NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F088523

Metagenome Family F088523

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F088523
Family Type Metagenome
Number of Sequences 109
Average Sequence Length 43 residues
Representative Sequence METKRLIPYSVHLPEDVYNKLKEAAGNRKASALVRDAITLIVEG
Number of Associated Samples 91
Number of Associated Scaffolds 109

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Viruses
% of genes with valid RBS motifs 100.00 %
% of genes near scaffold ends (potentially truncated) 99.08 %
% of genes from short scaffolds (< 2000 bps) 94.50 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction Yes
3D model pTM-score0.35

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (88.073 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake
(27.523 % of family members)
Environment Ontology (ENVO) Unclassified
(70.642 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(65.138 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 34.72%    β-sheet: 0.00%    Coil/Unstructured: 65.28%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.35
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 109 Family Scaffolds
PF00436SSB 8.26
PF04404ERF 5.50
PF06378DUF1071 3.67
PF01047MarR 0.92

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 109 Family Scaffolds
COG0629Single-stranded DNA-binding proteinReplication, recombination and repair [L] 8.26
COG2965Primosomal replication protein NReplication, recombination and repair [L] 8.26


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.33 %
UnclassifiedrootN/A3.67 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000268|M3P_10140560All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage737Open in IMG/M
3300002212|metazooDRAFT_1388407All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage928Open in IMG/M
3300002835|B570J40625_101549432All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage542Open in IMG/M
3300003393|JGI25909J50240_1126409All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage503Open in IMG/M
3300003943|Ga0007808_1005655All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage612Open in IMG/M
3300004282|Ga0066599_101310558All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage547Open in IMG/M
3300005582|Ga0049080_10165866All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage737Open in IMG/M
3300006071|Ga0007876_1167061All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage543Open in IMG/M
3300006108|Ga0007862_1022123All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1407Open in IMG/M
3300006802|Ga0070749_10704913Not Available539Open in IMG/M
3300006920|Ga0070748_1271374All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage607Open in IMG/M
3300007973|Ga0105746_1295840All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage561Open in IMG/M
3300008266|Ga0114363_1032503All Organisms → Viruses → Predicted Viral2191Open in IMG/M
3300008450|Ga0114880_1136080All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage903Open in IMG/M
3300009037|Ga0105093_10823182All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage541Open in IMG/M
3300009051|Ga0102864_1054383All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1084Open in IMG/M
3300009082|Ga0105099_10422443All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage798Open in IMG/M
3300009151|Ga0114962_10356625All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage801Open in IMG/M
3300009160|Ga0114981_10108639All Organisms → Viruses → Predicted Viral1537Open in IMG/M
3300009165|Ga0105102_10083080Not Available1475Open in IMG/M
3300009181|Ga0114969_10497717All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage682Open in IMG/M
3300009183|Ga0114974_10241047All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1086Open in IMG/M
3300009185|Ga0114971_10155134All Organisms → Viruses → Predicted Viral1376Open in IMG/M
3300009187|Ga0114972_10285713All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage983Open in IMG/M
3300010354|Ga0129333_10024693All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5693Open in IMG/M
3300010354|Ga0129333_10756458All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage831Open in IMG/M
3300010370|Ga0129336_10282302All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage927Open in IMG/M
3300010885|Ga0133913_11201143All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1945Open in IMG/M
3300010885|Ga0133913_12120980All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1390Open in IMG/M
3300012013|Ga0153805_1052049All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage694Open in IMG/M
3300013286|Ga0136641_1174303All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage575Open in IMG/M
3300013372|Ga0177922_11261038All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage733Open in IMG/M
3300017701|Ga0181364_1009353All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1659Open in IMG/M
3300017701|Ga0181364_1047789All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage674Open in IMG/M
3300017716|Ga0181350_1140936All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage567Open in IMG/M
3300017723|Ga0181362_1060128All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage780Open in IMG/M
3300017723|Ga0181362_1099388All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage579Open in IMG/M
3300017747|Ga0181352_1137743All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage652Open in IMG/M
3300017747|Ga0181352_1142573All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage638Open in IMG/M
3300017754|Ga0181344_1066044All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1069Open in IMG/M
3300017754|Ga0181344_1125064All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage740Open in IMG/M
3300017754|Ga0181344_1184181All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage589Open in IMG/M
3300017761|Ga0181356_1094864All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage977Open in IMG/M
3300017761|Ga0181356_1174529All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage652Open in IMG/M
3300017766|Ga0181343_1088921All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage882Open in IMG/M
3300017766|Ga0181343_1181949All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage579Open in IMG/M
3300017766|Ga0181343_1202472All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage543Open in IMG/M
3300017766|Ga0181343_1211633All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage529Open in IMG/M
3300017777|Ga0181357_1060843All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1462Open in IMG/M
3300017780|Ga0181346_1134456All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage937Open in IMG/M
3300017785|Ga0181355_1334197All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage561Open in IMG/M
3300017785|Ga0181355_1343858All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage550Open in IMG/M
3300019783|Ga0181361_116637All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage581Open in IMG/M
3300020172|Ga0211729_10176806All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage765Open in IMG/M
3300020498|Ga0208050_1013318All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage897Open in IMG/M
3300020696|Ga0214181_1037990All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage513Open in IMG/M
3300020710|Ga0214198_1020242All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage831Open in IMG/M
3300021962|Ga0222713_10754272All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage548Open in IMG/M
3300022179|Ga0181353_1088570All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage774Open in IMG/M
3300022190|Ga0181354_1021441All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2053Open in IMG/M
3300022190|Ga0181354_1129634All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage804Open in IMG/M
3300022752|Ga0214917_10120663All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1463Open in IMG/M
3300025387|Ga0207959_1024913All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage975Open in IMG/M
3300025421|Ga0207958_1047423All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage632Open in IMG/M
3300025470|Ga0208389_1030320All Organisms → Viruses → Predicted Viral1113Open in IMG/M
3300025598|Ga0208379_1161282Not Available501Open in IMG/M
3300025818|Ga0208542_1039474All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1505Open in IMG/M
3300026478|Ga0255156_1063351All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage667Open in IMG/M
3300027337|Ga0255087_1053349All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage755Open in IMG/M
3300027608|Ga0208974_1045132All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1282Open in IMG/M
3300027733|Ga0209297_1324009All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage567Open in IMG/M
3300027743|Ga0209593_10060823All Organisms → Viruses → Predicted Viral1437Open in IMG/M
3300027759|Ga0209296_1141778All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1090Open in IMG/M
3300027764|Ga0209134_10074070All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1150Open in IMG/M
3300027764|Ga0209134_10236850All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage626Open in IMG/M
3300027770|Ga0209086_10167463All Organisms → Viruses → Predicted Viral1044Open in IMG/M
3300027772|Ga0209768_10086802All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1564Open in IMG/M
3300027777|Ga0209829_10288773All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage674Open in IMG/M
3300027782|Ga0209500_10397501All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage555Open in IMG/M
3300027785|Ga0209246_10021312Not Available2430Open in IMG/M
3300027798|Ga0209353_10379570All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage584Open in IMG/M
3300027805|Ga0209229_10295193All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage715Open in IMG/M
3300027805|Ga0209229_10334498All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage664Open in IMG/M
3300027899|Ga0209668_11081016All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage540Open in IMG/M
3300027963|Ga0209400_1349671All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage547Open in IMG/M
3300028298|Ga0268280_1188782All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage527Open in IMG/M
3300028392|Ga0304729_1216322All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage587Open in IMG/M
3300031578|Ga0307376_10882627All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage547Open in IMG/M
3300031669|Ga0307375_10473596All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage760Open in IMG/M
3300031885|Ga0315285_10861230All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage560Open in IMG/M
3300031997|Ga0315278_11669757All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage607Open in IMG/M
3300032050|Ga0315906_11361054All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage502Open in IMG/M
3300032116|Ga0315903_10984220All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage592Open in IMG/M
3300032562|Ga0316226_1048724All Organisms → Viruses → Predicted Viral2207Open in IMG/M
3300032665|Ga0316221_1067673All Organisms → Viruses → Predicted Viral1380Open in IMG/M
3300032675|Ga0316225_1087781All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1069Open in IMG/M
3300033979|Ga0334978_0110375All Organisms → Viruses → Predicted Viral1390Open in IMG/M
3300034020|Ga0335002_0653036All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage536Open in IMG/M
3300034021|Ga0335004_0613636All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage574Open in IMG/M
3300034063|Ga0335000_0603639All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage617Open in IMG/M
3300034101|Ga0335027_0689933All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage608Open in IMG/M
3300034104|Ga0335031_0264759All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1134Open in IMG/M
3300034104|Ga0335031_0807056All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage524Open in IMG/M
3300034106|Ga0335036_0009431All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage8038Open in IMG/M
3300034106|Ga0335036_0820204All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage536Open in IMG/M
3300034116|Ga0335068_0323510All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage760Open in IMG/M
3300034117|Ga0335033_0386612All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage693Open in IMG/M
3300034117|Ga0335033_0510243All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage574Open in IMG/M
3300034119|Ga0335054_0634458All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage581Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake27.52%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake13.76%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater12.84%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater6.42%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment3.67%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater3.67%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater2.75%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.75%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous2.75%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient2.75%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic1.83%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment1.83%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment1.83%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater1.83%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater1.83%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil1.83%
LakeEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake0.92%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.92%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton0.92%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.92%
LoticEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Lotic0.92%
Surface IceEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice0.92%
FreshwaterEnvironmental → Aquatic → Freshwater → Pond → Sediment → Freshwater0.92%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.92%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.92%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.92%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water0.92%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000268Lotic microbial communities from Mississippi River at two locations in the state of Minnesota, sample from River Site 1, Mississippi Headwaters ver2EnvironmentalOpen in IMG/M
3300002212Freshwater microbial communities from San Paulo Zoo lake, Brazil - JAN 2013EnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003393Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DDEnvironmentalOpen in IMG/M
3300003943Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE06Aug07EnvironmentalOpen in IMG/M
3300004282Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sedimentEnvironmentalOpen in IMG/M
3300005582Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRFEnvironmentalOpen in IMG/M
3300006071Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09EnvironmentalOpen in IMG/M
3300006108Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH20Aug07EnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300007973Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2umEnvironmentalOpen in IMG/M
3300008266Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008450Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigsEnvironmentalOpen in IMG/M
3300009037Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015EnvironmentalOpen in IMG/M
3300009051Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02EnvironmentalOpen in IMG/M
3300009082Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015EnvironmentalOpen in IMG/M
3300009151Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaGEnvironmentalOpen in IMG/M
3300009160Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaGEnvironmentalOpen in IMG/M
3300009165Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009181Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaGEnvironmentalOpen in IMG/M
3300009183Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaGEnvironmentalOpen in IMG/M
3300009185Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaGEnvironmentalOpen in IMG/M
3300009187Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaGEnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010370Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNAEnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300012013Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface IceEnvironmentalOpen in IMG/M
3300013286Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23YEnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300017701Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.NEnvironmentalOpen in IMG/M
3300017716Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.DEnvironmentalOpen in IMG/M
3300017723Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.NEnvironmentalOpen in IMG/M
3300017747Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.NEnvironmentalOpen in IMG/M
3300017754Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.DEnvironmentalOpen in IMG/M
3300017761Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017766Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.DEnvironmentalOpen in IMG/M
3300017777Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017780Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300019783Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM110.S.NEnvironmentalOpen in IMG/M
3300020172Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1EnvironmentalOpen in IMG/M
3300020498Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020696Freshwater microbial communities from Trout Bog Lake, WI - 05NOV2007 epilimnionEnvironmentalOpen in IMG/M
3300020710Freshwater microbial communities from Trout Bog Lake, WI - 20SEP2008 epilimnionEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300022179Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.NEnvironmentalOpen in IMG/M
3300022190Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.NEnvironmentalOpen in IMG/M
3300022752Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BBEnvironmentalOpen in IMG/M
3300025387Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH20Aug07 (SPAdes)EnvironmentalOpen in IMG/M
3300025421Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul07 (SPAdes)EnvironmentalOpen in IMG/M
3300025470Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09 (SPAdes)EnvironmentalOpen in IMG/M
3300025598Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 (SPAdes)EnvironmentalOpen in IMG/M
3300025818Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026478Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8hEnvironmentalOpen in IMG/M
3300027337Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8dEnvironmentalOpen in IMG/M
3300027608Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027733Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027743Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027759Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027764Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027770Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027772Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027777Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027782Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027785Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027798Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027805Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300027963Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300028298Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_40mEnvironmentalOpen in IMG/M
3300028392Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2)EnvironmentalOpen in IMG/M
3300031578Soil microbial communities from Risofladan, Vaasa, Finland - TR-2EnvironmentalOpen in IMG/M
3300031669Soil microbial communities from Risofladan, Vaasa, Finland - TR-1EnvironmentalOpen in IMG/M
3300031885Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36EnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300032050Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300032562Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18017EnvironmentalOpen in IMG/M
3300032665Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18007EnvironmentalOpen in IMG/M
3300032675Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18015EnvironmentalOpen in IMG/M
3300033979Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003EnvironmentalOpen in IMG/M
3300034020Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055EnvironmentalOpen in IMG/M
3300034021Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057EnvironmentalOpen in IMG/M
3300034063Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053EnvironmentalOpen in IMG/M
3300034101Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107EnvironmentalOpen in IMG/M
3300034104Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120EnvironmentalOpen in IMG/M
3300034106Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131EnvironmentalOpen in IMG/M
3300034116Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOREnvironmentalOpen in IMG/M
3300034117Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124EnvironmentalOpen in IMG/M
3300034119Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
M3P_1014056013300000268LoticMEDNRLVPYSVHLKRDVYDKLKLAAGQRKASGLVRDAITMI
metazooDRAFT_138840743300002212LakeMATKRLIPYSVHLPEDIYEKLKKAAGDRKASALVRD
B570J40625_10154943213300002835FreshwaterMDKRLIPYSVHLPEEIYKKLKQAAGERKASALVRDAITLIIEGDDSFNG
JGI25909J50240_112640923300003393Freshwater LakeMEDNRLVPYSVHLKREVYDKLKLAAGQRKASALVRDAITMIVEGDDEFNG
Ga0007808_100565513300003943FreshwaterMDAGKRLIPYSVHLTPEIYEKLKEMAQQRKASSLVRDAITMIINGKGEFN
Ga0066599_10131055813300004282FreshwaterMETKRLIPYSVHLREDIHAQLRAVAKGRKAASMVRDAITMIVEGKGEF
Ga0049080_1016586613300005582Freshwater LenticMETKRLVPYSVHLREDIYLKLKAAAGQRKATALVRDAITLIVEGDDVFNGG
Ga0007876_116706123300006071FreshwaterMEASKRLIPYSVHLTPEIYDKLKELAQERKASKLVRDAITMILNGK
Ga0007862_102212313300006108FreshwaterMEKRLIPYSVHLPEPIYAKLKKAAGERKASALVRDAITMIIDGNDAYT
Ga0070749_1070491323300006802AqueousMEARMIPYSVHLREDIYLKLKEFAKDRKATALVRDAITMIVEGDDAF
Ga0070748_127137413300006920AqueousMEAKRLIPYSVHLREDIYIALKLAAKERKATSMVRDAITMI
Ga0105746_129584013300007973Estuary WaterMETKRLIPYSVHLREDIYHQLKDAAKGRKASGIVRDAITMI
Ga0114363_103250363300008266Freshwater, PlanktonMETKRLIPYSVHLPEDVYLKLKEAAGNRKASALVRDAITLIVEGDDEFNGG
Ga0114880_113608043300008450Freshwater LakeMEDNRLVPYSVHLKREVYDKLKLAAGQRNASALVRD
Ga0105093_1082318223300009037Freshwater SedimentMEAKRLIPYSVHLPEDVYLKLKEAAGNRKASALVRDAITLIVEGDDEFNGGYN
Ga0102864_105438343300009051EstuarineMETKRLIPYSVHLREDIYHQLKDAAKGRKASGIVRDAITMIIEGDDAF
Ga0105099_1042244333300009082Freshwater SedimentMEAKRLIPYSVHLPEDVYLKLKEAAGNRKASALVRDAITLIVEGD
Ga0114962_1035662533300009151Freshwater LakeMETKRLIPYSVHLSEDIFNQVKAAAKQRKASSLVRDAITMFLEGD
Ga0114981_1010863943300009160Freshwater LakeMETKRLVPYSVQLREDIYLKLKEAAGQRKATALVRDAITLIVEGDDVFNGG
Ga0105102_1008308013300009165Freshwater SedimentMEAKRLIPYSVHLPEDVYLKLKEAAGNRKASALVR
Ga0114969_1049771713300009181Freshwater LakeMETKKLIPYSVHLREDIYKKLKSAAGERKASSLVRDAITMIIEGDDEFNSGY
Ga0114974_1024104743300009183Freshwater LakeMADNRLVPYSVHLKRDVYDKLKLAAGERKASSLVRDAITLLIEGDDEFN
Ga0114971_1015513413300009185Freshwater LakeMEAKKLIPYSVHLREDIYLKLKTAAGDRKAAGMVRDA
Ga0114972_1028571313300009187Freshwater LakeMETKRLIPYSVHLSEDIFNQVKAAAKQRKASSLVRDAITMFLE
Ga0129333_10024693123300010354Freshwater To Marine Saline GradientMETRRLIPYSVHLPEHIYKKLKDAAGDRKASALVRDAIALILDGGDAY
Ga0129333_1075645833300010354Freshwater To Marine Saline GradientMIPYSVHLREDIYHKLREVAKDRKATALVRDAITMIIEGDD
Ga0129336_1028230233300010370Freshwater To Marine Saline GradientMDTKRLIPYSVHLPEDVYKKLKAAAGERKASSLVR
Ga0133913_1120114353300010885Freshwater LakeMETKRLIPYSVHLREDIYHQLKDAAKGRKASGIVRDAITMII
Ga0133913_1212098043300010885Freshwater LakeMADNRLVPYSVHLKRDVYDKLKLAAGERKASSLVRD
Ga0153805_105204933300012013Surface IceVETKRLIPYSVHLSEEVYLALKEKAKARQASSLVRD
Ga0136641_117430323300013286FreshwaterMEDNKLVPYSVHLERGIYDKLKIAAKNRKASALVRDAITMIIEGDDEFNGGYN
Ga0177922_1126103833300013372FreshwaterMETKRLIPYSVHLPEPIYKKLKAAAGERKASSLVRDAITMIVEGAPLYASGY
Ga0181364_100935313300017701Freshwater LakeMETKRLIPYSVHLPEPIYKKLKAAAGERKASALVRDAITMIVEGGPLY
Ga0181364_104778933300017701Freshwater LakeMEAKRLIPYSVHLREDIYNKLKLAAGERKASSMVRDAITMIIEGDDAYT
Ga0181350_114093623300017716Freshwater LakeMEKSKRLIPYSVHLREDIYKKLKAAAGDRKASGMV
Ga0181362_106012833300017723Freshwater LakeMEDNRLVPYSVHLKREVYDKLKLAAGQRKASALVRD
Ga0181362_109938823300017723Freshwater LakeMEDNRLVPYSVHLKREVYDKLKLAAGQRKASALVRDAITMIVEG
Ga0181352_113774333300017747Freshwater LakeMESKRLIPYSVHLREDIYLKLKEAAGNRKASGLVRDAITMILDGDDEF
Ga0181352_114257333300017747Freshwater LakeMETKRLVPYSVHLREDIYLKLKAAAGQRKATALVRDA
Ga0181344_106604413300017754Freshwater LakeMEKSKRLIPYSVHLREDIYKKLKAAAGERKASGMVRD
Ga0181344_112506413300017754Freshwater LakeMEKSKRLIPYSVHLREDIYKKLKAAAGDRKASGMVRDAITMIIEGDD
Ga0181344_118418113300017754Freshwater LakeMETKRLIPYSVHLPEDVYNKLKEAAGNRKASALVRDAITLI
Ga0181356_109486413300017761Freshwater LakeMEAKRLIPYSVHLREDIYNKLKLAAGERKASSMVRS
Ga0181356_117452913300017761Freshwater LakeMEDNRLVPYSVHLKREVYDKLKLAAGQRKASALVRDA
Ga0181343_108892133300017766Freshwater LakeMESTTLIPYSVHLRRDIHAKLKAAAGDRKAAGLVRDAI
Ga0181343_118194923300017766Freshwater LakeMEPERLIPYSVHLPKEVHAKLKEAAGNRKASALVR
Ga0181343_120247213300017766Freshwater LakeMEDNRLVPYSVHLKREVYDKLKLAAGQRKASALVRDAIT
Ga0181343_121163313300017766Freshwater LakeMETKRLIPYSVHLREDIYNKLKEAAEGRKASGMVRDAITMFLDGKDAF
Ga0181357_106084343300017777Freshwater LakeMETKRLIPYSVHLREDIYHQLKDAAKGRKASGIVRDAIT
Ga0181346_113445643300017780Freshwater LakeMEDNRLVPYSVHLKREVYDKLKLAAGQRKASALVRDAITMIVE
Ga0181355_133419713300017785Freshwater LakeMDKRLIPYSVHLPEEIYKKLKQAAGERKASALVRDAITLIIEGD
Ga0181355_134385823300017785Freshwater LakeMEDNHLIPYSVHLRKDIHAKLKAAAGDRKASGLVRDAITLIIEGDTQFDG
Ga0181361_11663713300019783Freshwater LakeMEAKRLIPYSVHLREDIYNKLKLAAGERKASSMVRD
Ga0211729_1017680613300020172FreshwaterVETKRLIPYSVHLSEEVYLALKEKAKARQASSLVRDAITMILE
Ga0208050_101331813300020498FreshwaterMEKRLIPYSVHLREDIYNKLKEAAGSRKASALVRD
Ga0214181_103799023300020696FreshwaterMETSKRLIPYSVHLTPQIYDKLKELAQERKASKLVRDAITMIINGKGDF
Ga0214198_102024213300020710FreshwaterMEASKRLIPYSVHLTPEIYEKLKELAQERKASKLVRDAITMIINGKGDF
Ga0222713_1075427213300021962Estuarine WaterMESKRLIPYSVHLREDIYLKLKEAAKDRKATALVRDAI
Ga0181353_108857013300022179Freshwater LakeMEKRLVPYSVHLREDIYNKLKEAAGSRKASALVRDA
Ga0181354_102144153300022190Freshwater LakeMEAKRLVPYSVHLREDIYLKLKEAAGQRKATALVRDAITLIIEGD
Ga0181354_112963433300022190Freshwater LakeMEDNHLIPYSVHLRKDIHAKLKAAAGDRKASGLVRDAITLIIEGL
Ga0214917_1012066343300022752FreshwaterMEAKRLIPYSVHLREDIYNKLKLAAGERKASSMVRDAITMIIEGDDA
Ga0207959_102491313300025387FreshwaterMDDRLIPYSVHLRRDIYDKLKEAAGQRKASSLVRDAITMIVEGD
Ga0207958_104742333300025421FreshwaterMDDRLIPYSVHLRRDIYDKLKEAAGDRKASALVRDAITMIIEGE
Ga0208389_103032043300025470FreshwaterMDDRLIPYSVHLRRDIYDKLKEAAGQRKASSLVRDA
Ga0208379_116128213300025598FreshwaterMETPKRLIPYSVHLPEEIYIKMKAAATERKASAMVRDAIVMMLEGDSVYNSGYRKGVRDSIN
Ga0208542_103947413300025818AqueousMEARRLIPYSVHLPEDIYKKLKAAAGERKASALVRDAISLILDGG
Ga0255156_106335113300026478FreshwaterMETKRLIPYSVHLPDDIYAKLKAAAGERKASALVRDAITMIVSGTTPFNSG
Ga0255087_105334933300027337FreshwaterMETRRLIPYSVHLPEHIYKKLKDAAGDRKASALVRDAIALILDGGDAYSS
Ga0208974_104513243300027608Freshwater LenticMEAKRLIPYSVHLREDIYTKLKAAAGERKASSMVRDAITMIIEGDDAYTS
Ga0209297_132400913300027733Freshwater LakeMETKRLIPYSVHLSEDIFNQVKAAAKQRKASSLVRDAIT
Ga0209593_1006082313300027743Freshwater SedimentMETKRLIPYSVHLPEDVYNKLKEAAGNRKASALVRDAITLIVEG
Ga0209296_114177843300027759Freshwater LakeMADNRLVPYSVHLKRDVYDKLKLAAGERKASSLVRDAITLLIEGDDEFNG
Ga0209134_1007407043300027764Freshwater LakeMETKRLIPYSVHLREDIYHQLKDAAKGRKASGIVRD
Ga0209134_1023685013300027764Freshwater LakeMEKSKRLIPYSVHLREDIYKKLKAAAGDRKASGMVRDAI
Ga0209086_1016746343300027770Freshwater LakeMETKRLVPYSVHLREDIYLKLKAAAGQRKATALVRDAITLIVEGD
Ga0209768_1008680213300027772Freshwater LakeMEAKRLIPYSVHLREDIYNKLKLAAGERKASSMVRDAITMIIEGDDAYTS
Ga0209829_1028877333300027777Freshwater LakeMESKRLIPYSVHLPEEIYKKLKAAAGERKASALVRDAITLIIEGDD
Ga0209500_1039750123300027782Freshwater LakeVETKRLIPYSVHLSEEVYLALKEKAKARQASSLVR
Ga0209246_1002131213300027785Freshwater LakeMEDNHLIPYSVHLRKDIHAKLKAAAGDRKASGLVRDAITLI
Ga0209353_1037957023300027798Freshwater LakeVETKRLIPYSVHLSEEVYLALKEKAKARQASSLVRDAITMILEGNDSFN
Ga0209229_1029519313300027805Freshwater And SedimentMEDNRLIPYSVHLKKDIYDKLKLAAGQRKASALVRDAITMIVE
Ga0209229_1033449833300027805Freshwater And SedimentMDTKRLIPYSVHLPADVYKKLKEAAGERKASSLVRDAITIILEGDDEFNGGD
Ga0209668_1108101623300027899Freshwater Lake SedimentMEKKRLVPYSVHLREDIYNALKAAAKGRKASSLVRDSIT
Ga0209400_134967113300027963Freshwater LakeMETKRLIPYSVHLREDIYHQLKDAAKGRKASGIVRDAITMIIEGD
Ga0268280_118878213300028298Saline WaterMETKRLIPYSVHLPEPIYKKLKAAAGERKASSLVRDAITM
Ga0304729_121632223300028392Freshwater LakeMETKRLIPYSVHLSEDIFNQVKAAAKQRKASSLVRDAITMFLEGDDAFKG
Ga0307376_1088262723300031578SoilMEKKRLIPYSVHLREDIYLKLKAAAGARKASSMVRDAI
Ga0307375_1047359613300031669SoilMEQARMIPYSVHLPEEVHKKLKEAAGHRKASALVRDAITLIVE
Ga0315285_1086123013300031885SedimentMEDNRLVPYSVHLKRDVYDKLKLAAGQRKASGLVRDA
Ga0315278_1166975713300031997SedimentMEDNRLVPYSVHLKREVYDKLKLAAGQRKASALVRDAITMIVEGDDEFNGG
Ga0315906_1136105413300032050FreshwaterMEDNRLVPYSVHLKREVYDKLKLAAGQRKASALVRDAITMIVEGDDEFN
Ga0315903_1098422033300032116FreshwaterMEKRLIPYSVHLREDIYIKLKEFAKDRKATALVRDA
Ga0316226_104872413300032562FreshwaterMEKKRLIPYSVHLREDIYDQLKEAAGERKAAGLVRDAITMIIE
Ga0316221_106767343300032665FreshwaterMDDRLIPYSVHLRRDIYDKLKEAAGQRKASSLVRDAITMIVEGDSQYM
Ga0316225_108778113300032675FreshwaterMEASKRLIPYSVHLTPEIYEKLKELAQERKASKLV
Ga0334978_0110375_1_1053300033979FreshwaterMEKRLVPYSVHLREDIYNKLKEAAGSRKASALVRD
Ga0335002_0653036_400_5343300034020FreshwaterMEKRLVPYSVHLREDIYNKLKEAAGSRKASALVRDAITMIIEGDD
Ga0335004_0613636_439_5733300034021FreshwaterMEDNRLVPYSVHLKREVYDKLKLAAGQRKASALVRDAITMIVEGD
Ga0335000_0603639_1_1323300034063FreshwaterMETKRLIPYSVHLSEEVYLALKEKAKARQASSLVRDAITMILEG
Ga0335027_0689933_3_1583300034101FreshwaterMETKRLIPYSVHLSEEVYLALKEKAKARQASSLVRDAITMILEGNDSFNSGY
Ga0335031_0264759_1_1593300034104FreshwaterMETKRLIPYSVHLPEPIYKKLKAAAGERKASSLVRDAITMIVEGGPLYASGYN
Ga0335031_0807056_1_1173300034104FreshwaterMDKRLIPYSVHLPEEIYKKLKQAAGERKASALVRDAITL
Ga0335036_0009431_1_1443300034106FreshwaterMDKRLIPYSVHLPEEIYKKLKQAAGERKASALVRDAITLIIEGDDSFN
Ga0335036_0820204_3_1373300034106FreshwaterMETTKRLIPYSVHLREDIYLKLKAAAKDRKATALVRDAITMIIEG
Ga0335068_0323510_1_1353300034116FreshwaterMETKRLIPYSVHLSEEVYLALKEKAKARQASSLVRDAITMILEGN
Ga0335033_0386612_3_1163300034117FreshwaterMEAKRLIPYSVHLPEDVYLKLKEAAGNRKASALVRDAI
Ga0335033_0510243_15_1463300034117FreshwaterMETKRLIPYSVHLREDIYHQLKDAAKGRKASGIVRDAITMIIE
Ga0335054_0634458_471_5813300034119FreshwaterMETKRLIPYSVHLSEEVYLALKEKAKARQASSLVRDA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.