129\|Ga0370493_0185788	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	690	Open in IMG/M
3300034129\|Ga0370493_0309891	Not Available	543	Open in IMG/M
3300034281\|Ga0370481_0106349	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	945	Open in IMG/M
3300034354\|Ga0364943_0381747	Not Available	542	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	72.48%
Host-Associated	Host-Associated	25.69%
Engineered	Engineered	1.83%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	61.47%
Plants	Host-Associated → Plants	25.69%
Aquatic	Environmental → Aquatic	11.01%
Wastewater	Engineered → Wastewater	1.83%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	54.13%
Rhizosphere	Host-Associated → Plants → Rhizosphere	14.68%
Rhizoplane	Host-Associated → Plants → Rhizoplane	10.09%
Peat	Environmental → Terrestrial → Peat	6.42%
Freshwater	Environmental → Aquatic → Freshwater	5.50%
Sediment	Environmental → Aquatic → Sediment	5.50%
Floodplain	Environmental → Terrestrial → Floodplain	0.92%
Roots	Host-Associated → Plants → Roots	0.92%
Anaerobic Digestor	Engineered → Wastewater → Anaerobic Digestor	0.92%
Industrial Wastewater	Engineered → Wastewater → Industrial Wastewater	0.92%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	42.20%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	10.09%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	9.17%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	6.42%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	6.42%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	5.50%
Loam	Environmental → Terrestrial → Soil → Loam	4.59%
Soil	Host-Associated → Plants → Rhizosphere → Soil	4.59%
Sediment	Environmental → Aquatic → Freshwater → Sediment	2.75%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	1.83%
Lake	Environmental → Aquatic → Freshwater → Lake	0.92%
Sand	Environmental → Terrestrial → Soil → Sand	0.92%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.92%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.92%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.92%
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified	0.92%
Unclassified	Engineered → Wastewater → Industrial Wastewater → Unclassified	0.92%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	22.02%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	10.09%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	9.17%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	9.17%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	6.42%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	6.42%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	5.50%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	4.59%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	4.59%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	3.67%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	3.67%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	2.75%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	2.75%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	1.83%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	0.92%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	0.92%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	0.92%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.92%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.92%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.92%
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified	0.92%
Unclassified	Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified	0.92%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	10.09%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	7.34%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	6.42%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	3.67%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	3.67%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	3.67%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	3.67%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	2.75%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	2.75%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	2.75%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	2.75%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	2.75%
Wetland	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland	1.83%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment	1.83%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	1.83%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	1.83%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.83%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	1.83%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	1.83%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	1.83%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	1.83%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.83%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	1.83%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.92%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	0.92%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	0.92%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.92%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.92%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	0.92%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	0.92%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.92%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	0.92%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	0.92%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.92%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	0.92%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.92%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.92%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil	0.92%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	0.92%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.92%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.92%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.92%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.92%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.92%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.92%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.92%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.92%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.92%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.92%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.92%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.92%
Anaerobic Digestor Sludge	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge	0.92%
Sewage Treatment Plant	Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Sewage Treatment Plant	0.92%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300004156	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1	Environmental	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Host-Associated	Open in IMG/M
3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Environmental	Open in IMG/M
3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Environmental	Open in IMG/M
3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Environmental	Open in IMG/M
3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Host-Associated	Open in IMG/M
3300005561	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148	Environmental	Open in IMG/M
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated	Open in IMG/M
3300006034	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105	Environmental	Open in IMG/M
3300006606	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006903	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated	Open in IMG/M
3300009131	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1	Environmental	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009688	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC08_MetaG	Engineered	Open in IMG/M
3300009804	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300011421	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT769_2	Environmental	Open in IMG/M
3300012210	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG	Environmental	Open in IMG/M
3300012361	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG	Environmental	Open in IMG/M
3300012486	Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.120510	Environmental	Open in IMG/M
3300012923	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG	Environmental	Open in IMG/M
3300012929	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental	Open in IMG/M
3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Host-Associated	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Host-Associated	Open in IMG/M
3300013763	Permafrost microbial communities from Nunavut, Canada - A15_65cm_0M	Environmental	Open in IMG/M
3300013769	Sewage treatment plant microbial communities from Vermont, USA - Sand_B	Engineered	Open in IMG/M
3300014166	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015	Environmental	Open in IMG/M
3300014296	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D1	Environmental	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300015158	Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G1A, Ice margin)	Environmental	Open in IMG/M
3300015257	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231_16_10D	Environmental	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300017947	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG	Environmental	Open in IMG/M
3300018063	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2	Environmental	Open in IMG/M
3300018071	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1	Environmental	Open in IMG/M
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental	Open in IMG/M
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental	Open in IMG/M
3300018481	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T	Environmental	Open in IMG/M
3300019888	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2	Environmental	Open in IMG/M
3300021082	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo	Environmental	Open in IMG/M
3300021363	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2	Environmental	Open in IMG/M
3300021413	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c1	Environmental	Open in IMG/M
3300022534	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1	Environmental	Open in IMG/M
3300023069	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S049-202B-5	Environmental	Open in IMG/M
3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026476	Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 PR6	Environmental	Open in IMG/M
3300026501	Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 PR4	Environmental	Open in IMG/M
3300026542	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)	Environmental	Open in IMG/M
3300026550	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)	Environmental	Open in IMG/M
3300027360	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes)	Host-Associated	Open in IMG/M
3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes)	Host-Associated	Open in IMG/M
3300027842	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027871	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes)	Environmental	Open in IMG/M
3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes)	Host-Associated	Open in IMG/M
3300027915	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)	Environmental	Open in IMG/M
3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300028589	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1	Environmental	Open in IMG/M
3300030000	I_Fen_N3 coassembly	Environmental	Open in IMG/M
3300030003	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_3	Environmental	Open in IMG/M
3300030019	II_Fen_E2 coassembly	Environmental	Open in IMG/M
3300030114	I_Fen_E2 coassembly	Environmental	Open in IMG/M
3300030838	I_Fen_N1 coassembly	Environmental	Open in IMG/M
3300031170	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S	Environmental	Open in IMG/M
3300031231	Coassembly Site 11 (all samples) - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031736	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21	Environmental	Open in IMG/M
3300031765	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22	Environmental	Open in IMG/M
3300031805	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23	Environmental	Open in IMG/M
3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Host-Associated	Open in IMG/M
3300031890	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)	Environmental	Open in IMG/M
3300031902	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2	Environmental	Open in IMG/M
3300031938	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1	Environmental	Open in IMG/M
3300031941	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080	Environmental	Open in IMG/M
3300031943	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2	Environmental	Open in IMG/M
3300032008	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18	Environmental	Open in IMG/M
3300032017	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4	Environmental	Open in IMG/M
3300032054	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23	Environmental	Open in IMG/M
3300032068	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21	Environmental	Open in IMG/M
3300032397	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0	Environmental	Open in IMG/M
3300032421	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3	Environmental	Open in IMG/M
3300033416	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C	Environmental	Open in IMG/M
3300033485	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A	Environmental	Open in IMG/M
3300034129	Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_16	Environmental	Open in IMG/M
3300034281	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03D_15	Environmental	Open in IMG/M
3300034354	Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.44
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.44
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F088838

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0062589_1004234342	3300004156	Soil	FVAVYERTIGTLARAGTRIEHVDLRYRNGFAARVPGFRERVRKKT*
Ga0062595_1020045142	3300004479	Soil	AHDRTIGALARAGRHIERVDLRYRNGFAARVPGFREKPVRKS*
Ga0070677_102430371	3300005333	Miscanthus Rhizosphere	GRTIGALARSGTRVAEIDLRYRNGFAARVPGFREKAPRRVETKD*
Ga0070714_1023878802	3300005435	Agricultural Soil	RTVGALARAGTKVEQVDLRYRNGFSARVPAFRERPQKKAA*
Ga0070701_110624822	3300005438	Corn, Switchgrass And Miscanthus Rhizosphere	LGALARVGTKVEVVDLRYRNGFAARVPAFREKAATRTGA*
Ga0070711_1006107722	3300005439	Corn, Switchgrass And Miscanthus Rhizosphere	KTVGALARAGTRVEYADLRYRNGFAARVPGFKERAVKKAA*
Ga0068867_1004740422	3300005459	Miscanthus Rhizosphere	QTIGALARGGTRVETVDLRYRNGYAVRVPAFREKNLKPAA*
Ga0066699_109983461	3300005561	Soil	TVGALNRAGTRVDYVDLRYRNGFAVRVPGFTERSPRRSG*
Ga0068852_1012833692	3300005616	Corn Rhizosphere	HGRTLGALARAGTRIEAVDLRYRNGFAARIPGFREKSAKPAAGTT*
Ga0066656_106878731	3300006034	Soil	VGALNRGGTRVDYVDLRYRNGFAVRVPGFTERSPRKAG*
Ga0074062_127371391	3300006606	Soil	TVGALARAGTRIDRVDLRYRNGFAARVPGLPELPARKTTG*
Ga0075434_1020635902	3300006871	Populus Rhizosphere	AVYGRTLATLARAGTRVDRVDLRYRNGFAAHVPEFHERPAKKARAA*
Ga0075426_101143763	3300006903	Populus Rhizosphere	LATLARAGTRVDRVDLRYRNGFAAHVPEFHERPAKKARAV*
Ga0075424_1004317062	3300006904	Populus Rhizosphere	IGALAQVGRHIEQVDLRYRNGFAVRVPGFREKPVKKS*
Ga0105247_108919652	3300009101	Switchgrass Rhizosphere	FVSAHRQTIGALSRAGTKVDVVDLRYRNGFAVRVPAFREKNAKPA*
Ga0115027_101570502	3300009131	Wetland	TIGALARQGTRVDHVDLRYRNGFAARVPGLREAPAKSGA*
Ga0114129_104861003	3300009147	Populus Rhizosphere	RTIGALARAGRWVEQVDLRYRNGFAARVPGFREKPAKKS*
Ga0116176_106398262	3300009688	Anaerobic Digestor Sludge	LARSGTRVGEVDLRYRNGFAARVPGFREKPAKRPL*
Ga0105063_10921941	3300009804	Groundwater Sand	TIGALARAGRWVEQVDLRYRNGFAARVPGFREKPAKKS*
Ga0126376_108531072	3300010359	Tropical Forest Soil	RTLGALARAGTRVEYVDLRYRNGFAVRIPGFVERTPKRGG*
Ga0126377_126688241	3300010362	Tropical Forest Soil	SRFVTYYAKTIGALARAGTRVEYADLRYRNGFAVRVPAFVEKSTKKAS*
Ga0134128_122177772	3300010373	Terrestrial Soil	YGRTLGVLARTGTRVERVDLRYRNGFAAQMPGFREKPARKVS*
Ga0134122_123478461	3300010400	Terrestrial Soil	TRSGVEIEHVDLRYRNGFAARVPGFKERPPKKTG*
Ga0137462_10705002	3300011421	Soil	LDALARAGTRVAHVDLRYRNGFAARVPGFQERAPKKKAGA*
Ga0137378_118041332	3300012210	Vadose Zone Soil	VGALNHGGTRVDSVDLRYRNGFAVRVPGFTERSPRKAG*
Ga0137360_105644272	3300012361	Vadose Zone Soil	GALARAGTRVEYVDLRYRNGFAARVPEFKERAVKKAA*
Ga0157331_10107301	3300012486	Soil	ARTVGALARAGTRVEYADLRYRNGFAARIPLFKERAAKKAA*
Ga0137359_100425825	3300012923	Vadose Zone Soil	YYAKTVGALARAGTRVEYADLRYRNGFAARVPGFKERAVKKAA*
Ga0137404_110678401	3300012929	Vadose Zone Soil	YHARTVGALNHGGTRVDYVDLRYRNGFAVRVPGFTERSPRKAG*
Ga0164305_107341282	3300012989	Soil	VGALAHAGTHVDHVDLRYRNSFAARVPGFREKTARRIS*
Ga0157370_119598252	3300013104	Corn Rhizosphere	GVLAHAGTHVDHVDLRYRNGFAARMPNFREKPAHKVS*
Ga0157374_126829152	3300013296	Miscanthus Rhizosphere	AHAGTHVDHVDLRYRNGFAARMPNFREKPAHKVS*
Ga0157372_134681781	3300013307	Corn Rhizosphere	VLARTGKHVDHVDLRYRNGFAARMPGFREKTPRKVS*
Ga0120179_10590362	3300013763	Permafrost	ARAGTRVEYADLRYRNGFAARVPGFKERAVKKAA*
Ga0119887_10137511	3300013769	Sewage Treatment Plant	TLGALARAGTRVDAVDLRYRNGFAARIPGFREKNAKPAA*
Ga0134079_106349542	3300014166	Grasslands Soil	FVSYYARTVGALARAGTRVEYVDLRYRNGFAARVPEFKERAVKKAA*
Ga0134079_107506081	3300014166	Grasslands Soil	RYHTRTVGALNRAGTRVDYVDLRYRNGFAVRVPGFTDRSPRKAG*
Ga0075344_11533002	3300014296	Natural And Restored Wetlands	FVAAHGRTLGALARAGTRVDAVDLRYRNGFAARVPAFREKTMKPGA*
Ga0163163_128733521	3300014325	Switchgrass Rhizosphere	IGALSRAGTKIDVVDLRYRNGFAVRVPNFREKNTKPSA*
Ga0167622_10423801	3300015158	Glacier Forefield Soil	ARTIARLERSGTRVEYVDLRYSNGFAVRVPGFKERAPKKLG*
Ga0180067_11597592	3300015257	Soil	YERTIVALARAGTRIEHVDLRYRNGFAARVPGFQERAPKKKGTGKA*
Ga0132256_1025921291	3300015372	Arabidopsis Rhizosphere	TIGALARGGTRVETVDLRYRNGYAVRVPAFREKNLTPRA*
Ga0132257_1016097312	3300015373	Arabidopsis Rhizosphere	GRAGTVVAQVDLRYRNGFAARVPGFRERPAKKTA*
Ga0187785_107056261	3300017947	Tropical Peatland	TLGVLARAGTRVDRVDLRYHSGFAVHVPGFRERAKKGTA
Ga0184637_106095911	3300018063	Groundwater Sediment	RTLGALARAGTRIDTVDLRYRNGFAARVPGFREKSAKPAAGTT
Ga0184618_103195822	3300018071	Groundwater Sediment	VGALARAGTRVEYADLRYRNGFAARVPGFKERAMKKAA
Ga0190270_128113182	3300018469	Soil	RAGTRIDAVDLRYRNGFAARVPGFREMGGKPAAGKT
Ga0190270_133177851	3300018469	Soil	HGRTLGALERAGTKVDAVDLRYRNGFAARVPAFREKGAKPSA
Ga0190274_135579872	3300018476	Soil	FVAVHDRTIGALARSGRPIGQVDLRYRNGFAVRVPGFREKPARKS
Ga0190271_121174841	3300018481	Soil	TAAYARTVAALSRQGTRIEYVDLRYRNGFAARLPGFREGAKKPGT
Ga0193751_12229511	3300019888	Soil	ARTVGALARAGTRVEYADLRYRNGFAARVPGFKERAMKKAA
Ga0210380_103899052	3300021082	Groundwater Sediment	VLNRGGTRIDHVDLRYRTGFAARVPGFKERPQKRTT
Ga0193699_102541072	3300021363	Soil	VGTLTRGGMEIEHVDLRYRNGFAARVPGFKERPPKKTG
Ga0193750_10093751	3300021413	Soil	LARAGTRVEYADLRYRNGFAARVPGFKERAVKKAA
Ga0224452_12815911	3300022534	Groundwater Sediment	FVAAHDRTIGALARAGRPITQVDLRYRNGFAARVPGFREKPTTKS
Ga0247751_10554872	3300023069	Soil	TIGALARGGTRVAEVDLRYRNGFAARVPGFREKAPRRAEAKD
Ga0207695_100464816	3300025913	Corn Rhizosphere	RTMGVLAHAGTHVDRVDLRYRNGFAARMPGFREKPGRKAS
Ga0207663_106565511	3300025916	Corn, Switchgrass And Miscanthus Rhizosphere	AKTVGALARAGTRVEYADLRYRNGFAARVPGFKERAVKKAA
Ga0207660_116750391	3300025917	Corn Rhizosphere	RTIRLLAHNGTHIDRVDLRYRNGFAARMPNFHEKPARKVS
Ga0207687_112066531	3300025927	Miscanthus Rhizosphere	AVYTRTVGVLARTGKPVDHVDLRYRNGFAARMPEFREKPVRKLS
Ga0207690_111604381	3300025932	Corn Rhizosphere	AYRGTIGVLARSGTRVETVDLRYRNGYAVRVPAFREKIMKPAA
Ga0207689_110449051	3300025942	Miscanthus Rhizosphere	VGVLARTGKPLDHVDLRYRNGFAARMPEFREKPVRKLS
Ga0207667_105387821	3300025949	Corn Rhizosphere	TRVLARTGTRVERVDLRYRNGFAAQMPGFREKPARKVS
Ga0207640_120366152	3300025981	Corn Rhizosphere	LARTGKPVDHVDLRYRNGFAARMPEFREKPVRKLS
Ga0207658_104639812	3300025986	Switchgrass Rhizosphere	DRTVGALARAGRPVNEVDLRYRSGFAARVPGFREKPAKKT
Ga0207677_101131943	3300026023	Miscanthus Rhizosphere	RTVAVLARAGKRVEHVDLRYRSGFAAQMPGFREKATRKVS
Ga0207641_105220202	3300026088	Switchgrass Rhizosphere	ARAGTRVDRVDLRYRNGFAARVPGFRERPAKKAGAA
Ga0256808_10473691	3300026476	Sediment	GALARQGTRVDYVDLRYRNGFAARVPGLREAPAKSGV
Ga0256806_10019453	3300026501	Sediment	RTIGALARQGTRVDYVDLRYRNGFAARVPGLREAPAKSGV
Ga0209805_10780971	3300026542	Soil	YAKTIGALARAGTRVEYVDLRYRNGFAARVPEFKERAVKKAA
Ga0209474_107709271	3300026550	Soil	GAVHDRTIGALARAGRHIEQVDLRYRNGFAARVPGFREKPAKKS
Ga0209969_10501872	3300027360	Arabidopsis Thaliana Rhizosphere	ARTVAVLARTGKRVDHVDLRYRNGFAARMPGFREKAQRKT
Ga0209971_10212142	3300027682	Arabidopsis Thaliana Rhizosphere	VYARTIAVLARAGTQVDRVDLRYRNGFAARLPGFREKPQRKAS
Ga0209580_102328291	3300027842	Surface Soil	TIAALARGGTHVDYVDLRYRNGFAVRVLEATEKPSRRTG
Ga0209397_100282123	3300027871	Wetland	IAAYGRTVGALARAGTRIEYVDMRYRNGFAARVPGFKERPPKKAA
Ga0209974_100233321	3300027876	Arabidopsis Thaliana Rhizosphere	YARTVGALARGGTRVADVDLRYRNGFAARVPGFREKPARRAD
Ga0209069_103624562	3300027915	Watersheds	ERTIGALARAQTNIEHVDLRYRNGFAARVPGFRERPPKKAA
Ga0268266_105721032	3300028379	Switchgrass Rhizosphere	FVGAYDRTIAALARAGTRIEHVDLRYRNGFAARVPGFRERAPKRAA
Ga0247818_102515732	3300028589	Soil	IPAFARTGKPVDHVDLRYRNGFAARMPGFREKPPRKVS
Ga0311337_111727002	3300030000	Fen	TRVEQVDLRYRNGFAARVPEFREAAAKKPAADQLRNKH
Ga0302172_100540271	3300030003	Fen	VYGRTIQALARAGTRVDRVDLRYRNGFAARVPGFHERPAKKAGAA
Ga0311348_103301202	3300030019	Fen	QPRTLGTLERAGTHVDYVDLRYRNGFAARVPKFREKTARPAA
Ga0311333_100523701	3300030114	Fen	AAQPRTLGTLARAGTHVDYVDLRYRNGFAARVPKFREKTVKPAA
Ga0311333_115431771	3300030114	Fen	QPRTLGVLARAGTRVDYVDLRYRNGFAARVPQFREKSVKPHA
Ga0311335_100479371	3300030838	Fen	PRTLGALARSGTRVDYVDLRYRNGFAARVPQFREKAVKPHA
Ga0307498_103996202	3300031170	Soil	RQTLGALARAGTRVDVVDLRYRNGFAARVPAFREKIVKPAA
Ga0170824_1166073612	3300031231	Forest Soil	GLAGVYARTVGALVSAGTKVDYVDLRYRAGFAARVPGFREKLPKKLA
Ga0318501_104668981	3300031736	Soil	TIGALARTGTGIEHVDLRYRNGFAARVPGFRERVRKKG
Ga0318554_106071931	3300031765	Soil	SSTLAALARAGTPVEHVDLRYRNGFAVRMPGFTARPSARRPT
Ga0318497_104221561	3300031805	Soil	AVYERTIGALARAGTRIEHVDLRYHNGFAARVPGFRERTRKKA
Ga0307413_100678211	3300031824	Rhizosphere	FAAAYARTIAALSRQGTRVEYVDLRYRNGFAARLPGFREGAKKPGT
Ga0306925_105530871	3300031890	Soil	AYDRTIGALARANRGVEQVDLRYRNGFAARVPGFREKPSKKS
Ga0302322_1018419911	3300031902	Fen	PRTLGTLARTGTHVDYVDLRYRNGFAIRVPQFREKTVKPAA
Ga0308175_1010326982	3300031938	Soil	RTVGVLARTGKPVDRVDLRYRNGFAARMPEFREKPSRKVS
Ga0310912_100554251	3300031941	Soil	RTIGALARTGTGIEHVDLRYRNGFAARVPGFRERVRKKG
Ga0310885_100073091	3300031943	Soil	LARSGTRVADVDLRYRNGFTARVPGFREKPARRAD
Ga0318562_100729753	3300032008	Soil	ATAYPRTLAALASVGTHVDHVDLRYRNGFAARVPGFKERAAPKRG
Ga0318562_103619122	3300032008	Soil	PRTLGALARAGTRVEYVDLRYRNGFAVRVPGFVEKTPKKGG
Ga0310899_106870292	3300032017	Soil	AYARTVGALVRNGTRVADVDLRYRNGFTARVPGFREKPARRAD
Ga0318570_102049922	3300032054	Soil	IGALARTGTGIEHVDLRYRNGFAARVPGFRERVRKKG
Ga0318553_101676401	3300032068	Soil	YERTIGALARTGTGIEHVDLRYRNGFAARVPGFRERVRKKG
Ga0315287_110877191	3300032397	Sediment	AALARAGTRIEYVDLRYRNGFAARVPGFRERPAKRGA
Ga0310812_102338201	3300032421	Soil	YARTVGVLARTGKPVDHVDLRYRNGFAARMPGFREKPPRKVS
Ga0316622_1029525662	3300033416	Soil	ALARAGTRIEYVDMRYRNGFAARVPGFKERPPKKAA
Ga0316626_104876811	3300033485	Soil	VVAYGRTIGALTRQGTRVDHVDLRYRNGFAARVPGLREAPAKSGA
Ga0370493_0185788_1_108	3300034129	Untreated Peat Soil	LEKGGTRIDRVDLRYRNGFAARVPNFKERPPKKAA
Ga0370493_0309891_431_541	3300034129	Untreated Peat Soil	ALARAGTRVDYVDLRYRNGFAARIPQFREKSAKPAA
Ga0370481_0106349_11_127	3300034281	Untreated Peat Soil	VGALARAGTAVATVDLRYRNGFAARIPGFREKPAKKAA
Ga0364943_0381747_392_529	3300034354	Sediment	VYERTIDALARAGTRVEHVDLRYRNGFAARVPGFQERAAKKKATG

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign