Basic Information | |
---|---|
Family ID | F088523 |
Family Type | Metagenome |
Number of Sequences | 109 |
Average Sequence Length | 43 residues |
Representative Sequence | METKRLIPYSVHLPEDVYNKLKEAAGNRKASALVRDAITLIVEG |
Number of Associated Samples | 91 |
Number of Associated Scaffolds | 109 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 100.00 % |
% of genes near scaffold ends (potentially truncated) | 99.08 % |
% of genes from short scaffolds (< 2000 bps) | 94.50 % |
Associated GOLD sequencing projects | 88 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.35 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (88.073 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (27.523 % of family members) |
Environment Ontology (ENVO) | Unclassified (70.642 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (65.138 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.72% β-sheet: 0.00% Coil/Unstructured: 65.28% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 109 Family Scaffolds |
---|---|---|
PF00436 | SSB | 8.26 |
PF04404 | ERF | 5.50 |
PF06378 | DUF1071 | 3.67 |
PF01047 | MarR | 0.92 |
COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
---|---|---|---|
COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 8.26 |
COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 8.26 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 96.33 % |
Unclassified | root | N/A | 3.67 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000268|M3P_10140560 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 737 | Open in IMG/M |
3300002212|metazooDRAFT_1388407 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 928 | Open in IMG/M |
3300002835|B570J40625_101549432 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
3300003393|JGI25909J50240_1126409 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 503 | Open in IMG/M |
3300003943|Ga0007808_1005655 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 612 | Open in IMG/M |
3300004282|Ga0066599_101310558 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 547 | Open in IMG/M |
3300005582|Ga0049080_10165866 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 737 | Open in IMG/M |
3300006071|Ga0007876_1167061 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 543 | Open in IMG/M |
3300006108|Ga0007862_1022123 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1407 | Open in IMG/M |
3300006802|Ga0070749_10704913 | Not Available | 539 | Open in IMG/M |
3300006920|Ga0070748_1271374 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 607 | Open in IMG/M |
3300007973|Ga0105746_1295840 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 561 | Open in IMG/M |
3300008266|Ga0114363_1032503 | All Organisms → Viruses → Predicted Viral | 2191 | Open in IMG/M |
3300008450|Ga0114880_1136080 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 903 | Open in IMG/M |
3300009037|Ga0105093_10823182 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 541 | Open in IMG/M |
3300009051|Ga0102864_1054383 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1084 | Open in IMG/M |
3300009082|Ga0105099_10422443 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 798 | Open in IMG/M |
3300009151|Ga0114962_10356625 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 801 | Open in IMG/M |
3300009160|Ga0114981_10108639 | All Organisms → Viruses → Predicted Viral | 1537 | Open in IMG/M |
3300009165|Ga0105102_10083080 | Not Available | 1475 | Open in IMG/M |
3300009181|Ga0114969_10497717 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 682 | Open in IMG/M |
3300009183|Ga0114974_10241047 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1086 | Open in IMG/M |
3300009185|Ga0114971_10155134 | All Organisms → Viruses → Predicted Viral | 1376 | Open in IMG/M |
3300009187|Ga0114972_10285713 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 983 | Open in IMG/M |
3300010354|Ga0129333_10024693 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5693 | Open in IMG/M |
3300010354|Ga0129333_10756458 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 831 | Open in IMG/M |
3300010370|Ga0129336_10282302 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 927 | Open in IMG/M |
3300010885|Ga0133913_11201143 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1945 | Open in IMG/M |
3300010885|Ga0133913_12120980 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1390 | Open in IMG/M |
3300012013|Ga0153805_1052049 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 694 | Open in IMG/M |
3300013286|Ga0136641_1174303 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 575 | Open in IMG/M |
3300013372|Ga0177922_11261038 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 733 | Open in IMG/M |
3300017701|Ga0181364_1009353 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1659 | Open in IMG/M |
3300017701|Ga0181364_1047789 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 674 | Open in IMG/M |
3300017716|Ga0181350_1140936 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 567 | Open in IMG/M |
3300017723|Ga0181362_1060128 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 780 | Open in IMG/M |
3300017723|Ga0181362_1099388 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 579 | Open in IMG/M |
3300017747|Ga0181352_1137743 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 652 | Open in IMG/M |
3300017747|Ga0181352_1142573 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 638 | Open in IMG/M |
3300017754|Ga0181344_1066044 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1069 | Open in IMG/M |
3300017754|Ga0181344_1125064 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 740 | Open in IMG/M |
3300017754|Ga0181344_1184181 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 589 | Open in IMG/M |
3300017761|Ga0181356_1094864 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 977 | Open in IMG/M |
3300017761|Ga0181356_1174529 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 652 | Open in IMG/M |
3300017766|Ga0181343_1088921 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 882 | Open in IMG/M |
3300017766|Ga0181343_1181949 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 579 | Open in IMG/M |
3300017766|Ga0181343_1202472 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 543 | Open in IMG/M |
3300017766|Ga0181343_1211633 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
3300017777|Ga0181357_1060843 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1462 | Open in IMG/M |
3300017780|Ga0181346_1134456 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 937 | Open in IMG/M |
3300017785|Ga0181355_1334197 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 561 | Open in IMG/M |
3300017785|Ga0181355_1343858 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 550 | Open in IMG/M |
3300019783|Ga0181361_116637 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
3300020172|Ga0211729_10176806 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 765 | Open in IMG/M |
3300020498|Ga0208050_1013318 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 897 | Open in IMG/M |
3300020696|Ga0214181_1037990 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 513 | Open in IMG/M |
3300020710|Ga0214198_1020242 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 831 | Open in IMG/M |
3300021962|Ga0222713_10754272 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 548 | Open in IMG/M |
3300022179|Ga0181353_1088570 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 774 | Open in IMG/M |
3300022190|Ga0181354_1021441 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2053 | Open in IMG/M |
3300022190|Ga0181354_1129634 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 804 | Open in IMG/M |
3300022752|Ga0214917_10120663 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1463 | Open in IMG/M |
3300025387|Ga0207959_1024913 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 975 | Open in IMG/M |
3300025421|Ga0207958_1047423 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 632 | Open in IMG/M |
3300025470|Ga0208389_1030320 | All Organisms → Viruses → Predicted Viral | 1113 | Open in IMG/M |
3300025598|Ga0208379_1161282 | Not Available | 501 | Open in IMG/M |
3300025818|Ga0208542_1039474 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1505 | Open in IMG/M |
3300026478|Ga0255156_1063351 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 667 | Open in IMG/M |
3300027337|Ga0255087_1053349 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 755 | Open in IMG/M |
3300027608|Ga0208974_1045132 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1282 | Open in IMG/M |
3300027733|Ga0209297_1324009 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 567 | Open in IMG/M |
3300027743|Ga0209593_10060823 | All Organisms → Viruses → Predicted Viral | 1437 | Open in IMG/M |
3300027759|Ga0209296_1141778 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1090 | Open in IMG/M |
3300027764|Ga0209134_10074070 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1150 | Open in IMG/M |
3300027764|Ga0209134_10236850 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 626 | Open in IMG/M |
3300027770|Ga0209086_10167463 | All Organisms → Viruses → Predicted Viral | 1044 | Open in IMG/M |
3300027772|Ga0209768_10086802 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1564 | Open in IMG/M |
3300027777|Ga0209829_10288773 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 674 | Open in IMG/M |
3300027782|Ga0209500_10397501 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 555 | Open in IMG/M |
3300027785|Ga0209246_10021312 | Not Available | 2430 | Open in IMG/M |
3300027798|Ga0209353_10379570 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
3300027805|Ga0209229_10295193 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 715 | Open in IMG/M |
3300027805|Ga0209229_10334498 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 664 | Open in IMG/M |
3300027899|Ga0209668_11081016 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 540 | Open in IMG/M |
3300027963|Ga0209400_1349671 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 547 | Open in IMG/M |
3300028298|Ga0268280_1188782 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
3300028392|Ga0304729_1216322 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 587 | Open in IMG/M |
3300031578|Ga0307376_10882627 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 547 | Open in IMG/M |
3300031669|Ga0307375_10473596 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 760 | Open in IMG/M |
3300031885|Ga0315285_10861230 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 560 | Open in IMG/M |
3300031997|Ga0315278_11669757 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 607 | Open in IMG/M |
3300032050|Ga0315906_11361054 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
3300032116|Ga0315903_10984220 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 592 | Open in IMG/M |
3300032562|Ga0316226_1048724 | All Organisms → Viruses → Predicted Viral | 2207 | Open in IMG/M |
3300032665|Ga0316221_1067673 | All Organisms → Viruses → Predicted Viral | 1380 | Open in IMG/M |
3300032675|Ga0316225_1087781 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1069 | Open in IMG/M |
3300033979|Ga0334978_0110375 | All Organisms → Viruses → Predicted Viral | 1390 | Open in IMG/M |
3300034020|Ga0335002_0653036 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 536 | Open in IMG/M |
3300034021|Ga0335004_0613636 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 574 | Open in IMG/M |
3300034063|Ga0335000_0603639 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 617 | Open in IMG/M |
3300034101|Ga0335027_0689933 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
3300034104|Ga0335031_0264759 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1134 | Open in IMG/M |
3300034104|Ga0335031_0807056 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 524 | Open in IMG/M |
3300034106|Ga0335036_0009431 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8038 | Open in IMG/M |
3300034106|Ga0335036_0820204 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 536 | Open in IMG/M |
3300034116|Ga0335068_0323510 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 760 | Open in IMG/M |
3300034117|Ga0335033_0386612 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 693 | Open in IMG/M |
3300034117|Ga0335033_0510243 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 574 | Open in IMG/M |
3300034119|Ga0335054_0634458 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 27.52% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 13.76% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 12.84% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 6.42% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 3.67% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.67% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 2.75% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.75% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.75% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.75% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.83% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.83% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.83% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.83% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.83% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.83% |
Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.92% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.92% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.92% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.92% |
Lotic | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Lotic | 0.92% |
Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.92% |
Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.92% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.92% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.92% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.92% |
Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.92% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000268 | Lotic microbial communities from Mississippi River at two locations in the state of Minnesota, sample from River Site 1, Mississippi Headwaters ver2 | Environmental | Open in IMG/M |
3300002212 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - JAN 2013 | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
3300003943 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE06Aug07 | Environmental | Open in IMG/M |
3300004282 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sediment | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300006071 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09 | Environmental | Open in IMG/M |
3300006108 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH20Aug07 | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009037 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
3300009051 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02 | Environmental | Open in IMG/M |
3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
3300009187 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
3300013286 | Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300019783 | Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020696 | Freshwater microbial communities from Trout Bog Lake, WI - 05NOV2007 epilimnion | Environmental | Open in IMG/M |
3300020710 | Freshwater microbial communities from Trout Bog Lake, WI - 20SEP2008 epilimnion | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300025387 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH20Aug07 (SPAdes) | Environmental | Open in IMG/M |
3300025421 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul07 (SPAdes) | Environmental | Open in IMG/M |
3300025470 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09 (SPAdes) | Environmental | Open in IMG/M |
3300025598 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 (SPAdes) | Environmental | Open in IMG/M |
3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300026478 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8h | Environmental | Open in IMG/M |
3300027337 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8d | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027743 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028298 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_40m | Environmental | Open in IMG/M |
3300028392 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300032562 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18017 | Environmental | Open in IMG/M |
3300032665 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18007 | Environmental | Open in IMG/M |
3300032675 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18015 | Environmental | Open in IMG/M |
3300033979 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003 | Environmental | Open in IMG/M |
3300034020 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055 | Environmental | Open in IMG/M |
3300034021 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057 | Environmental | Open in IMG/M |
3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
M3P_101405601 | 3300000268 | Lotic | MEDNRLVPYSVHLKRDVYDKLKLAAGQRKASGLVRDAITMI |
metazooDRAFT_13884074 | 3300002212 | Lake | MATKRLIPYSVHLPEDIYEKLKKAAGDRKASALVRD |
B570J40625_1015494321 | 3300002835 | Freshwater | MDKRLIPYSVHLPEEIYKKLKQAAGERKASALVRDAITLIIEGDDSFNG |
JGI25909J50240_11264092 | 3300003393 | Freshwater Lake | MEDNRLVPYSVHLKREVYDKLKLAAGQRKASALVRDAITMIVEGDDEFNG |
Ga0007808_10056551 | 3300003943 | Freshwater | MDAGKRLIPYSVHLTPEIYEKLKEMAQQRKASSLVRDAITMIINGKGEFN |
Ga0066599_1013105581 | 3300004282 | Freshwater | METKRLIPYSVHLREDIHAQLRAVAKGRKAASMVRDAITMIVEGKGEF |
Ga0049080_101658661 | 3300005582 | Freshwater Lentic | METKRLVPYSVHLREDIYLKLKAAAGQRKATALVRDAITLIVEGDDVFNGG |
Ga0007876_11670612 | 3300006071 | Freshwater | MEASKRLIPYSVHLTPEIYDKLKELAQERKASKLVRDAITMILNGK |
Ga0007862_10221231 | 3300006108 | Freshwater | MEKRLIPYSVHLPEPIYAKLKKAAGERKASALVRDAITMIIDGNDAYT |
Ga0070749_107049132 | 3300006802 | Aqueous | MEARMIPYSVHLREDIYLKLKEFAKDRKATALVRDAITMIVEGDDAF |
Ga0070748_12713741 | 3300006920 | Aqueous | MEAKRLIPYSVHLREDIYIALKLAAKERKATSMVRDAITMI |
Ga0105746_12958401 | 3300007973 | Estuary Water | METKRLIPYSVHLREDIYHQLKDAAKGRKASGIVRDAITMI |
Ga0114363_10325036 | 3300008266 | Freshwater, Plankton | METKRLIPYSVHLPEDVYLKLKEAAGNRKASALVRDAITLIVEGDDEFNGG |
Ga0114880_11360804 | 3300008450 | Freshwater Lake | MEDNRLVPYSVHLKREVYDKLKLAAGQRNASALVRD |
Ga0105093_108231822 | 3300009037 | Freshwater Sediment | MEAKRLIPYSVHLPEDVYLKLKEAAGNRKASALVRDAITLIVEGDDEFNGGYN |
Ga0102864_10543834 | 3300009051 | Estuarine | METKRLIPYSVHLREDIYHQLKDAAKGRKASGIVRDAITMIIEGDDAF |
Ga0105099_104224433 | 3300009082 | Freshwater Sediment | MEAKRLIPYSVHLPEDVYLKLKEAAGNRKASALVRDAITLIVEGD |
Ga0114962_103566253 | 3300009151 | Freshwater Lake | METKRLIPYSVHLSEDIFNQVKAAAKQRKASSLVRDAITMFLEGD |
Ga0114981_101086394 | 3300009160 | Freshwater Lake | METKRLVPYSVQLREDIYLKLKEAAGQRKATALVRDAITLIVEGDDVFNGG |
Ga0105102_100830801 | 3300009165 | Freshwater Sediment | MEAKRLIPYSVHLPEDVYLKLKEAAGNRKASALVR |
Ga0114969_104977171 | 3300009181 | Freshwater Lake | METKKLIPYSVHLREDIYKKLKSAAGERKASSLVRDAITMIIEGDDEFNSGY |
Ga0114974_102410474 | 3300009183 | Freshwater Lake | MADNRLVPYSVHLKRDVYDKLKLAAGERKASSLVRDAITLLIEGDDEFN |
Ga0114971_101551341 | 3300009185 | Freshwater Lake | MEAKKLIPYSVHLREDIYLKLKTAAGDRKAAGMVRDA |
Ga0114972_102857131 | 3300009187 | Freshwater Lake | METKRLIPYSVHLSEDIFNQVKAAAKQRKASSLVRDAITMFLE |
Ga0129333_1002469312 | 3300010354 | Freshwater To Marine Saline Gradient | METRRLIPYSVHLPEHIYKKLKDAAGDRKASALVRDAIALILDGGDAY |
Ga0129333_107564583 | 3300010354 | Freshwater To Marine Saline Gradient | MIPYSVHLREDIYHKLREVAKDRKATALVRDAITMIIEGDD |
Ga0129336_102823023 | 3300010370 | Freshwater To Marine Saline Gradient | MDTKRLIPYSVHLPEDVYKKLKAAAGERKASSLVR |
Ga0133913_112011435 | 3300010885 | Freshwater Lake | METKRLIPYSVHLREDIYHQLKDAAKGRKASGIVRDAITMII |
Ga0133913_121209804 | 3300010885 | Freshwater Lake | MADNRLVPYSVHLKRDVYDKLKLAAGERKASSLVRD |
Ga0153805_10520493 | 3300012013 | Surface Ice | VETKRLIPYSVHLSEEVYLALKEKAKARQASSLVRD |
Ga0136641_11743032 | 3300013286 | Freshwater | MEDNKLVPYSVHLERGIYDKLKIAAKNRKASALVRDAITMIIEGDDEFNGGYN |
Ga0177922_112610383 | 3300013372 | Freshwater | METKRLIPYSVHLPEPIYKKLKAAAGERKASSLVRDAITMIVEGAPLYASGY |
Ga0181364_10093531 | 3300017701 | Freshwater Lake | METKRLIPYSVHLPEPIYKKLKAAAGERKASALVRDAITMIVEGGPLY |
Ga0181364_10477893 | 3300017701 | Freshwater Lake | MEAKRLIPYSVHLREDIYNKLKLAAGERKASSMVRDAITMIIEGDDAYT |
Ga0181350_11409362 | 3300017716 | Freshwater Lake | MEKSKRLIPYSVHLREDIYKKLKAAAGDRKASGMV |
Ga0181362_10601283 | 3300017723 | Freshwater Lake | MEDNRLVPYSVHLKREVYDKLKLAAGQRKASALVRD |
Ga0181362_10993882 | 3300017723 | Freshwater Lake | MEDNRLVPYSVHLKREVYDKLKLAAGQRKASALVRDAITMIVEG |
Ga0181352_11377433 | 3300017747 | Freshwater Lake | MESKRLIPYSVHLREDIYLKLKEAAGNRKASGLVRDAITMILDGDDEF |
Ga0181352_11425733 | 3300017747 | Freshwater Lake | METKRLVPYSVHLREDIYLKLKAAAGQRKATALVRDA |
Ga0181344_10660441 | 3300017754 | Freshwater Lake | MEKSKRLIPYSVHLREDIYKKLKAAAGERKASGMVRD |
Ga0181344_11250641 | 3300017754 | Freshwater Lake | MEKSKRLIPYSVHLREDIYKKLKAAAGDRKASGMVRDAITMIIEGDD |
Ga0181344_11841811 | 3300017754 | Freshwater Lake | METKRLIPYSVHLPEDVYNKLKEAAGNRKASALVRDAITLI |
Ga0181356_10948641 | 3300017761 | Freshwater Lake | MEAKRLIPYSVHLREDIYNKLKLAAGERKASSMVRS |
Ga0181356_11745291 | 3300017761 | Freshwater Lake | MEDNRLVPYSVHLKREVYDKLKLAAGQRKASALVRDA |
Ga0181343_10889213 | 3300017766 | Freshwater Lake | MESTTLIPYSVHLRRDIHAKLKAAAGDRKAAGLVRDAI |
Ga0181343_11819492 | 3300017766 | Freshwater Lake | MEPERLIPYSVHLPKEVHAKLKEAAGNRKASALVR |
Ga0181343_12024721 | 3300017766 | Freshwater Lake | MEDNRLVPYSVHLKREVYDKLKLAAGQRKASALVRDAIT |
Ga0181343_12116331 | 3300017766 | Freshwater Lake | METKRLIPYSVHLREDIYNKLKEAAEGRKASGMVRDAITMFLDGKDAF |
Ga0181357_10608434 | 3300017777 | Freshwater Lake | METKRLIPYSVHLREDIYHQLKDAAKGRKASGIVRDAIT |
Ga0181346_11344564 | 3300017780 | Freshwater Lake | MEDNRLVPYSVHLKREVYDKLKLAAGQRKASALVRDAITMIVE |
Ga0181355_13341971 | 3300017785 | Freshwater Lake | MDKRLIPYSVHLPEEIYKKLKQAAGERKASALVRDAITLIIEGD |
Ga0181355_13438582 | 3300017785 | Freshwater Lake | MEDNHLIPYSVHLRKDIHAKLKAAAGDRKASGLVRDAITLIIEGDTQFDG |
Ga0181361_1166371 | 3300019783 | Freshwater Lake | MEAKRLIPYSVHLREDIYNKLKLAAGERKASSMVRD |
Ga0211729_101768061 | 3300020172 | Freshwater | VETKRLIPYSVHLSEEVYLALKEKAKARQASSLVRDAITMILE |
Ga0208050_10133181 | 3300020498 | Freshwater | MEKRLIPYSVHLREDIYNKLKEAAGSRKASALVRD |
Ga0214181_10379902 | 3300020696 | Freshwater | METSKRLIPYSVHLTPQIYDKLKELAQERKASKLVRDAITMIINGKGDF |
Ga0214198_10202421 | 3300020710 | Freshwater | MEASKRLIPYSVHLTPEIYEKLKELAQERKASKLVRDAITMIINGKGDF |
Ga0222713_107542721 | 3300021962 | Estuarine Water | MESKRLIPYSVHLREDIYLKLKEAAKDRKATALVRDAI |
Ga0181353_10885701 | 3300022179 | Freshwater Lake | MEKRLVPYSVHLREDIYNKLKEAAGSRKASALVRDA |
Ga0181354_10214415 | 3300022190 | Freshwater Lake | MEAKRLVPYSVHLREDIYLKLKEAAGQRKATALVRDAITLIIEGD |
Ga0181354_11296343 | 3300022190 | Freshwater Lake | MEDNHLIPYSVHLRKDIHAKLKAAAGDRKASGLVRDAITLIIEGL |
Ga0214917_101206634 | 3300022752 | Freshwater | MEAKRLIPYSVHLREDIYNKLKLAAGERKASSMVRDAITMIIEGDDA |
Ga0207959_10249131 | 3300025387 | Freshwater | MDDRLIPYSVHLRRDIYDKLKEAAGQRKASSLVRDAITMIVEGD |
Ga0207958_10474233 | 3300025421 | Freshwater | MDDRLIPYSVHLRRDIYDKLKEAAGDRKASALVRDAITMIIEGE |
Ga0208389_10303204 | 3300025470 | Freshwater | MDDRLIPYSVHLRRDIYDKLKEAAGQRKASSLVRDA |
Ga0208379_11612821 | 3300025598 | Freshwater | METPKRLIPYSVHLPEEIYIKMKAAATERKASAMVRDAIVMMLEGDSVYNSGYRKGVRDSIN |
Ga0208542_10394741 | 3300025818 | Aqueous | MEARRLIPYSVHLPEDIYKKLKAAAGERKASALVRDAISLILDGG |
Ga0255156_10633511 | 3300026478 | Freshwater | METKRLIPYSVHLPDDIYAKLKAAAGERKASALVRDAITMIVSGTTPFNSG |
Ga0255087_10533493 | 3300027337 | Freshwater | METRRLIPYSVHLPEHIYKKLKDAAGDRKASALVRDAIALILDGGDAYSS |
Ga0208974_10451324 | 3300027608 | Freshwater Lentic | MEAKRLIPYSVHLREDIYTKLKAAAGERKASSMVRDAITMIIEGDDAYTS |
Ga0209297_13240091 | 3300027733 | Freshwater Lake | METKRLIPYSVHLSEDIFNQVKAAAKQRKASSLVRDAIT |
Ga0209593_100608231 | 3300027743 | Freshwater Sediment | METKRLIPYSVHLPEDVYNKLKEAAGNRKASALVRDAITLIVEG |
Ga0209296_11417784 | 3300027759 | Freshwater Lake | MADNRLVPYSVHLKRDVYDKLKLAAGERKASSLVRDAITLLIEGDDEFNG |
Ga0209134_100740704 | 3300027764 | Freshwater Lake | METKRLIPYSVHLREDIYHQLKDAAKGRKASGIVRD |
Ga0209134_102368501 | 3300027764 | Freshwater Lake | MEKSKRLIPYSVHLREDIYKKLKAAAGDRKASGMVRDAI |
Ga0209086_101674634 | 3300027770 | Freshwater Lake | METKRLVPYSVHLREDIYLKLKAAAGQRKATALVRDAITLIVEGD |
Ga0209768_100868021 | 3300027772 | Freshwater Lake | MEAKRLIPYSVHLREDIYNKLKLAAGERKASSMVRDAITMIIEGDDAYTS |
Ga0209829_102887733 | 3300027777 | Freshwater Lake | MESKRLIPYSVHLPEEIYKKLKAAAGERKASALVRDAITLIIEGDD |
Ga0209500_103975012 | 3300027782 | Freshwater Lake | VETKRLIPYSVHLSEEVYLALKEKAKARQASSLVR |
Ga0209246_100213121 | 3300027785 | Freshwater Lake | MEDNHLIPYSVHLRKDIHAKLKAAAGDRKASGLVRDAITLI |
Ga0209353_103795702 | 3300027798 | Freshwater Lake | VETKRLIPYSVHLSEEVYLALKEKAKARQASSLVRDAITMILEGNDSFN |
Ga0209229_102951931 | 3300027805 | Freshwater And Sediment | MEDNRLIPYSVHLKKDIYDKLKLAAGQRKASALVRDAITMIVE |
Ga0209229_103344983 | 3300027805 | Freshwater And Sediment | MDTKRLIPYSVHLPADVYKKLKEAAGERKASSLVRDAITIILEGDDEFNGGD |
Ga0209668_110810162 | 3300027899 | Freshwater Lake Sediment | MEKKRLVPYSVHLREDIYNALKAAAKGRKASSLVRDSIT |
Ga0209400_13496711 | 3300027963 | Freshwater Lake | METKRLIPYSVHLREDIYHQLKDAAKGRKASGIVRDAITMIIEGD |
Ga0268280_11887821 | 3300028298 | Saline Water | METKRLIPYSVHLPEPIYKKLKAAAGERKASSLVRDAITM |
Ga0304729_12163222 | 3300028392 | Freshwater Lake | METKRLIPYSVHLSEDIFNQVKAAAKQRKASSLVRDAITMFLEGDDAFKG |
Ga0307376_108826272 | 3300031578 | Soil | MEKKRLIPYSVHLREDIYLKLKAAAGARKASSMVRDAI |
Ga0307375_104735961 | 3300031669 | Soil | MEQARMIPYSVHLPEEVHKKLKEAAGHRKASALVRDAITLIVE |
Ga0315285_108612301 | 3300031885 | Sediment | MEDNRLVPYSVHLKRDVYDKLKLAAGQRKASGLVRDA |
Ga0315278_116697571 | 3300031997 | Sediment | MEDNRLVPYSVHLKREVYDKLKLAAGQRKASALVRDAITMIVEGDDEFNGG |
Ga0315906_113610541 | 3300032050 | Freshwater | MEDNRLVPYSVHLKREVYDKLKLAAGQRKASALVRDAITMIVEGDDEFN |
Ga0315903_109842203 | 3300032116 | Freshwater | MEKRLIPYSVHLREDIYIKLKEFAKDRKATALVRDA |
Ga0316226_10487241 | 3300032562 | Freshwater | MEKKRLIPYSVHLREDIYDQLKEAAGERKAAGLVRDAITMIIE |
Ga0316221_10676734 | 3300032665 | Freshwater | MDDRLIPYSVHLRRDIYDKLKEAAGQRKASSLVRDAITMIVEGDSQYM |
Ga0316225_10877811 | 3300032675 | Freshwater | MEASKRLIPYSVHLTPEIYEKLKELAQERKASKLV |
Ga0334978_0110375_1_105 | 3300033979 | Freshwater | MEKRLVPYSVHLREDIYNKLKEAAGSRKASALVRD |
Ga0335002_0653036_400_534 | 3300034020 | Freshwater | MEKRLVPYSVHLREDIYNKLKEAAGSRKASALVRDAITMIIEGDD |
Ga0335004_0613636_439_573 | 3300034021 | Freshwater | MEDNRLVPYSVHLKREVYDKLKLAAGQRKASALVRDAITMIVEGD |
Ga0335000_0603639_1_132 | 3300034063 | Freshwater | METKRLIPYSVHLSEEVYLALKEKAKARQASSLVRDAITMILEG |
Ga0335027_0689933_3_158 | 3300034101 | Freshwater | METKRLIPYSVHLSEEVYLALKEKAKARQASSLVRDAITMILEGNDSFNSGY |
Ga0335031_0264759_1_159 | 3300034104 | Freshwater | METKRLIPYSVHLPEPIYKKLKAAAGERKASSLVRDAITMIVEGGPLYASGYN |
Ga0335031_0807056_1_117 | 3300034104 | Freshwater | MDKRLIPYSVHLPEEIYKKLKQAAGERKASALVRDAITL |
Ga0335036_0009431_1_144 | 3300034106 | Freshwater | MDKRLIPYSVHLPEEIYKKLKQAAGERKASALVRDAITLIIEGDDSFN |
Ga0335036_0820204_3_137 | 3300034106 | Freshwater | METTKRLIPYSVHLREDIYLKLKAAAKDRKATALVRDAITMIIEG |
Ga0335068_0323510_1_135 | 3300034116 | Freshwater | METKRLIPYSVHLSEEVYLALKEKAKARQASSLVRDAITMILEGN |
Ga0335033_0386612_3_116 | 3300034117 | Freshwater | MEAKRLIPYSVHLPEDVYLKLKEAAGNRKASALVRDAI |
Ga0335033_0510243_15_146 | 3300034117 | Freshwater | METKRLIPYSVHLREDIYHQLKDAAKGRKASGIVRDAITMIIE |
Ga0335054_0634458_471_581 | 3300034119 | Freshwater | METKRLIPYSVHLSEEVYLALKEKAKARQASSLVRDA |
⦗Top⦘ |