Metagenome Family F088246

Overview

Basic Information

• Family ID: F088246
• Family Type: Metagenome
• Number of Sequences: 109
• Average Sequence Length: 42 residues
• Representative Sequence: MKTQCLQTNETQHCLGKESALGAGGGVERVALIKSLIYAR
• Number of Associated Samples: 4
• Number of Associated Scaffolds: 109

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 4.72 %
• % of genes near scaffold ends (potentially truncated): 16.51 %
• % of genes from short scaffolds (< 2000 bps): 50.46 %
• Associated GOLD sequencing projects: 4
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.31

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (93.578 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton (93.578 % of family members)
• Environment Ontology (ENVO): Unclassified (93.578 % of family members)
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Water (non-saline) (94.495 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 42.65%
  β-sheet: 0.00%
  Coil/Unstructured: 57.35%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 109 Family Scaffolds
PF00665	rve	0.92
PF01531	Glyco_transf_11	0.92
PF00858	ASC	0.92
PF12832	MFS_1_like	0.92

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 109 Family Scaffolds
COG2801	Transposase InsO and inactivated derivatives	Mobilome: prophages, transposons [X]	0.92
COG2826	Transposase and inactivated derivatives, IS30 family	Mobilome: prophages, transposons [X]	0.92
COG3316	Transposase (or an inactivated derivative), DDE domain	Mobilome: prophages, transposons [X]	0.92
COG4584	Transposase	Mobilome: prophages, transposons [X]	0.92

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.58 %
All Organisms	root	All Organisms	6.42 %

Level 2

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.58 %
cellular organisms	root	All Organisms → cellular organisms	6.42 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.58 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	6.42 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.58 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	6.42 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.58 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	5.50 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.58 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	5.50 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.58 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	5.50 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.58 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	5.50 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.58 %
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	5.50 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.58 %
Panarthropoda	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda	5.50 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.58 %
Arthropoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	5.50 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.58 %
Mandibulata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata	5.50 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.58 %
Pancrustacea	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea	5.50 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.58 %
Crustacea	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea	5.50 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.58 %
Multicrustacea	superclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea	4.59 %
Branchiopoda	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda	0.92 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.58 %
Hexanauplia	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia	4.59 %
Phyllopoda	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda	0.92 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.58 %
Copepoda	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda	4.59 %
Diplostraca	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca	0.92 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.58 %
Neocopepoda	infraclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda	4.59 %
Cladocera	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera	0.92 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.58 %
Podoplea	superorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea	1.83 %
Anomopoda	infraorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda	0.92 %
Gymnoplea	superorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea	0.92 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.58 %
Podoplea	superorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea	1.83 %
Daphniidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae	0.92 %
Calanoida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida	0.92 %

Level 21

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.58 %
Podoplea	superorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea	1.83 %
Temoridae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae	0.92 %
Daphnia	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia	0.92 %

Level 22

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.58 %
Podoplea	superorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea	1.83 %
Eurytemora	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora	0.92 %
Daphnia pulex	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex	0.92 %

Level 23

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.58 %
Podoplea	superorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea	1.83 %
Eurytemora affinis	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis	0.92 %
Daphnia pulex	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex	0.92 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300005528|Ga0068872_10588481	Not Available	591
3300008106|Ga0114339_1205929	Not Available	648
3300008106|Ga0114339_1228509	Not Available	599
3300008106|Ga0114339_1288413	Not Available	502
3300008121|Ga0114356_1002546	Not Available	13496
3300008121|Ga0114356_1002748	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea	13587
3300008121|Ga0114356_1002938	All Organisms → cellular organisms → Eukaryota → Opisthokonta	8977
3300008121|Ga0114356_1003237	Not Available	9448
3300008121|Ga0114356_1006108	Not Available	7349
3300008121|Ga0114356_1006172	Not Available	9889
3300008121|Ga0114356_1007404	Not Available	6964
3300008121|Ga0114356_1007706	Not Available	7336
3300008121|Ga0114356_1007870	Not Available	10573
3300008121|Ga0114356_1010412	Not Available	6293
3300008121|Ga0114356_1011507	Not Available	6665
3300008121|Ga0114356_1014110	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda	9035
3300008121|Ga0114356_1015664	Not Available	5525
3300008121|Ga0114356_1016724	Not Available	9469
3300008121|Ga0114356_1016726	Not Available	5399
3300008121|Ga0114356_1018011	Not Available	5261
3300008121|Ga0114356_1023189	Not Available	4812
3300008121|Ga0114356_1025562	Not Available	4640
3300008121|Ga0114356_1030016	Not Available	4365
3300008121|Ga0114356_1032748	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda	4217
3300008121|Ga0114356_1037177	Not Available	4561
3300008121|Ga0114356_1040808	Not Available	3848
3300008121|Ga0114356_1043408	Not Available	3745
3300008121|Ga0114356_1047525	Not Available	5982
3300008121|Ga0114356_1052554	Not Available	4228
3300008121|Ga0114356_1052812	Not Available	3427
3300008121|Ga0114356_1053842	Not Available	3396
3300008121|Ga0114356_1056928	Not Available	3308
3300008121|Ga0114356_1061154	Not Available	3197
3300008121|Ga0114356_1062824	Not Available	3696
3300008121|Ga0114356_1064148	Not Available	3123
3300008121|Ga0114356_1068771	Not Available	4141
3300008121|Ga0114356_1070862	Not Available	2969
3300008121|Ga0114356_1079632	Not Available	2788
3300008121|Ga0114356_1082651	Not Available	2732
3300008121|Ga0114356_1088067	Not Available	3873
3300008121|Ga0114356_1092081	Not Available	2573
3300008121|Ga0114356_1093281	Not Available	3947
3300008121|Ga0114356_1099431	Not Available	2460
3300008121|Ga0114356_1099594	Not Available	2458
3300008121|Ga0114356_1105767	Not Available	3721
3300008121|Ga0114356_1106759	Not Available	4594
3300008121|Ga0114356_1113818	Not Available	2264
3300008121|Ga0114356_1120629	Not Available	2182
3300008121|Ga0114356_1121404	Not Available	2173
3300008121|Ga0114356_1122794	Not Available	3239
3300008121|Ga0114356_1123352	Not Available	2572
3300008121|Ga0114356_1125687	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea	2124
3300008121|Ga0114356_1143054	Not Available	2643
3300008121|Ga0114356_1146245	Not Available	1915
3300008121|Ga0114356_1147993	Not Available	1900
3300008121|Ga0114356_1153014	Not Available	1855
3300008121|Ga0114356_1156687	Not Available	1822
3300008121|Ga0114356_1162303	Not Available	1775
3300008121|Ga0114356_1165008	Not Available	1752
3300008121|Ga0114356_1167825	Not Available	1730
3300008121|Ga0114356_1170503	Not Available	1709
3300008121|Ga0114356_1173654	Not Available	1685
3300008121|Ga0114356_1178636	Not Available	1649
3300008121|Ga0114356_1179970	Not Available	1639
3300008121|Ga0114356_1183006	Not Available	1618
3300008121|Ga0114356_1183648	Not Available	1614
3300008121|Ga0114356_1190267	Not Available	1569
3300008121|Ga0114356_1194309	Not Available	1543
3300008121|Ga0114356_1196548	Not Available	3240
3300008121|Ga0114356_1202481	Not Available	1491
3300008121|Ga0114356_1202499	Not Available	1491
3300008121|Ga0114356_1221129	Not Available	1382
3300008121|Ga0114356_1226068	Not Available	2353
3300008121|Ga0114356_1234317	Not Available	1313
3300008121|Ga0114356_1253935	Not Available	1221
3300008121|Ga0114356_1263918	Not Available	1177
3300008121|Ga0114356_1264497	Not Available	1175
3300008121|Ga0114356_1277185	Not Available	1124
3300008121|Ga0114356_1296028	Not Available	1579
3300008121|Ga0114356_1352655	Not Available	879
3300008121|Ga0114356_1359567	Not Available	1164
3300008121|Ga0114356_1372234	Not Available	829
3300008121|Ga0114356_1383214	Not Available	804
3300008121|Ga0114356_1396957	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex	773
3300008121|Ga0114356_1399673	Not Available	768
3300008121|Ga0114356_1417643	Not Available	730
3300008121|Ga0114356_1418225	Not Available	729
3300008121|Ga0114356_1426106	Not Available	714
3300008121|Ga0114356_1428018	Not Available	710
3300008121|Ga0114356_1462518	Not Available	649
3300008121|Ga0114356_1467231	Not Available	642
3300008121|Ga0114356_1479267	Not Available	623
3300008121|Ga0114356_1480627	Not Available	621
3300008121|Ga0114356_1485778	Not Available	613
3300008121|Ga0114356_1496410	Not Available	597
3300008121|Ga0114356_1496418	Not Available	597
3300008121|Ga0114356_1508829	Not Available	579
3300008121|Ga0114356_1515484	Not Available	570
3300008121|Ga0114356_1552182	Not Available	523
3300008121|Ga0114356_1557059	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis	518
3300028027|Ga0247722_10052449	Not Available	1577
3300028027|Ga0247722_10156589	Not Available	819
3300028027|Ga0247722_10221780	Not Available	661
3300028027|Ga0247722_10242022	Not Available	627
3300028027|Ga0247722_10265604	Not Available	593
3300028027|Ga0247722_10321631	Not Available	526

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	100.00%

Class

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	94.50%
Terrestrial	Environmental → Terrestrial	5.50%

Category

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	94.50%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	5.50%

Type

Habitat	Taxonomy	Distribution
Lake	Environmental → Aquatic → Freshwater → Lake	93.58%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	5.50%
Lentic	Environmental → Aquatic → Freshwater → Lentic	0.92%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	93.58%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	5.50%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	0.92%

Habitat

Habitat	Taxonomy	Distribution
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	93.58%
Deep Subsurface Sediment	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment	5.50%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	0.92%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300005528	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG	Environmental
3300008106	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-53-LTR	Environmental
3300008121	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-100-LTR	Environmental
3300028027	Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 3H_FC	Environmental

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0068872_105884813	3300005528	Freshwater Lake	MKTQCLQTNEIQHCLGKESALGAGGGVERVALIKSLIYAR*
Ga0114339_12059291	3300008106	Freshwater, Plankton	IYVETDCLQTNKTQHYLGKENA*EAGGVEERVGVN*
Ga0114339_12285091	3300008106	Freshwater, Plankton	MKTQCLQTNETQHCLGKESALGERGGVERVALIKSLIYVR*
Ga0114339_12884132	3300008106	Freshwater, Plankton	LQTNEAQHCLVKESAGEAGGGVERVALIKSLIYAR*
Ga0114356_10025461	3300008121	Freshwater, Plankton	MKTQCLQTSETQHCLGKESALGVGGGVERVALIKSLIYVREKECA*
Ga0114356_10027486	3300008121	Freshwater, Plankton	MKTQCLQTNETQHCLGKESALGAGGGVERVALIKSLIYAR*
Ga0114356_10029387	3300008121	Freshwater, Plankton	MKTQCLPSNEMQHCLGKESALGAGGGVERIALIKSLIYARKKECA*
Ga0114356_10032374	3300008121	Freshwater, Plankton	MKTHCLQTTEMQDCLGKESALGARGGVERVALIKSLIYARWKRCA*
Ga0114356_10061081	3300008121	Freshwater, Plankton	MKTQCLQTNEKQHCFGKESALGARGGVERDALIKSLIYVR*
Ga0114356_10061724	3300008121	Freshwater, Plankton	MYMKTQCLQANETQHCLGKESALGAGGGVERVALIKSLIYTR*
Ga0114356_10074043	3300008121	Freshwater, Plankton	MKTLCLQTNEIQHCLEKESA*GVGGGVERVALIKSLIYAR*
Ga0114356_10077061	3300008121	Freshwater, Plankton	MKTQCLQTNETQHCSGKKSALEARGGVERDALIKSLIYSR*
Ga0114356_10078702	3300008121	Freshwater, Plankton	MKKQCLQTNETQHCLGKESALGAGGGVERVVLIKSLIYAR*
Ga0114356_10104123	3300008121	Freshwater, Plankton	MKTQCLQTNEMQHCLGKERALGAGGGVERVALIKSSIYVR*
Ga0114356_10115071	3300008121	Freshwater, Plankton	MKTQCLQTNETQYCLGKESALGARGGVERVALIKSLIYAR*
Ga0114356_10141103	3300008121	Freshwater, Plankton	MKTQCLQTNETQHCLGKESAREAGGGVERVVLTKSLIYVR*
Ga0114356_10156643	3300008121	Freshwater, Plankton	MKTKCLQTNGMQHCLGKESALGAERVALIKSLIYARKKERT*
Ga0114356_10167242	3300008121	Freshwater, Plankton	MKTQCLQTNEMRHCFGKVSALGSRGGVERDALIKSLIYAR*
Ga0114356_10167263	3300008121	Freshwater, Plankton	MKTQCLQTNGMQDCLGKESAFGAGSVALIKSLIYARKKERA*
Ga0114356_10180111	3300008121	Freshwater, Plankton	MKTQCLQTNETQHCLGRESALGAGGGVERVGLIKSLMGGFHL*
Ga0114356_10231892	3300008121	Freshwater, Plankton	MKTKCLQINETQHCLGKESAPEAGGGVERVVLIKNLIYAR*
Ga0114356_10233091	3300008121	Freshwater, Plankton	MWHCFGKESALGAGGGVESVALIKSLIYARKKGRA*
Ga0114356_10255624	3300008121	Freshwater, Plankton	MKTQCLQTNEMQHCLGKESAIGAGGGVERVALIKSLIYVK*
Ga0114356_10300164	3300008121	Freshwater, Plankton	MKTQCLQTKEMQHCLGKESALGVGGEVERVALIKSLIL*
Ga0114356_10327481	3300008121	Freshwater, Plankton	MKTQCLQTNETQYCLGKERALGARGGVERVALIKSLIYA*
Ga0114356_10362016	3300008121	Freshwater, Plankton	MLWYHTYTETQCLQTNEMQHCLGKESALGAEGGVERVALIKSLIYSRKKE*
Ga0114356_10371771	3300008121	Freshwater, Plankton	METQCLQTNEAQHCLGKESALGAIGGGESVALIKSLI*
Ga0114356_10408083	3300008121	Freshwater, Plankton	MKKQCLQTNETQHCLGKESALGVGGGVERVVLIKSLIYTR*
Ga0114356_10434083	3300008121	Freshwater, Plankton	MKAQCLQTNETQHCLVKESALGAGGGVERVAVIKSLIHTR*
Ga0114356_10475254	3300008121	Freshwater, Plankton	MKTQCLQPNETQHCFGKESALGERGGVERVALIKSLIYTRGKEHA*
Ga0114356_10525542	3300008121	Freshwater, Plankton	MKTQCLQTNETYHCLGKESALGARGGVERVALIKSLIYSRWKERA*
Ga0114356_10528121	3300008121	Freshwater, Plankton	MKTQCLQTNEAWHCLGKESALGARGGVERDALIKSLIYAR*
Ga0114356_10538421	3300008121	Freshwater, Plankton	MKTQCSQTNEMQHCLGKESALGAGGGVERVALIKSLFDARYKERA*
Ga0114356_10569282	3300008121	Freshwater, Plankton	MKTQRLQTNETQHCLGKESAREAGGGVERVALIKSLIYGR*
Ga0114356_10611541	3300008121	Freshwater, Plankton	MKTQCLQTNEMQHCFGNESALGARGGVERDALIKSLIYARRKEYA*
Ga0114356_10628245	3300008121	Freshwater, Plankton	MKTKCLQTNEKQHCMGKESALGARGGVERVALIKSLIYARKKECA*
Ga0114356_10641482	3300008121	Freshwater, Plankton	MKTQCLQTNEIQHCLGKESALEVRGGVERVTLIKSLIYTRWKECP*
Ga0114356_10687713	3300008121	Freshwater, Plankton	MKTQCLQTNEMQHYLGKENALGVGGGVERVALIKSLI*
Ga0114356_10708622	3300008121	Freshwater, Plankton	MKTQCLQTNEMQHCLGKESALGEGGGVERVALIKSLRRRVAKFF*
Ga0114356_10796323	3300008121	Freshwater, Plankton	MKTQCLQTNETQHCLGKESALGVGEGVERVGLIKSLIYAR
Ga0114356_10826513	3300008121	Freshwater, Plankton	MKTQCLQTNETQHCLEKESALGAGGGVERVALIKSLIYAR*
Ga0114356_10880673	3300008121	Freshwater, Plankton	MKTQCLQTNETQHCLGKESALGAKGGVKRVALIKSLIYARRKEHA*
Ga0114356_10920811	3300008121	Freshwater, Plankton	FDTHIYMKTQCLQTNETQHCLGKESALGVGGGVERVALIKSLIYVR*
Ga0114356_10932811	3300008121	Freshwater, Plankton	MKTQCFQTNEMQHCLGKESALGAGGGVERVVLIKSLIYARKKE
Ga0114356_10994311	3300008121	Freshwater, Plankton	MKTNEMQHCLGKESALGSGVGVERLALMKSLIYAR*
Ga0114356_10995945	3300008121	Freshwater, Plankton	TINMKTLCLQTNEMQHCLGKESALGARGGVERVALIKSSIYAREV*
Ga0114356_11057673	3300008121	Freshwater, Plankton	MKTQCLQTNEIQHCLGEESALGAGGGVERVALIKSLIYAR*
Ga0114356_11067591	3300008121	Freshwater, Plankton	MKTQCLQTNEMQHNVIVLGKKSALGARGGVDRGALIKV*
Ga0114356_11138183	3300008121	Freshwater, Plankton	MKTQCLQTNVTQHCLGKESALGAGGGVERVALIKSLIYAREKERA*
Ga0114356_11206291	3300008121	Freshwater, Plankton	MRTQCLQTKETQHCLEKESALGAGGGGERVALIKSLI*
Ga0114356_11214041	3300008121	Freshwater, Plankton	MKTQCLQTNETQHCLGKESALGAGGGVERVALIKSLIYARKKERA*
Ga0114356_11227941	3300008121	Freshwater, Plankton	MKTKFLQTNEAHHCLGKESALGAGGGVERVALIKSLIYAR*
Ga0114356_11233523	3300008121	Freshwater, Plankton	MKTQCLQTNEMQHCLGKESSLGAGRGVERVALIKSLIYAR*
Ga0114356_11256871	3300008121	Freshwater, Plankton	MKTQCLQTNENQHCLGKESALGERGGVERVALIKSLMYERLKERA*
Ga0114356_11430542	3300008121	Freshwater, Plankton	MKTQCLQTNGTQHCLGKESALGAGRVALIKSLIYARKKERA*
Ga0114356_11462451	3300008121	Freshwater, Plankton	MKTQCLQTNETQHYLGKESALEAGGGVERVALIKSLI*
Ga0114356_11479931	3300008121	Freshwater, Plankton	MKTQCLQTNETQHCFGKESALGAGGGVEIVALIKSLIYARRKERA*
Ga0114356_11530143	3300008121	Freshwater, Plankton	CLQTNETQHYAIMGKENALEAGGWSRERVALIKS*
Ga0114356_11566871	3300008121	Freshwater, Plankton	MKTQCSQTNEMQHCLGKESALGARGGEERDALIKSLIYAR*
Ga0114356_11623032	3300008121	Freshwater, Plankton	MKKQCLQTNEMQHCLGKESAVGAGGGVERVALIKSLIYAR*
Ga0114356_11650081	3300008121	Freshwater, Plankton	MLWYNFFIKTQCLQTNETQHCLGKESALGAGGGVERVALIKSLIYAR*
Ga0114356_11678251	3300008121	Freshwater, Plankton	MKTQCLLANETQHCLGKESVLGAGGGVERVALIKSLIYMR*
Ga0114356_11705031	3300008121	Freshwater, Plankton	VKTQCLQTNETQHYLGKESALGAGGGVERVALIKSLINAR
Ga0114356_11736541	3300008121	Freshwater, Plankton	MKTQCLQTNETQHCLGKESALGVRGGVAQVALIKSLIYARWKERA*
Ga0114356_11786362	3300008121	Freshwater, Plankton	MKTQCLKTKETQHCLGKESALGAIGGGESVALIKSLI*
Ga0114356_11799701	3300008121	Freshwater, Plankton	MKTQCLQTNVTQHCLGKESALGALGGVERVELMKSLIYVR*
Ga0114356_11830061	3300008121	Freshwater, Plankton	MLRTTIYMKTQCLQTNETQHCLGKESALGSGGGVEKVALIKSLIYAR*
Ga0114356_11836481	3300008121	Freshwater, Plankton	MKTQCLQTNEMQHCLGKESALGVGGVVERVALIKSLIYAR*
Ga0114356_11902671	3300008121	Freshwater, Plankton	MKTQCLQTNETQHCLGKESALGAGGGVERVALIKSLIYVR*
Ga0114356_11943091	3300008121	Freshwater, Plankton	MKTQCLQTNEMQHCLEKESALGAGGGVERVALIKSLIYAR*
Ga0114356_11965481	3300008121	Freshwater, Plankton	MKTQCLQTNEMQHCLGRESALGVGGGVERVEIIKSLIYAR*
Ga0114356_12024812	3300008121	Freshwater, Plankton	MKTEYLQRNEMQHCFGKESAREVGGGVERVALIKSLICAR*
Ga0114356_12024991	3300008121	Freshwater, Plankton	MKIKSFDTTIYMKTYCLQTNETQHCLGKESAREARGGVERVALIKSLIYVREKECA*
Ga0114356_12156562	3300008121	Freshwater, Plankton	QTNETRHCFGKESALGAGGGVESVALIKSLIYARKKERA*
Ga0114356_12211291	3300008121	Freshwater, Plankton	MKTQCLQKNETQHCLGKESALGAGGGVERVALIKSFIYAR*
Ga0114356_12260681	3300008121	Freshwater, Plankton	MKTQFLQTNETQHCLGKESALGARGGVERVALIKSLIYAR*
Ga0114356_12343171	3300008121	Freshwater, Plankton	IYMKTQCLQTNETQHCFGKESALGARGGVERDALIKSLIYAR*
Ga0114356_12539351	3300008121	Freshwater, Plankton	MKTQCLQTNETQHCLGKESALGAGEGVERVVLFKSLIYAR*
Ga0114356_12639181	3300008121	Freshwater, Plankton	MKTQCLQTNETQHCFGKESALGARGGVERDALIKS
Ga0114356_12644972	3300008121	Freshwater, Plankton	MQTQCLQTNETQHCLGMENALGAGGEVERVALIKSLIYA*
Ga0114356_12771852	3300008121	Freshwater, Plankton	MKTQCLQTNETQHCLGKESALGLGEGVERVGLIKSLIYAR*
Ga0114356_12960282	3300008121	Freshwater, Plankton	MKTQCLQTNEMQHCLGKENALGAGGGVDSVALIKSLIYVRKKECA*
Ga0114356_13526551	3300008121	Freshwater, Plankton	MKTQCLQTNETQHCLGKESALGAGGGVERVALIKSLIYARKKEPA*
Ga0114356_13595671	3300008121	Freshwater, Plankton	MKTQCLQTNEMQHCLGKESALGARGGLERVALIKSLIYTRWKERA*
Ga0114356_13722341	3300008121	Freshwater, Plankton	MKTQCLQTNETQHCLGKDSAVVAGGGVERVALIKSLIYTRKKERN*
Ga0114356_13832141	3300008121	Freshwater, Plankton	MKTQYLQTNEMQHLLGKESALGARGGVERDALIKSLIYAR
Ga0114356_13969572	3300008121	Freshwater, Plankton	MHCTAIYMKTQCLQTNETQHVSGKESALGAIGGGESLALIKSLI*
Ga0114356_13996731	3300008121	Freshwater, Plankton	FGTTIYMKTQCLQTNEMQHCLGKESALGVGGGVERVVLIKSLIYAR*
Ga0114356_14176431	3300008121	Freshwater, Plankton	MKTQCLQANETQHCLGKENALGARGGVEREALIKSLIY
Ga0114356_14182251	3300008121	Freshwater, Plankton	MKTQCLQTNETQHCLGKESASGAIGGVERDALIKSLIYAR*
Ga0114356_14261062	3300008121	Freshwater, Plankton	MKTQCLQTNETQHCLEKESALVSGGGVERVALIKSLIYARRKELA*
Ga0114356_14280181	3300008121	Freshwater, Plankton	MKTQCLQTNETQHCLGKESALGAGGGLEGVVLIKSLIFAR*
Ga0114356_14625181	3300008121	Freshwater, Plankton	MKTQCLQTNESQHCLGKESALGAGGVQRAALIKSLIYTRQKEHA*
Ga0114356_14672311	3300008121	Freshwater, Plankton	MKTQCLQTNETQYCLGKESALEVGGGVERVALIKSLIYVR*
Ga0114356_14792671	3300008121	Freshwater, Plankton	MKTQCLHTNETQHCLGKESALGAGEGVERVALIKSLIYARKEDNA*
Ga0114356_14806271	3300008121	Freshwater, Plankton	MKTLCLQTNEMQHCLGKESALGAGGGVERVALIKSLI*
Ga0114356_14857781	3300008121	Freshwater, Plankton	NKCFCTTIYMKTHCLQTNKMQHCLGKESALGEGGGVERVVLIKSLIYVR*KECA*
Ga0114356_14964101	3300008121	Freshwater, Plankton	MKTQCLQTNETPHCLGKESALVAVGGVERVALIKNLIYSR*
Ga0114356_14964181	3300008121	Freshwater, Plankton	MKIQCLQTNEMKHCFGNESALGAGGGVERVALIKSLIYARKNEHD*
Ga0114356_15088291	3300008121	Freshwater, Plankton	IYMKTQCLQTNEMQHCLGKESALGAGGGVERVALIKSLIYA*
Ga0114356_15154842	3300008121	Freshwater, Plankton	MKTQCLQTNETQYCFGKESALGARGGVERDALIKSLIYVR
Ga0114356_15521821	3300008121	Freshwater, Plankton	IGTSIYIKTQCLQTNETQHCLRKESALGAGGGVERVALIKSLIYAR*
Ga0114356_15570591	3300008121	Freshwater, Plankton	MKTQCLQTNEIQHYLGKENAFGVGGRVERVALIKSL
Ga0247722_100524491	3300028027	Deep Subsurface Sediment	MKTQCLQTNETQHCLGQESALGVGGGVERVALIKSLIYAR
Ga0247722_101565891	3300028027	Deep Subsurface Sediment	MKTQCLQTNETQHYLGKENALGAGGGVKRVALNKSLI
Ga0247722_102217801	3300028027	Deep Subsurface Sediment	MKTQCLQTNEMQHCLGKESALGAGGGVESLALIKSLIYAR
Ga0247722_102420221	3300028027	Deep Subsurface Sediment	MRLYTCTAIYMKTQCLQTNEMQHCLGKENALGARGGVERVALIKSLI
Ga0247722_102656041	3300028027	Deep Subsurface Sediment	MKTQYLQTNEMQHCLGKENALGARGGGESVELIKSLI
Ga0247722_103216311	3300028027	Deep Subsurface Sediment	MKTQCLQTNEMQHCLGKESALEARGGVEREALIKSLI