NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F088148

Metagenome / Metatranscriptome Family F088148

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F088148
Family Type Metagenome / Metatranscriptome
Number of Sequences 109
Average Sequence Length 49 residues
Representative Sequence NCRQLTQNNGAEFLLFLKANQPLALAKAEQLLPGKLPPSGQHAGQRPRTH
Number of Associated Samples 98
Number of Associated Scaffolds 109

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.08 %
% of genes from short scaffolds (< 2000 bps) 96.33 %
Associated GOLD sequencing projects 96
AlphaFold2 3D model prediction Yes
3D model pTM-score0.30

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (84.404 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil
(9.174 % of family members)
Environment Ontology (ENVO) Unclassified
(26.606 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(28.440 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 26.92%    β-sheet: 0.00%    Coil/Unstructured: 73.08%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.30
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 109 Family Scaffolds
PF01609DDE_Tnp_1 2.75
PF13701DDE_Tnp_1_4 0.92
PF06968BATS 0.92
PF13808DDE_Tnp_1_assoc 0.92

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 109 Family Scaffolds
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 2.75
COG3293TransposaseMobilome: prophages, transposons [X] 2.75
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 2.75
COG5421TransposaseMobilome: prophages, transposons [X] 2.75
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 2.75
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 2.75


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms84.40 %
UnclassifiedrootN/A15.60 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908038|B3_all_c_ConsensusfromContig116760All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11629Open in IMG/M
3300000955|JGI1027J12803_109459418Not Available543Open in IMG/M
3300001213|JGIcombinedJ13530_107123621All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11956Open in IMG/M
3300005172|Ga0066683_10311634All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11978Open in IMG/M
3300005180|Ga0066685_10612920All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300005186|Ga0066676_10612389All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11738Open in IMG/M
3300005454|Ga0066687_10555333All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11681Open in IMG/M
3300005836|Ga0074470_10709619All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11689Open in IMG/M
3300005896|Ga0075282_1056919All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11572Open in IMG/M
3300005897|Ga0075281_1048169All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11663Open in IMG/M
3300005900|Ga0075272_1069763All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11659Open in IMG/M
3300009091|Ga0102851_11638217All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11721Open in IMG/M
3300009091|Ga0102851_11750841All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11699Open in IMG/M
3300009091|Ga0102851_12048762All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11649Open in IMG/M
3300009131|Ga0115027_11019751All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300009179|Ga0115028_11163120All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300009179|Ga0115028_11194306All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11626Open in IMG/M
3300009618|Ga0116127_1035869All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Thermales → Thermaceae → Oceanithermus → Oceanithermus profundus1494Open in IMG/M
3300009631|Ga0116115_1089570All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11792Open in IMG/M
3300009644|Ga0116121_1092739All Organisms → cellular organisms → Bacteria945Open in IMG/M
3300009762|Ga0116130_1020387All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Thermales → Thermaceae → Oceanithermus → Oceanithermus profundus2213Open in IMG/M
3300010366|Ga0126379_11356983All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11817Open in IMG/M
3300011269|Ga0137392_10847182All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11754Open in IMG/M
3300012359|Ga0137385_10851136All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11756Open in IMG/M
3300012931|Ga0153915_12301145All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11631Open in IMG/M
3300013297|Ga0157378_10756052All Organisms → cellular organisms → Bacteria995Open in IMG/M
3300014165|Ga0181523_10283490All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11939Open in IMG/M
3300014167|Ga0181528_10222558Not Available1018Open in IMG/M
3300014319|Ga0075348_1027673All Organisms → cellular organisms → Bacteria1216Open in IMG/M
3300014491|Ga0182014_10314032Not Available801Open in IMG/M
3300014496|Ga0182011_11020564All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11512Open in IMG/M
3300014498|Ga0182019_10060439All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium2220Open in IMG/M
3300014498|Ga0182019_10869905All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11648Open in IMG/M
3300016730|Ga0181515_1343823Not Available1169Open in IMG/M
3300017654|Ga0134069_1203269All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11677Open in IMG/M
3300017941|Ga0187850_10198399Not Available920Open in IMG/M
3300017941|Ga0187850_10345858All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11654Open in IMG/M
3300017972|Ga0187781_10375559All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_111014Open in IMG/M
3300017973|Ga0187780_11476001All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300017998|Ga0187870_1164014All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11803Open in IMG/M
3300017999|Ga0187767_10308515All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11543Open in IMG/M
3300018021|Ga0187882_1136486Not Available1009Open in IMG/M
3300018035|Ga0187875_10778733All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300018046|Ga0187851_10495344All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11694Open in IMG/M
3300018047|Ga0187859_10261567All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11931Open in IMG/M
3300018057|Ga0187858_10423626All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11824Open in IMG/M
3300018090|Ga0187770_11471810All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11554Open in IMG/M
3300019230|Ga0181501_1248713All Organisms → cellular organisms → Bacteria821Open in IMG/M
3300019787|Ga0182031_1154615Not Available848Open in IMG/M
3300019787|Ga0182031_1202179Not Available722Open in IMG/M
3300021322|Ga0210330_1155126All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300021560|Ga0126371_13556763All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11526Open in IMG/M
3300021605|Ga0194054_10189585All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11690Open in IMG/M
3300023311|Ga0256681_11919168All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11983Open in IMG/M
3300025326|Ga0209342_10706820All Organisms → cellular organisms → Bacteria → Proteobacteria806Open in IMG/M
3300025446|Ga0208038_1010661All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Thermales → Thermaceae → Oceanithermus → Oceanithermus profundus2702Open in IMG/M
3300025852|Ga0209124_10240423All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11701Open in IMG/M
3300025922|Ga0207646_10715213All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11895Open in IMG/M
3300025943|Ga0210125_1046008All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11677Open in IMG/M
3300025948|Ga0210088_1031424All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11813Open in IMG/M
3300026896|Ga0207730_1010764All Organisms → cellular organisms → Bacteria790Open in IMG/M
3300026945|Ga0207743_1013646All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11856Open in IMG/M
3300027330|Ga0207777_1060261All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300027330|Ga0207777_1098814Not Available503Open in IMG/M
3300027743|Ga0209593_10321792All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300027890|Ga0209496_10719310All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11547Open in IMG/M
3300027896|Ga0209777_10623710All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11777Open in IMG/M
3300027903|Ga0209488_10809174All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11663Open in IMG/M
(restricted) 3300028043|Ga0233417_10286857All Organisms → cellular organisms → Bacteria741Open in IMG/M
3300028069|Ga0255358_1048884All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11601Open in IMG/M
3300028867|Ga0302146_10244691Not Available701Open in IMG/M
3300028868|Ga0302163_10074385All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11835Open in IMG/M
3300029442|Ga0239579_1034106All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia817Open in IMG/M
3300029914|Ga0311359_11046356All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11546Open in IMG/M
3300029945|Ga0311330_10557885Not Available909Open in IMG/M
3300029987|Ga0311334_11917033All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11507Open in IMG/M
3300030004|Ga0302186_10127309Not Available919Open in IMG/M
3300031232|Ga0302323_103130196All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11527Open in IMG/M
3300031250|Ga0265331_10558068All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11516Open in IMG/M
3300031712|Ga0265342_10427669Not Available681Open in IMG/M
3300031726|Ga0302321_103453792All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11514Open in IMG/M
3300031765|Ga0318554_10584784All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11630Open in IMG/M
3300031873|Ga0315297_10945480Not Available714Open in IMG/M
3300031902|Ga0302322_101063612All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11977Open in IMG/M
3300031902|Ga0302322_102132623All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300032076|Ga0306924_11337917All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11767Open in IMG/M
3300032156|Ga0315295_11949547All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11553Open in IMG/M
3300032164|Ga0315283_11570424All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11671Open in IMG/M
3300032256|Ga0315271_10806012All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11809Open in IMG/M
3300032397|Ga0315287_11228242All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11861Open in IMG/M
3300032397|Ga0315287_11543248Not Available749Open in IMG/M
3300032401|Ga0315275_10294205All Organisms → cellular organisms → Bacteria1817Open in IMG/M
3300032516|Ga0315273_12106702All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11666Open in IMG/M
3300032783|Ga0335079_11269131All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11737Open in IMG/M
3300032783|Ga0335079_12240585All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11520Open in IMG/M
3300032892|Ga0335081_11164439All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11882Open in IMG/M
3300032893|Ga0335069_11896185All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11631Open in IMG/M
3300033289|Ga0310914_10969521All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11750Open in IMG/M
3300033402|Ga0326728_10572577All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11890Open in IMG/M
3300033414|Ga0316619_11118749All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11692Open in IMG/M
3300033414|Ga0316619_11514546All Organisms → cellular organisms → Bacteria602Open in IMG/M
3300033482|Ga0316627_101590848All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11665Open in IMG/M
3300033486|Ga0316624_10855729All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11811Open in IMG/M
3300033521|Ga0316616_100383506All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_111547Open in IMG/M
3300033557|Ga0316617_101052312All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300033743|Ga0334844_087644All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11609Open in IMG/M
3300034123|Ga0370479_0247227All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11514Open in IMG/M
3300034124|Ga0370483_0142113Not Available804Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland9.17%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil9.17%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment8.26%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen5.50%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland4.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.59%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland3.67%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.67%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.67%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog3.67%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands2.75%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.75%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil2.75%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen2.75%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog2.75%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.83%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.83%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.83%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.83%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.83%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.83%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.92%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.92%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater0.92%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.92%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.92%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.92%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.92%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.92%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.92%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.92%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.92%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.92%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.92%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.92%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.92%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.92%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908038Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3EnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300005896Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_204EnvironmentalOpen in IMG/M
3300005897Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_103EnvironmentalOpen in IMG/M
3300005900Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_404EnvironmentalOpen in IMG/M
3300009091Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300009131Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1EnvironmentalOpen in IMG/M
3300009179Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1EnvironmentalOpen in IMG/M
3300009618Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100EnvironmentalOpen in IMG/M
3300009631Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100EnvironmentalOpen in IMG/M
3300009644Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10EnvironmentalOpen in IMG/M
3300009762Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014319Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D1EnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014496Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300016730Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300017941Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017998Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150EnvironmentalOpen in IMG/M
3300017999Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MGEnvironmentalOpen in IMG/M
3300018021Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300019230Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019787Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300021322Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.298 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300021605Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L227-10mEnvironmentalOpen in IMG/M
3300023311Combined Assembly of Gp0281739, Gp0281740, Gp0281741EnvironmentalOpen in IMG/M
3300025326Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025446Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025852Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-22A (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025943Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025948Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026896Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 71 (SPAdes)EnvironmentalOpen in IMG/M
3300026945Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 55 (SPAdes)EnvironmentalOpen in IMG/M
3300027330Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35 (SPAdes)EnvironmentalOpen in IMG/M
3300027743Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027890Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300027896Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300028043 (restricted)Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0.5_MGEnvironmentalOpen in IMG/M
3300028069Peat soil microbial communities from Stordalen Mire, Sweden - G.F.S.T0EnvironmentalOpen in IMG/M
3300028867Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_3EnvironmentalOpen in IMG/M
3300028868Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_3EnvironmentalOpen in IMG/M
3300029442Freshwater lake microbial communities from Alinen Mustajarvi, Finland - AM13EnvironmentalOpen in IMG/M
3300029914III_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029945I_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029987I_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300030004Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_1EnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031250Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaGHost-AssociatedOpen in IMG/M
3300031712Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaGHost-AssociatedOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031873Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0EnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032156Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0EnvironmentalOpen in IMG/M
3300032164Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0EnvironmentalOpen in IMG/M
3300032256Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_topEnvironmentalOpen in IMG/M
3300032397Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0EnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033414Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_BEnvironmentalOpen in IMG/M
3300033482Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_CEnvironmentalOpen in IMG/M
3300033486Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_AEnvironmentalOpen in IMG/M
3300033521Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_BEnvironmentalOpen in IMG/M
3300033557Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_BEnvironmentalOpen in IMG/M
3300033743Peat soil microbial communities from Stordalen Mire, Sweden - 714 E1 5-9EnvironmentalOpen in IMG/M
3300034123Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_01D_15EnvironmentalOpen in IMG/M
3300034124Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
B3_all_c_027539402124908038SoilTQGNGAEFFLFLKANQPLALAKAEQLLPGTLPPSGHHAGQRPRTH
JGI1027J12803_10945941813300000955SoilQLTQNNGAEFFLFLKANQPTALAKAEQLLPGKLPPSGHHAG*
JGIcombinedJ13530_10712362123300001213WetlandCLTTDAAHTIKANCRQLTQGNGAEFFLFLKANQPAALAKAEQLLPGALSPSGPHAGQGPRAH*
Ga0066683_1031163413300005172SoilQLTQNNGADYLLFLKANQPLALAKAEQLLPGALPPSGHHGGQGPRTD*
Ga0066685_1061292013300005180SoilKANCRQLTQNNGADLFLFLKANQPRALAKAEQLLPGNFPPSGQHSG*
Ga0066676_1061238913300005186SoilTQNNGAEFLLFLKANQPTALAKAEQLLLGKVPPSGQHAG*
Ga0066687_1055533323300005454SoilQLTQNNGADFFLFLQGNQPTALAKAEQLLPGKLPPSGQHAG*
Ga0074470_1070961913300005836Sediment (Intertidal)AAHLTKANCRQLTQNNGAESFIFLKGNQPTALAKAQQLVPGNIPPSGQHAG*
Ga0075282_105691923300005896Rice Paddy SoilCRQLTQGNGAEFLLFLKANQPTALAKAEQLLPGTLPPSGPHAG*
Ga0075281_104816913300005897Rice Paddy SoilIKANCRQLTQGNGAEFFLFLKANQPTALAKAEQLLPGALPPSGHDGGQGPRTH*
Ga0075272_106976323300005900Rice Paddy SoilAHTIKANCRQLTQGNGAEFFLFLKANQPLALAKAEQLLPGALPPSGHDGGQGPRTP*
Ga0102851_1163821723300009091Freshwater WetlandsAGVCLTTNAAHLTKANCRQLTQNNGADFFMFLKKNQPTALAKAEQLLLGTLPPSGQHAG*
Ga0102851_1175084123300009091Freshwater WetlandsLTQGNGAEFFLCLKANQPLALAKAEQLLPGALPPSGQHAGQRPRTH*
Ga0102851_1204876213300009091Freshwater WetlandsCRQLSQGNGAEFFLFLKANQPLALAKAEQLLPGTFPPSGQHDG*
Ga0115027_1101975133300009131WetlandAHLVKANCRQLTQHNGAEFLLFLKGNQPTALAKAEQLLPGALPPSGLEGGQRPRPD*
Ga0115028_1116312013300009179WetlandTTKANCRQLSQNNGAEFLLFLKANQPLALAKAQQLLPGTFPPSGQQLGQGPRTD*
Ga0115028_1119430613300009179WetlandANCRQLTQGNGAEFFLFLKANQPLALAKAEQLLPGTLPPSGQHVGQGPRTN*
Ga0116127_103586923300009618PeatlandRQLTQGNGAEFFLFLKANQPLALAKAEQLLPGALPPSGQHTGQRSRTN*
Ga0116115_108957023300009631PeatlandCRQLTQNNGAEFFLFLKANQPTALAKAEQLLPGNVPPSGQHAG*
Ga0116121_109273933300009644PeatlandCRQLTQGNGAEFFLFLKANQPTALAKAEQLLPGALPPSGHNGGQGPRTH*
Ga0116130_102038733300009762PeatlandFFLFLKANQPLALAKAEQLLPGALPPSGQHTGQRSRTN*
Ga0126379_1135698313300010366Tropical Forest SoilAEFFLFLKANQPTALAKAEQLLPGNTPPSGQHAGQGARAN*
Ga0137392_1084718223300011269Vadose Zone SoilHLTKANCRQLTQGNGAEFFLFLKANQPLALAKAEQLLPGTLPPSGQHAGQRPRTN*
Ga0137385_1085113613300012359Vadose Zone SoilQNNGADFLLFLKGNQPLALAKAEQVLPGKVPPSGHHGGQGPRTD*
Ga0153915_1230114513300012931Freshwater WetlandsDAAHTIKANCRQLTQGNGAEFFLFLKGNQPTALAKAEQLLPGTLPPSCHHGGQRPRTH*
Ga0157370_1191190013300013104Corn RhizosphereANCRQLTQNNGADFLLFLKGNQPTALAKAEQLLPGAFPPSGRQPD*
Ga0157378_1075605223300013297Miscanthus RhizosphereAHTTKANCRQLSQGNGADFLLFLKGNQPTALAKAGQLLPGDVPPSGDNDGETSRAD*
Ga0181523_1028349013300014165BogKANCRQLTQGNGAEFFLFLKGNQPFALAKAEQLLSGNFPPSGQHPGQAARTH*
Ga0181528_1022255833300014167BogFLFLKGNQPLALAKAEQLLPGTLPPSGQHAGQKPRPH*
Ga0075348_102767313300014319Natural And Restored WetlandsKANCRQLTQNNGAEFLLFLKANQPLALAKAEQLLPGKLPPSGQYAGQRPRTH*
Ga0182014_1031403223300014491BogKANCRQLTQGNGAEFFLFLKGNQPLALAKAEQLLPGTLPPSGQHAGQKPRPH*
Ga0182011_1102056413300014496FenTKANCRQLTQGNGADFFLFLKANQPLALAKAEQLLPGALPPSGHHGG*
Ga0182019_1006043933300014498FenAEFFLFLKANQPLALAKAEQLLPGTLPPSDQHVGQGPRTN*
Ga0182019_1086990523300014498FenVCVTADAAHTIKANCRQLTQGNGAEFFLFLKANQPLALAKAEQLLPGKLPPSGHHAGQRPRTH*
Ga0181515_134382343300016730PeatlandGADFFLFLKGNQPLALAKAEQLLSGNFPPSGQHSGQGSRTH
Ga0134069_120326913300017654Grasslands SoilLTKANCRQLTQNNGAEFLLFLKANQPTALAKAEQLLLGKVPPSGQHAG
Ga0187850_1019839923300017941PeatlandRQLTQGNGAEFFLFLKANQPTALAKAEQLLPGALPPSGQHTGQRPRTH
Ga0187850_1034585813300017941PeatlandNCRQLTQNNGAEFFLFLKANQPTALAKAEQLLPGNVPPSGQHAG
Ga0187781_1037555933300017972Tropical PeatlandDAAHTTKANCRQLTQDNGAEFFLFLKANQPIARAKAEQLLPGALPPSDHDGGQGPRTH
Ga0187780_1147600123300017973Tropical PeatlandTDAAHLTKANCRQLTQHNGADFFIFLKKNQPTALAKAEQLLPGTLPPSGPHAG
Ga0187870_116401413300017998PeatlandTKANCRQLTQNNGAEFFLFLKANQPTALAKAEQLLPGNVPPSGQHAG
Ga0187767_1030851513300017999Tropical PeatlandANCRQLTQNNGAEFFIFLKANQPTALAKAEQLLPGTLPPSGHDGGQGSRPH
Ga0187882_113648633300018021PeatlandDFFLFLKGNQPSALAKAEQLLSGNFPPSGQHSGQGSRTH
Ga0187875_1077873313300018035PeatlandLFLKGNQPLALAKAEQLLPGTLPPSDQHAGQKPRPH
Ga0187851_1049534413300018046PeatlandGNGADFFLFLKGNQPLALAKAEPLLSGDFPPSGQHAGQGSRTH
Ga0187859_1026156713300018047PeatlandTVKANCRQLTQGNGAEFFLFLKANQPTALAKAEQLLPGALPPSGHDGGQGSRTH
Ga0187858_1042362623300018057PeatlandEFFLFLKANQPTALAKAEQLLPGALPPSGQHAGQRPRTD
Ga0187770_1147181023300018090Tropical PeatlandTQNNGAEFYLFLKANQPTTLAKAEQLLPGALPPSGQHVGQRARTH
Ga0181501_124871323300019230PeatlandRQLTQGNGAEFFLFLKGNQPLALAKAEQLLPGTLPPSDQHAGQKPRPH
Ga0182031_115461533300019787BogTQGNGAEFFLFLKGNQPLALAKAEQLLPGTLPPSGQHAGQKPRPH
Ga0182031_120217923300019787BogTIKANCRQLTQGNGAEFFLFLKGNQPLALAKAEQLLPGTLPPSGQHAGQKPRPH
Ga0210330_115512623300021322EstuarineDAAHTTKANARQLTQGNGADYLLILKANQPTAWAKAQQLLPGAIPPSGPDDRQGPRAG
Ga0126371_1355676313300021560Tropical Forest SoilKANCRQLTQGNGAEFFLFLKANQPTALAKAEQLLPGNTPPSGPHAGQGARPN
Ga0194054_1018958523300021605Anoxic Zone FreshwaterTKANCRQLTQGNGADFLLFLKANQPLALAKAEQLLPGNFPPSGHHAGQGPRPH
Ga0256681_1191916823300023311FreshwaterNCRQLTQNNGAEFLLFLKANQPLALAKAEQLLPGKLPPSGQHAGQRPRTH
Ga0209342_1070682013300025326SoilCRQLTQNNGAEFLLFLKANQPLALAKAEQLLPGTLPPSG
Ga0208038_101066113300025446PeatlandLFLKANQPLALAKAEQLLPGALPPSGQHTGQRSRTN
Ga0209124_1024042323300025852Arctic Peat SoilAHTIKANCRQLTQGNGAEFFLFLKANQPLALAKAEQLLPGALPPSGQHAGQRSRTN
Ga0207646_1071521313300025922Corn, Switchgrass And Miscanthus RhizosphereQLTQNNGADFFIFLKGNQPTALAKAEQLLPGKFPPSGQHAG
Ga0210125_104600823300025943Natural And Restored WetlandsADAAHTTKANCRQLTQNNGAEFLLFLKANQPLALAKAEQLLPGKLPPSGQHAG
Ga0210088_103142413300025948Natural And Restored WetlandsTIKANCRQLTQSNGAEFLLFLKANQPTALAKAEQLLPGALPPSGQHAGQGPRTH
Ga0207730_101076423300026896Tropical Forest SoilAHTIKANCRQLTQANGAEFFLFLKANQPTALAKAEQLLPGTLPPSGQHAGQRPRTH
Ga0207743_101364623300026945Tropical Forest SoilTTDAAHLTKANCRQLTQHNGADFFLFLKANQPTALAKAEQLLPGKLPPSGQHAG
Ga0207777_106026113300027330Tropical Forest SoilFFLFLKANQPTALAKAEQLLPGTLPPSGQHAGQRPRTH
Ga0207777_109881423300027330Tropical Forest SoilRLPQLNLQGLLVTADAAHTTQANCFQLTHGNGADYLLFLKANQPTAKAKAEQLLPGTLPPSGPNSG
Ga0209593_1032179213300027743Freshwater SedimentDAAHTIKANCRQLTQGNGAEFFLFLKANQPTALAKAERLLPGALPPSGHDGGQGPRTH
Ga0209496_1071931013300027890WetlandNGAEFFLFLKANQPLALAKAEQLLPGKLPPSGHHAGQRPRTH
Ga0209777_1062371023300027896Freshwater Lake SedimentAAHTIKANCRQLTQGNGAEFFLFLKANQPLALAKAEQLLPGKLPPSGHHAGQRPRTH
Ga0209488_1080917423300027903Vadose Zone SoilGNGAEFFLFLKANQPLALAKAEQLLPGTLPPSGQHAGQRPRTN
(restricted) Ga0233417_1028685713300028043SedimentAAHTIKANCRQLTQANGAEFFLFLKANQPTALAKAEQLLPGALSPSGHDAGQRPRTH
Ga0255358_104888413300028069SoilANCRQLTQHNGAEFLLFLKANQPLALAKAEQLLAGKLPPSGHHAGQRPRTH
Ga0302146_1024469113300028867BogDFFLFLKGNQPTALAKAEQLLPGTLPPSGQHAGQKPRPH
Ga0302163_1007438523300028868FenKANCRQLTQNNGAEFLLFLKANQPLALAKAEQLLPGKLPPSGHHAGQRPRTH
Ga0239579_103410613300029442Freshwater LakeTVKANCRQLTQGNGAEFLLFLKANQPLALAKAEQLLPGALPPSGQHPGQRSRAN
Ga0311359_1104635613300029914BogADFFLFLKGNQPTALAKAEQLLPGTLPPSGQHAGQGPRTH
Ga0311330_1055788523300029945BogNCRQLTQGNGADFFLFLKGNQPLARAKAEQLLPGALPPSGQHAGQKPRPH
Ga0311334_1191703323300029987FenLTADAAHTVTANCRQLTQSNGAEFFLFLKKNQPLALAKAEQLLPGALPPSGHHGG
Ga0302186_1012730913300030004BogAHTIKANCRQLTQGNGAEFFLFLKGNQPLALAKAEQLLPGTLPPSGQHAGQKPRPH
Ga0302323_10313019623300031232FenNGADFFLVLKANQPLALAKAEQLLPGDTPPSGRVVG
Ga0265331_1055806823300031250RhizosphereGNGAEFFLCLKANQPLALAKAEQLLPGTLPPSGQHVGQRPRTN
Ga0265342_1042766913300031712RhizosphereAAHTTQANCFQLTNGNGADYFLFLKGNQPNAKAKAEQLLPGKLPPSGSDVG
Ga0302321_10345379213300031726FenGVCLTADAAHTTKANCRQLTLCNGADFFLVLKANQPLALAKAEQLLPGDTPPSGRVVG
Ga0318554_1058478423300031765SoilLTTDAAHLTKANCRQLTQKNGADFFIFLKKNQPTALAKAEQLLPGKLPPSGQNAG
Ga0315297_1094548023300031873SedimentNCRQLSQNNGAEFWLVLKANQPLALAKAEQLLPGKFPPSGQQSGQGPRADRVA
Ga0302322_10106361213300031902FenAAHTTKANCRQLTQGNGADFFLFLKANQPLALAKAEQLLPGALPPSGHHGG
Ga0302322_10213262313300031902FenLTTDAAHLTKANCRQLPQGNGADFFIFLKANQPLALAKAEQLLPGALPPSGQHAQQGPRT
Ga0306924_1133791713300032076SoilDAAHLTKANCRQLTQKNGADFFIFLKKNQPTALAKAEQLLPGKLPPSGQNAG
Ga0315295_1194954713300032156SedimentQNNGAEFLLFLKANQPLALAKAEQLLPGALPPSGPHAGQRPRTH
Ga0315283_1157042433300032164SedimentGVCLTADAAHLTKANCRQLTQGNGAEFFLFLKANQPLALAKAEQLLPGTLPPSGQHVGQRSRTN
Ga0315271_1080601213300032256SedimentFLKANQPTALAKAEQLLPGALPPSGQHAGQGPRTH
Ga0315287_1122824223300032397SedimentEFFLFLKGNQPTALAKAEQLLLGALPPSGHDSGQGARTH
Ga0315287_1154324813300032397SedimentNCRQLSQGNGAEFLLFLKANQPLALAKAEQLLPGTFPPSGQHAG
Ga0315275_1029420533300032401SedimentQLTQNNGAEFLLFLKANQPLALAKAEQLLPGKLPPSGQHAGQRPRTH
Ga0315273_1210670213300032516SedimentAAHLTKANCRQLSQGNGAEFFIFLKANQPTALAKAEQLLPGALPPSSPHGQQRPRTH
Ga0335079_1126913113300032783SoilTADAAHTVKANCRQLTQGNGAEFYLFLKANQPTALAKAEQLLPGTLPPSGQHAGQGPRTH
Ga0335079_1224058523300032783SoilNCRQLTQGNGAEFFLFLKANQPTALAKAEQLLPGALPPSGPHAR
Ga0335081_1116443923300032892SoilCLTADAAHTVKANCRQLTQGNGAEFYLFLKANQPTALAKAEQLLPGTLPPSGQHAGQGPRTH
Ga0335069_1189618523300032893SoilAHLTKANCRQLTQNNGAEFFIFLKGNQPTALAKAEQLLPGTLPPSGHDGGQGPRSH
Ga0310914_1096952133300033289SoilQKNGADFFIFLKKNQPTALAKAEQLLPGKLPPSGQNAG
Ga0326728_1057257713300033402Peat SoilCLTADAAHTVKANCRQLTQGNGAEFFLFLKANQPTALAKAEQLLPGTLPPSGQHAGQGPRAH
Ga0316619_1111874923300033414SoilKANCRQLTQGNGAEFFLFLKANQPLALAKAEQLLPGKLPPSGHHVG
Ga0316619_1151454623300033414SoilAEFLLFLKANQPLALAKAQQLLPGTFPPSGQQLGQGPRTD
Ga0316627_10159084813300033482SoilNGAEFLLFLKGNQPTALAKAEQLLPGALPPSGPHGGERPRTH
Ga0316624_1085572923300033486SoilGAEFLLFLKANQPLALAKAEQLLPGKLPPSGHHAGQRSRTH
Ga0316616_10038350613300033521SoilDAAHTTKANCRQLTQNNGAEFLLFLKANQPLALAKAEQLLPGKLPPSGQHAGQRPRTH
Ga0316617_10105231223300033557SoilLSQNNGAEFLLFLKANQPLALAKAQQLLPGTFPPSGQQLGQGPRTD
Ga0334844_087644_499_6093300033743SoilNGADFFLFLKANQPLALAKAEQLLPGALPPSGHHGG
Ga0370479_0247227_336_5123300034123Untreated Peat SoilDAAHTTKANCRQLTQGNGAEFFLFLKANQPTALAKAEQLLPGALPPSSQHAGQGPRTH
Ga0370483_0142113_684_8033300034124Untreated Peat SoilEFFLFLKGNQPLALAKAEQLLPGTLPPSGQHAGQKPRPH


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.