NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F088093

Metagenome Family F088093

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F088093
Family Type Metagenome
Number of Sequences 109
Average Sequence Length 179 residues
Representative Sequence MNSRTRSELAILSLLAATLIASPCARAQGIRCGAGQDLIVQALERITPQSGNDAFEDALQLLKSAVAECPELGDAWYYRSLVEKRLGHDALAKYAMDKARFNGSEALDQDLNPLVLSTPASRGIEAEGTETPVPVAPPVKPGPVQQKWALVIGIGHFTDAQIPQLNYTGADA
Number of Associated Samples 83
Number of Associated Scaffolds 109

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 29.25 %
% of genes near scaffold ends (potentially truncated) 97.25 %
% of genes from short scaffolds (< 2000 bps) 85.32 %
Associated GOLD sequencing projects 79
AlphaFold2 3D model prediction Yes
3D model pTM-score0.54

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.248 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland
(30.275 % of family members)
Environment Ontology (ENVO) Unclassified
(67.890 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(55.046 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 48.50%    β-sheet: 0.00%    Coil/Unstructured: 51.50%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.54
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 109 Family Scaffolds
PF00135COesterase 0.92
PF10531SLBB 0.92
PF00656Peptidase_C14 0.92
PF14326DUF4384 0.92
PF06552TOM20_plant 0.92

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 109 Family Scaffolds
COG2272Carboxylesterase type BLipid transport and metabolism [I] 0.92
COG4249Uncharacterized conserved protein, contains caspase domainGeneral function prediction only [R] 0.92


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.25 %
UnclassifiedrootN/A2.75 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005541|Ga0070733_10400330All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii914Open in IMG/M
3300005591|Ga0070761_11118324All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Candidatus Magnetobacterium → Candidatus Magnetobacterium casensis502Open in IMG/M
3300009519|Ga0116108_1108526All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii837Open in IMG/M
3300009548|Ga0116107_1075142All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1065Open in IMG/M
3300009623|Ga0116133_1038490All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1183Open in IMG/M
3300009628|Ga0116125_1046098All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1104Open in IMG/M
3300009630|Ga0116114_1124733All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Candidatus Magnetobacterium → Candidatus Magnetobacterium casensis670Open in IMG/M
3300009643|Ga0116110_1096009All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1012Open in IMG/M
3300009645|Ga0116106_1091677All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii987Open in IMG/M
3300009760|Ga0116131_1016037All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii2828Open in IMG/M
3300010379|Ga0136449_100413465All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii2386Open in IMG/M
3300010379|Ga0136449_103906261All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii559Open in IMG/M
3300014153|Ga0181527_1143780All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1052Open in IMG/M
3300014156|Ga0181518_10056747All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii2321Open in IMG/M
3300014161|Ga0181529_10142990All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1465Open in IMG/M
3300014161|Ga0181529_10422906All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii716Open in IMG/M
3300014162|Ga0181538_10057261All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii2405Open in IMG/M
3300014165|Ga0181523_10004615All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae11776Open in IMG/M
3300014199|Ga0181535_10197885All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1235Open in IMG/M
3300014199|Ga0181535_10216863All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1167Open in IMG/M
3300014199|Ga0181535_10246569All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1079Open in IMG/M
3300014199|Ga0181535_10727487All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii564Open in IMG/M
3300014200|Ga0181526_10430575All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii837Open in IMG/M
3300014200|Ga0181526_10484692All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii783Open in IMG/M
3300014200|Ga0181526_10852124All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii573Open in IMG/M
3300014201|Ga0181537_10064271All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii2487Open in IMG/M
3300014491|Ga0182014_10318179All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii794Open in IMG/M
3300014491|Ga0182014_10556666All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Candidatus Magnetobacterium → Candidatus Magnetobacterium casensis558Open in IMG/M
3300014492|Ga0182013_10064458All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii2669Open in IMG/M
3300014494|Ga0182017_10414358All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii832Open in IMG/M
3300014496|Ga0182011_10134148All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1714Open in IMG/M
3300014501|Ga0182024_12661991All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Candidatus Magnetobacterium → Candidatus Magnetobacterium casensis536Open in IMG/M
3300014638|Ga0181536_10010532All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii8577Open in IMG/M
3300014655|Ga0181516_10065567All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1830Open in IMG/M
3300014655|Ga0181516_10373749All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Candidatus Magnetobacterium → Candidatus Magnetobacterium casensis727Open in IMG/M
3300014658|Ga0181519_10168380All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1391Open in IMG/M
3300014838|Ga0182030_10648061All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1005Open in IMG/M
3300014838|Ga0182030_11175312All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii658Open in IMG/M
3300014838|Ga0182030_11626270All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii527Open in IMG/M
3300017931|Ga0187877_1143357All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii965Open in IMG/M
3300017932|Ga0187814_10301093All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii614Open in IMG/M
3300017935|Ga0187848_10459958All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Candidatus Magnetobacterium → Candidatus Magnetobacterium casensis522Open in IMG/M
3300017938|Ga0187854_10077432All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1596Open in IMG/M
3300017940|Ga0187853_10143584All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1147Open in IMG/M
3300017940|Ga0187853_10448678All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Candidatus Magnetobacterium → Candidatus Magnetobacterium casensis567Open in IMG/M
3300017948|Ga0187847_10062659All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii2091Open in IMG/M
3300017970|Ga0187783_10481054All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii900Open in IMG/M
3300017972|Ga0187781_10028219All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii3876Open in IMG/M
3300017975|Ga0187782_10579871All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii861Open in IMG/M
3300017975|Ga0187782_11528187All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii526Open in IMG/M
3300018003|Ga0187876_1235000All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Candidatus Magnetobacterium → Candidatus Magnetobacterium casensis602Open in IMG/M
3300018004|Ga0187865_1177466All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii734Open in IMG/M
3300018009|Ga0187884_10117207All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1144Open in IMG/M
3300018014|Ga0187860_1376813All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii535Open in IMG/M
3300018021|Ga0187882_1178958All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii846Open in IMG/M
3300018024|Ga0187881_10319818All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii642Open in IMG/M
3300018025|Ga0187885_10158129All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1068Open in IMG/M
3300018025|Ga0187885_10261495All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii789Open in IMG/M
3300018033|Ga0187867_10098907All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1702Open in IMG/M
3300018033|Ga0187867_10186457All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1183Open in IMG/M
3300018033|Ga0187867_10274347All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii947Open in IMG/M
3300018035|Ga0187875_10376002All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii761Open in IMG/M
3300018035|Ga0187875_10616903All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii572Open in IMG/M
3300018035|Ga0187875_10771872All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Candidatus Magnetobacterium → Candidatus Magnetobacterium casensis503Open in IMG/M
3300018037|Ga0187883_10193674All Organisms → cellular organisms → Bacteria1043Open in IMG/M
3300018037|Ga0187883_10761256All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii506Open in IMG/M
3300018038|Ga0187855_10746763All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii570Open in IMG/M
3300018043|Ga0187887_10935421All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii513Open in IMG/M
3300018046|Ga0187851_10256469All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1023Open in IMG/M
3300018046|Ga0187851_10302787All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii926Open in IMG/M
3300018046|Ga0187851_10838611All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Candidatus Magnetobacterium → Candidatus Magnetobacterium casensis517Open in IMG/M
3300018047|Ga0187859_10435902All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Candidatus Magnetobacterium → Candidatus Magnetobacterium casensis723Open in IMG/M
3300018047|Ga0187859_10685614All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii582Open in IMG/M
3300018057|Ga0187858_10343737All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii937Open in IMG/M
3300018057|Ga0187858_10669926All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Candidatus Magnetobacterium → Candidatus Magnetobacterium casensis621Open in IMG/M
3300018062|Ga0187784_11499896All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii534Open in IMG/M
3300019082|Ga0187852_1104206All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1245Open in IMG/M
3300019787|Ga0182031_1277346All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii590Open in IMG/M
3300021402|Ga0210385_11245155All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii571Open in IMG/M
3300021405|Ga0210387_10657448All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii930Open in IMG/M
3300021420|Ga0210394_10427132All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1166Open in IMG/M
3300025480|Ga0208688_1116638All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii502Open in IMG/M
3300027908|Ga0209006_10428547All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1110Open in IMG/M
3300028574|Ga0302153_10013436All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii2764Open in IMG/M
3300028873|Ga0302197_10001267All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae24812Open in IMG/M
3300029911|Ga0311361_11037643All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii680Open in IMG/M
3300029916|Ga0302148_1229855All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii524Open in IMG/M
3300029953|Ga0311343_10363068All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1360Open in IMG/M
3300030020|Ga0311344_10546111All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1011Open in IMG/M
3300030041|Ga0302274_10105371All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1514Open in IMG/M
3300031238|Ga0265332_10303620All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii659Open in IMG/M
3300031241|Ga0265325_10054865All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii2039Open in IMG/M
3300031595|Ga0265313_10140099All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1040Open in IMG/M
3300031708|Ga0310686_104781591All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii723Open in IMG/M
3300031708|Ga0310686_108074268All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii717Open in IMG/M
3300032160|Ga0311301_11125120All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1018Open in IMG/M
3300032783|Ga0335079_11548635All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii653Open in IMG/M
3300032805|Ga0335078_11673770All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii700Open in IMG/M
3300032805|Ga0335078_12088090All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii602Open in IMG/M
3300032898|Ga0335072_10796928All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii904Open in IMG/M
3300033134|Ga0335073_10341300All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1779Open in IMG/M
3300033402|Ga0326728_10205173All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1976Open in IMG/M
3300033818|Ga0334804_075748All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii911Open in IMG/M
3300033828|Ga0334850_024499All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1128Open in IMG/M
3300033977|Ga0314861_0230190All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii862Open in IMG/M
3300034163|Ga0370515_0521731All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Candidatus Magnetobacterium → Candidatus Magnetobacterium casensis501Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland30.28%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog16.51%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland8.26%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog7.34%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog6.42%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.59%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.59%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.75%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil2.75%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere2.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.83%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen1.83%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.92%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.92%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.92%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.92%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.92%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.92%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.92%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.92%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300009519Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150EnvironmentalOpen in IMG/M
3300009548Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100EnvironmentalOpen in IMG/M
3300009623Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10EnvironmentalOpen in IMG/M
3300009628Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10EnvironmentalOpen in IMG/M
3300009630Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40EnvironmentalOpen in IMG/M
3300009643Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40EnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300009760Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_100EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300014153Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaGEnvironmentalOpen in IMG/M
3300014156Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaGEnvironmentalOpen in IMG/M
3300014161Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaGEnvironmentalOpen in IMG/M
3300014162Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaGEnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014199Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014492Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaGEnvironmentalOpen in IMG/M
3300014494Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaGEnvironmentalOpen in IMG/M
3300014496Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014638Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaGEnvironmentalOpen in IMG/M
3300014655Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaGEnvironmentalOpen in IMG/M
3300014658Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300017931Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017938Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018003Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40EnvironmentalOpen in IMG/M
3300018004Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100EnvironmentalOpen in IMG/M
3300018009Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40EnvironmentalOpen in IMG/M
3300018014Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40EnvironmentalOpen in IMG/M
3300018021Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150EnvironmentalOpen in IMG/M
3300018024Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100EnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300019082Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40EnvironmentalOpen in IMG/M
3300019787Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300025480Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028574Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_2EnvironmentalOpen in IMG/M
3300028766Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_2EnvironmentalOpen in IMG/M
3300028873Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_1EnvironmentalOpen in IMG/M
3300029911III_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029916Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_1EnvironmentalOpen in IMG/M
3300029953II_Bog_E3 coassemblyEnvironmentalOpen in IMG/M
3300030020II_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300030041Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_1EnvironmentalOpen in IMG/M
3300031238Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaGHost-AssociatedOpen in IMG/M
3300031241Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaGHost-AssociatedOpen in IMG/M
3300031595Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaGHost-AssociatedOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033818Peat soil microbial communities from Stordalen Mire, Sweden - 713 S-3-MEnvironmentalOpen in IMG/M
3300033822Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 5-9EnvironmentalOpen in IMG/M
3300033828Peat soil microbial communities from Stordalen Mire, Sweden - 715 P1 1-5EnvironmentalOpen in IMG/M
3300033977Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75EnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0070733_1040033013300005541Surface SoilMTASRRLSFFPMALVAFALAASPGSRAQGVRCGAGQDLIVQALERITPQSGDDAFEDALQLLKSAVAECPELGDAWYYRSLVEKRLGHDALSNYAMEKARFNGSDALDQNLNPLVLSTPASRGFETDQGTTPAPAAAPVKPGPVQQKWALVVGIG
Ga0070761_1111832413300005591SoilRASGESVRCGAGQDLVVQALERITPQSPDGDLVDALELLKHAVSTCPELGDAWYYRSLVEQRLGSAHAPMAKYAMGKAQFYGSDAMDDGLNPLILATPASRGFDLEASTPAATAPAPVKPGPVQQKWALVVGIANFTDSQIPRLNYTTADADAFAAALKDPNIGQF
Ga0116108_110852623300009519PeatlandMNSRTRSGLAILSLLAATLIASPCARAQGIRCGAGQDLIVQALERITPQSGNDAFEDALQLLKSAVAECPELGDAWYYRSLVEKRLGHDALAKYAMDKAHFNGSEALDQDLNPLVLSTPASRGIEAEGTETPVPVAPPVKPGPVQQKWALVIGIGHFTDAQIPQLNYTGADAASFAAA
Ga0116107_107514223300009548PeatlandMNSRTRSELAILSLLAATLVASPRARAQGIRCGAGQDLIVQALERITPQSGNDAFEDALQLLKSAVAECPELGDAWYYRSLVEKRLGHDSLANYAMDKARFNGSDALDQNLNPLVLSTPASRGIEAEGVETPVPAAPPVKPGPVQQKWALVIGIGHFTDTTIPQLNYTGADATAFATALKDPSIGGFPADNVHVL
Ga0116133_103849013300009623PeatlandMNSRTRSGLAILSLLAATLIASPCARAQGIRCGAGQDLIVQALERITPQSGNDAFEDALQLLKSAVAECPELGDAWYYRSLVEKRLGHDALAKYAMDKARFNGSEALDQDLNPLVLSTPASRGIEAEGTETPVPVAPPVKPGPVQQKWALVIGIGHFTDAQIPQLNYTGADATAFATALEDPSIGGFPADNVHV
Ga0116125_104609813300009628PeatlandMNSRTRSGLAILSLLAATLIASPCARAQGIRCGAGQDLIVQALERITPQSGNDAFEDALQLLKSAVAECPELGDAWYYRSLVEKRLVHGVLGESVVAKARFNGSEALDQDLNPLVLSTPASRGIEAEGTETPVPVAPPAKPGPVQQKWALVIG
Ga0116114_112473313300009630PeatlandMLTATLIASPCARAQGIRCGAGQDLIVQALERITPQSGNDAFEDALQLLKSAVAECPELGDAWYYRSLVEKHLGHDSLANYAMDKARFNSSEALDQGLNPLVLSTPASRGFEAESTETPVPVAPPVKPGPVQQKWALVVGIGHFTDKQIPQLNYTGSDAAAFATELKDPSIGGFPAANVHVLTDHQA
Ga0116110_109600913300009643PeatlandMIARLPSRILLVALFALALGLAFGSWPRASAQEVRCGAGQDLVVQALERVTPQSGNDAFLDALELLKHAVSVCPELGDAWYYRSLVEKRLGHVSLAKYALDKARFNGSEALDQGLNPLELATPSSRGIPDNAPASAANAPPVRPGPVEQKWALVVGIGSFTDSEIPRLNYTTADADAFAAALKDPAIGEFPAGNVHVLTDEQATTKNIKEQLNLIARHAGANDL
Ga0116106_109167723300009645PeatlandMNSRTRSGLAILSLLAATLIASPCARAQGIRCGAGQDLIVQALERITPQSGNDAFEDALQLLKSAVAECPELGDAWYYRSLVEKRLGHDALAKYAMDKARFNGSEALDQDLNPLVLSTPASRGIEAEGTETPVPVAPPVKPGPVQQKWALVIGIGHFTDAQIPQLNYTGADAAAFAAALKDPSIGGFPADNVHVLTDDQATTK
Ga0116131_101603713300009760PeatlandMNSRTRSELAILSLLAATLVASPRARAQGIRCGAGQDLIVQALERITPQSGNDAFEDALQLLKSAVAECPELGDAWYYRSLVEKRLGHDSLANYAMDKARFNGSDALDQNLNPLVLSTPASRGIEAEGVETPVPAAPPVKPGPVQQKW
Ga0136449_10041346523300010379Peatlands SoilMIRRSPFSIPVATLVALVLCVCLPARGESLRCGAGQDLVVQALERVTPQSPNSDFDDALQLLKHAVSSCPELGDAWYYRSLVEQKLGHAPLAKYALDKAHFYGSDALDDGLNPLILATPAARGFSMEQASTPAAPAAPVKPGPVQQKWALVIGIGDFTDAQIPKLNYTTADADAFADALKDPNIGQFPADNVHVLTDGNATTKNIK
Ga0136449_10390626113300010379Peatlands SoilGSRSQAQGVRCGAGQDLVVQALERITPQSGDDAFQDALELLKHAVAECPELGDAWYYRSLVEKRLGHANLANYALDKARFNGSEALDQGLDPLILSTPASRGFETTEGTTPAQAAPPVRPGPVQQKWALIVGNSRFTDTEIPKLNFTTADAKSFAAALGDPNIGGFPADNVHTLTDEQATTKNIK
Ga0181527_114378013300014153BogMSSRSPSSLAILALFTAALFAYPRASAQGIRCGAGQDLVVQALERIAPQSGDDAFEDALQLLKAAVAECPELGDAWYYRSLVEKRLGHDALANYSLDKARFNGSEALDQGLNPLVLSTPASRGFETGQGATPAPAAPPVKPGPV
Ga0181518_1005674713300014156BogMNSRTRSGLAILSLLAATLIASPCARAQGIRCGAGQDLIVQALERITPQSGNDAFEDALQLLKSAVAECPELGDAWYYRSLVEKRLGHDALAKYTMDKARFNGSEALDQDLNPLVLSTPASRGIEAEGTETPVPVAPPVKPGPVQQKWALVIGIGHFTDAQIPQLNYTGADA
Ga0181529_1014299013300014161BogMNSRTRSGLAILSLLAATLIASPCARAQGIRCGAGQDLIVQALERITPQSGNDAFEDALQLLKSAVAECPELGDAWYYRSLVEKRLGHDALAKYAMDKARFNGSEALDQDLNPLVLSTPASRGIEAEGTETPVPVAPPVKPGPVQQKWALVIGIGHFTDAQIPQLNYT
Ga0181529_1042290613300014161BogMILPSRFKLAILPLLAAALIACPSARAQGARCGAGQDLIVQALERITPQSGNDAFEDALQLLKSAVAECPELGDAWYYRSLVEKHLGHDSLANYAMDKARFNSSEALDQGLNPLVLSTPASRGFEAESTETPVPAAPPVKPGPVQQKWALVVGIGHFTDKQIPQLNYTGSDAAAFATELKDPSIGGFPADNVHV
Ga0181538_1005726133300014162BogMNSRTRSGLAILSLLAATLIASPCARAQGIRCGAGQDLIVQALERITPQSGNDAFEDALQLLKSAVAECPELGDAWYYRSLVEKRLGHDALAKYAMDKAHFNGSEALDQDLNPLVLSTPASRGIEAEGTETPVPVAPPVKPGPVQ
Ga0181523_1000461593300014165BogMILPSRFKLAILPLLAAALIACPSARAQGARCGAGQDLIVQALERITPQSGNDAFEDALQLLKSAVAECPELGDAWYYRSLVEKHLGHDSLANYAMDKARFNSSEALDQGLNPLVLSTPASRGFEAESTETPVPAAPPVKPGPVQQKWALVVGIGHFTDKQIPQLNYTGSDATAFAAELKDPSIGGFPADNVHVLTDDQATTKNI
Ga0181535_1019788523300014199BogMNLPSLSKLAILPLLAATLIACRGARAEDVRCGAGQDLVVQALERVTPQSGNDAFGDALQLLKSAVAECPELGDAWYYRSLVEKHLGHDSLANYAMDKARFNGSDALDQGLNPLVLSTPASRGFETEGATTPAPAAPPVKPGPVQQKWALVVGIGHFTDKQIPQLNYTDADATAFAADLKDPSI
Ga0181535_1021686323300014199BogMIRRLPSRILLVALFALAFGPWTRASAQTVRCGAGQDLVVQALERVTPQSGNDAFVDALELLKHAVSVCPELGDAWYYRSLVEKRLGHDALAKYALGKAQFNGSEALDQGLNPLELSTPSSRGIPDKSSAPEASAPPISPGPVQQKWALVIGIGHFTDSEIPQLNYTTADATAFADALKDSSI
Ga0181535_1024656923300014199BogMNLPSLSRLAILPLLAATLIACPGSRAEDVRCGAGQDLVVQALERVTPQSGNDAFGDALQLLKSAVAECPELGDAWYYRSLVEKRLGHDSLANYAMDKARFNGSEALDQGLNPLVLSTPASRGFETEGATTPAPAAPPVKPGPVQQKWALVVGIGHFTDKQIPQLNYTDADATAFAADLKDPSI
Ga0181535_1072748713300014199BogEARGNRKARSRKMNSRTRSGLAILSLLAATLIASPCARAQGVRCGAGQDLVVQALERITPQSGNDAFEDALQLLKSAVAECPELGDAWYYRSLVEKRLGHDALAKYAMDKAHFNGSEALDQDLNPLVLSTPASRGIEAEGTETPVPVAPPVKPGPVQQKWALVIGIGHFTDAQIPQLNYTGADAAAFA
Ga0181526_1043057523300014200BogMILPSRFKLAILPLLAAALIACPSARAQGARCGAGQDLIVQALERITPQSGNDAFEDALQLLKSAVAECPELGDAWYYRSLVEKHLGHDSLANYAMDKARFNSSEALDQGLNPLVLSTPASRGFEAESTETPVPAAPPVKPGPVQQKWALVVGIGHFTDKQIPQLNYTG
Ga0181526_1048469223300014200BogMRGAWFAKWAMLGTILFPGFPAAGQGSRCGAGRDLVVQALERISPQSNQNAFEDALQLLKHAVSECGELGDAWYYRSLVEQRLGHDSLAHYAMDKARFVGSEALDQQLDPLILSTPATRGFVVEASTTHPSQPAPVKPGPVQQKWALVIGISRFVDGAIPRLKYTTADANAFAAELKDPTIGRFPAAN
Ga0181526_1085212413300014200BogESQSDKEARGNRKARSRKMNSRTRSGLAILSLLAATLIASPCARAQGVRCGAGQDLVVQALERITPQSGNDAFEDALQLLKSAVAECPELGDAWYYRSLVEKRLGHDALAKYTMDKARFNGSEALDQDLNPLVLSTPASRGIEAEGTETPVPVAPPVKPGPVQQKWALVIGIGHFTDAQIPQLNYTGADA
Ga0181537_1006427133300014201BogMIARLPSRVLLIALVAFAFGSWPRASAQTVRCGAGQDLIVQALERVTPQSGNDAFLDALELLKHAVSVCPELGDAWYYRSLVEKRLGHDSLAKYALDKAHFNGSEALDQELNPLVLSTPSSRALPDKGPAPEASAPPASPGPVQQKWALVVGIGHFTDSEIPGLNYTTSDASAFA
Ga0182014_1031817923300014491BogMSANRPSCVLLPALLIAVLSVCPSAHAQGIRCGAGQDLVVQALERITPQSGNDAFDDALQLLKHAVAVCPELGNAWYYRSLIEKRLGHDALAKYSLDKARFNGSDALDQGLNPLVLSTPASRGFTQAAGTEIPAPGAAPVRPGPVEQRWALVV
Ga0182014_1055666613300014491BogALAVRPCAFAQQVKCGAGRDLVVQALERVTPQSGNDAFVDALELLKHAVSVCPELGDAWYYRSLVEKRLGHDSLANYALGKAQFNGSEALDQGLNPLELSTPSSRGITATEGPAPEASAAPVRPGPVQEKWALVVGIGDFTDSEIPHLNYTTADATAFADALEDPAIGQFPTDNVHLLTDKQATT
Ga0182013_1006445833300014492BogMIAQLPSRVLVVALLALAVRPCAFAQQVKCGAGRDLVVQALERVTPQSGNDAFVDALELLKHAVSVCPELGDAWYYRSLVEKRLGHDSLANYALGKAQFNGSEALDQGLNPLELSTPSSRGITATEGPAPEASAAPVRPGPVQEKWALVVGIGDFTDSEIPHLNYTTADATAFADALEDPAIGQFPTDN
Ga0182017_1041435823300014494FenMNPRTRFGLAILSLLTATLIASPCARAQGIRCGAGQDLIVQALERITPQSGNDAFEDALQLLKSALGECPELGDAWYYRSLVEKRLGHDSLANYAMGKARFNGSEALDQDLNPLVLSTPASRGIEAEGTETPVPVAPPVKPGPVQQKWALVIGIGHFTDTQIPQLNYTGADATEFATAL
Ga0182011_1013414813300014496FenMSRLNRCGILFLALLAAPFAACPRASAQGVRCGAGQDLVIQALERITPQSGNDAFEDALQLLKHAVSVCPELGDAWYYRSLVEKRLGHDNLANYAMEKARFNESEALGQGLNPLVLSTPASRGFTPEGTETPAPAAPPVRPGPVQQKWALVVGVGHFTDTQIPQLNYTTADADAFAAA
Ga0182024_1266199113300014501PermafrostTLIAAPSSRAQGIRCGAGQDLIVQALEQITPQSDTKAFGDALEILKSALGECPELGDAWYYRSLVEKRLGHQALADYAMGKARFNGSDALDQGLDPLVLATPASRGIEAEGVETPVPAAPPVKPGPVQQKWALVVGIGHFTDTKIPQLNYTGADATAFATALKDPTIGGFPADNVHIL
Ga0181536_1001053213300014638BogMIRRLPSRMLLVALLALAPGLRPRAAAQEVRCGAGQDLVVQALERITPQSGNDAFVDALELLKHAVSVCPELGDAWYYRSLVEKRLGHDQLAKYALDKARFNGSEALDQGLNPLELSTPSSRGIAAGEGPAPEPSAPAVRPGPVQQKWALVVGIGHFTDSEIPRLNYTTADATAFAAALEDPSIGQFPADNVHVLTDEQATTKNIKE
Ga0181516_1006556723300014655BogMILRSRSRLDLLPLLAAALIACPCARAQGVRCGAGQDLVVQALERITPQSGNDAFEDALQLLKSAVAECPELGDAWYYRSLVEKHLGHDSLANYAMDKARFNGSEALDQGLNPLILSTPASRGFEDAGTQTPVPVAPPVKPG
Ga0181516_1037374913300014655BogCRPATAYERRSECAGCGRDENSRGETAKRQTCGRKMMARLPSRILLIALVALAVGARTGASAQTMKCGAGQDLVVQALERITPQSGNDAFLDALELLKHAVSVCPELGDAWYYRSLVEKRLGHESLATYAMGKAQFNGSEALDQELNPLQLSTPSSRGISAEAGPAPEASAPPVRPGPVDQKWALVIGIGNFTDTGIPKLHYTTDDATAFAAALEDPAIGQFPADNVHVLTDAQATTKNIKE
Ga0181519_1016838023300014658BogMNSRTRSGLAILSLLAATLIASPCARAQGIRCGAGQDLIVQALERITPQSGNDAFEDALQLLKSAVAECPELGDAWYYRSLVEKRLGHDALAKYAMDKAHFNGSEALDQDLNPLVLSTPASRGIEAEGTETPVPVAPPAKPGPVQQKWALVIGIGHFTDTQIPQLNYTGADATAFATALE
Ga0182030_1064806113300014838BogMNQFHRSGILSVVLLSGALSACLHAYGESVRCGAGQDLVVQALEQFTPQSPNDDFENALQLLKHAVSVCPELGDAWYYRSLVEQRLGHAPLAKYAMDKAHFYGSDALDEGVNPLVLSTPASRGLSMEASTPAAPAAPVKPGPVQQKWALVVGVGNFTDTQIPKLNYTTADANAFADALKDPNIGQFPADNVHVLTD
Ga0182030_1117531213300014838BogMISPTRSRLAVFSLLAATLIACPCARAQGVRCGAGHDLIVQALERITPQSGNGAFVDALELLKSALSECPELGDAWYYRSLVEKRLGHDSLADYAMGKARFNGSDALDQGLNPLILSTPASRGFEAEGPQTPVPAAPPVKP
Ga0182030_1162627013300014838BogRKMNSRTRSGLAILSLLAATLIASPCARAQGIRCGAGQDLIVQALERITPQSGNDAFEDALQLLKSAVAECPELGDAWYYRSLVEKRLGHDALAKYAMDKAHFNGSEALDQDLNPLVLSTPASRGIEAEGTETPVPVAPPAKPGPVQQKWALVIGIGRFTDTQIPQLNYTGADAT
Ga0187877_114335713300017931PeatlandMNSRTRSELAILSLLAATLVASPRARAQGIRCGAGQDLIVQALERITPQSGNDAFEDALQLLKSAVAECPELGDAWYYRSLVEKRLGHDSLANYAMDKARFNGSDALDQNLNPLVLSTPASRGIEAEGVETPVPAAPPVKPGPVQQKWALVIGIGHFTDTTIPQLNYTGA
Ga0187814_1030109313300017932Freshwater SedimentMKSFRRFGFLVLAFLTAAQIPCPRGQAQGVRCGAGQDLVVQALERISPQSGDDTFQDALELLKHAVAECPELGDAWYYRSLVEKRLGHASLANYALDKARFNGSEALDQGLDPLILSTPASRGFETTEATTPAPAAPPVRPGPVQQKWALIV
Ga0187848_1045995813300017935PeatlandRASAQTVRCGAGQDLVVQALERVTPQSGNDAFLDALELLKHAVSVCPELGDAWYYRSLVEKRLGHVSLAKYALDKARFNGSEALDQGLNPLELATPSSRGIPDNAPASAANAPPVRPGPVEQKWALVVGIGSFTDSEIPRLNYTTADADAFAAALKDPAIGEFPAGNVHVLTDE
Ga0187854_1007743213300017938PeatlandMNSRTRSELAILSLLAATLVASPRARAQGIRCGAGQDLIVQALERITPQSGNDAFEDALQLLKSAVAECPELGDAWYYRSLVEKRLGHDSLANYAMDKARFNGSDALDQNLNPLVLSTPASRGIEAEGVETPVPAAPPVKPGPVQQKWALVIGIGHFTDTTIPQLNYTGADA
Ga0187853_1014358423300017940PeatlandMIPRLPSRIFLVALFALALGVRPRASAQTVRCGAGQDLVVQALERITPQSGNDAFLDALELLKHAVSVCPELGDAWYYRSLVEKRLGHDALAKYALDKARFNGSEALDQGLNPLELATPSSRGIPYKAPASEANAPPVSPGPVEQKWALIIGIGHFTDSEIPSLNYTTADATAFAAALEDPSIGQFPAANVHVLTDAQATTKNIK
Ga0187853_1044867813300017940PeatlandILLVALFALAFGSWTRASAQTVRCGAGQDLVVQALERVTPQSGNDAFLDALELLKHAVSVCPELGDAWYYRSLVEKHLGHDALAKYALDKARFNGSEALDQGLNPLELATPASRGITAEEGPAPESSAPAVRPGPVQQKWALVVGIGHFTDSEIPRLNYTTADATAFADALKDPSIGQFPADNVHVLT
Ga0187847_1006265923300017948PeatlandMTVHLPSRILLVALFTLAFGSWPRASAQKAPCGAGQDLIVQALERVTPQSGNDAFVDALELLKHAVSICPELGDAWYYRSLVEKRLGRETPAKYSLGKAQFNGSDALDQGLNPLELSTPSSRGISATEGPAPEASAPPVRPGPVQQKWALVIGIGNFTDSEIPQLHYTTADATAFAAALEDPTIGQFPADNVHVLTDEQAT
Ga0187783_1048105423300017970Tropical PeatlandMRIQRQYVFTLALLTAALWATPRATSQGARCGAGRDLVVQALERITPQSGSADFDAALQLLKHANSVCTELGDAWYYRSLVEQHLGHASLATYAMDKAKLIGSEALDQNLNPLVLSTPASRGISAEPNNNVLPAPPVKLGSIQQKWALVIGIGHFTDSGIPALHYTTADANSFAAAL
Ga0187781_1002821913300017972Tropical PeatlandMSFRTPSCLALAAWLAAALAASPRACAEGVRCGAGQDLVIQALERITPQSSNDVFVDAPELLKHAVAECPELGDAWYYRSLVEKRLGHDSLANYAMDKARFNGSDAMNQGLNPLVLSTPASRGFETDQSTTPAPAAPAARPGPVQQKWALVVGIGQFTDAQIPRLDYTTADANSFADALK
Ga0187782_1057987123300017975Tropical PeatlandMNPHHPSNFFFPALLAVSLCVSPHAFSQNVKCGAGQDLVAQALERITPQSPDTDFVDALELLKHAVSACPELGDAWYYRSLVEQRLGHAPLAKYAMDKARFYGSDALDQNLNPLILSTPASRGFSEEAGTATPPSAPPVKPGPVQQKWALVVGIGNFTDAQIPKLNFTTADADAFAAALKDPNIGQFPA
Ga0187782_1152818713300017975Tropical PeatlandRFAVWALLAATLAACPCARAQGVRCGAGQDLVVQALERITPQSRDDAFQDALQLLKSAVAECPELGDAWYYRSLVEKRLGHDALANYAMDKARFNGSEALDQGLNPLVLSTPASRGIEAEGVETPVPVAPPVKPGPVQQKWALIVGIGHFTDKQIPQLNYTDADATAFAAALKD
Ga0187876_123500013300018003PeatlandRGRSLLAILPLLAATLLASPCARAQGIRCGAGQDLIVQALERITPQSGNDAFEDALQLLKSALAECPELGDAWYYRSLVEKRLGHDSLAKYAMDKAHFNGSEALDQDLNPLVLSTPASRGIEAEGTETPVPVAPPVKPGPVQQKWALVIGIGHFTDAQIPQLNYTGADATAFAAALKDPSIGGFPADNVHVLTDDQATTK
Ga0187865_117746613300018004PeatlandMNSRTRSELAILSLLAATLVASPRARAQGIRCGAGQDLIVQALERITPQSGNDAFEDALQLLKSAVAECPELGDAWYYRSLVEKRLGHDSLANYAMDKARFNGSDALDQNLNPLVLSTPASRGIEAEGVETPVPAAPPVKPGPVQQKWAL
Ga0187884_1011720713300018009PeatlandMNCRTRSGLAILSLLTATLLASPCARTQGIRCSAGQDLIVQALERITPQSGNDSFEDALQLLKHAVSVCPELGDAWYYRSLVEKRLGHDSLANYAMDKARFNGSEALDQDLNPLVLSTPASRGIEAEGTETPVPVAPPVKPGPVQQKWALVIGIGHFTDTQIPQLNYTGADATAFATALKDPSIGGFPADNVHVLT
Ga0187860_137681323300018014PeatlandMISPSRSRLALLPLLAAALIACPSARAQGARCGAGQDLIVQALERITPQSGNDAFEDALQLLKSAVAECPELGDAWYYRSLVEKHLGHDSLANYAMDKARFNSSEALDQGLNPLVLSTPASRSFEAESTETPVPAAPPVKPGPVQQ
Ga0187882_117895823300018021PeatlandMISPSRSRLALLPLLAAALIACPSARAQGARCGAGQDLIVQALERITPQSGNDAFEDALQLLKSAVAECPELGDAWYYRSLVEKHLGHDSLANYAMDKARFNSSEALDQGLNPLVLSTPASRGFEAESTETPVPVAPPVKPGPVQQKWALVVGIGHFTDKQIPQLNYTGSDAAAFATELKDPSIGGFPADNVHVLTDDQA
Ga0187881_1031981823300018024PeatlandMNSRTRSELAILSLLAATLIASPCARAQGIRCGAGQDLIVQALERITPQSGNDAFEDALQLLKSAVAECPELGDAWYYRSLVEKRLGHDALAKYAMDKARFNGSEALDQDLNPLVLSTPASRGIEAEGTETPVPVAPPVKPGPVQQKWALVIGIGHFTDAQIPQLNYTGADA
Ga0187885_1015812913300018025PeatlandMIARLPSRILLVALFALALGLAFGSWPRASAQEVRCGAGQDLVVQALERVTPQSGNDAFLDALELLKHAVSVCPELGDAWYYRSLVEKRLGHVSLAKYALDKARFNGSEALDQGLNPLELATPSSRGIPDNAPASAANAPPVRPGPVEQKWALVVGIGSFTDSEIPRLNYTTADADAFAAALKDPAIGE
Ga0187885_1026149513300018025PeatlandMISPSRSRLALLPLLAAALIACPSARAQGARCGAGQDLIVQALERITPQSGNDAFEDALQLLKSAVAECPELGDAWYYRSLVEKHLGHDSLANYAMDKARFNSSEALDQGLNPLVLSTPASRGFEAESTETPVPAAPPVKPGPVQQKWALVVGIGHFTDKQIPQLNYTGSDATAFAA
Ga0187867_1009890723300018033PeatlandMISPTRSRLALLPLLAATMIACPGVRAQGVRCGAGQDLIVQALERITPQSGNDAFEDALQLLKSAVAECPELGDAWYYRSLVEKRLGHDALANYAMDKARFNSSEALDQGLNPLVLSTPASRGFEAEGTETPVPAAPPVKPGPVQQKWALVVGIGHFTDKQIPQLNYTGADAAAFATELKDPSIGGFPADNVHVLTDDQAT
Ga0187867_1018645713300018033PeatlandMIRRLPSRILLVALFALAFGPWTRASAQTVRCGAGQDLVVQALERVTPQSGNDAFVDALELLKHAVSVCPELGDAWYYRSLVEKRLGHDALAKYALGKAQFNGSEALDQGLNPLILSTPASRGFEDAGTVTPVPVAPPVKPGPVQQKWALVIGIGHFTDAQIPQLNYTGADAAAFAAALKDPSIGGFPADNVH
Ga0187867_1027434723300018033PeatlandMIARLPSRILLVALLALAFGSWPRASAQEVRCGAGQDLIVQALERITPQSGNDAFLDALELLKHAVSVCPELGDAWYYRSLVEKRLGHDALAKYALDKARFNGSEALDQGLNPLELATPSSRGIPYKAPASEANAPPVSPGPVEQKWALIIGIGHFTDSEIPSLNYTTADATAFAAALEDPSIGQFPAANVHVLTDEQATTKNIKEQL
Ga0187875_1037600213300018035PeatlandMISPTRSRLALLPLLAATMIACPGVRAQGVRCGAGQDLIVQALERITPQSGNDAFEDALQLLKSAVAECPELGDAWYYRSLVEKRLGHDALANYAMDKARFNSSEALDQGLNPLVLSTPASRGFEAEGTETPVPAAPPVKPGPVQQKWALVVGIGHFTDKQIPQLNYTGADAAAFATELKDPSIG
Ga0187875_1061690313300018035PeatlandESQSDKEARGNRKARSRKMNSRTRSGLAILSLLAATLIASPCARAQGVRCGAGQDLVVQALERITPQSGNDAFEDALQLLKSAVAECPELGDAWYYRSLVEKRLGHDALAKYAMDKAHFNGSEALDQDLNPLVLSTPASRGIEAEGTETPVPVAPPVKPGPVQQKWALVIGIGHFTDAQIPQLNYTGADA
Ga0187875_1077187213300018035PeatlandPCARAQGIRCGAGQDLIVQALERITPQSGNDAFEDALQLLKSAVAECPELGDAWYYRSLVEKHLGHDSLANYAMDKARFNGSEALDQGLNPLILSTPASRGFEDAGTVTPVPVAPPVKPGPVQQKWALVIGIGHFTDAQIPQLNYTGADAAAFAAALKDPSIGGFPA
Ga0187883_1019367423300018037PeatlandMIRHLRSGILAAAFLAIALGGWSRARCESVRCGAGQDLVVQALERITPQSPNSDFDDALQLLKHAVSVCPELGDAWYYRSLVEQRLGHAPLAKYAMDKAHFYDSEALDQDLNPLILSTPASRGFTQEASTPAAPAAPPVKPGPVQQKWALIVGVGNFTDAQIPKLNYTTADADAFAAALKDPSIGQFPADNVQELTN
Ga0187883_1035021413300018037PeatlandMILLRKSVIFFAALLATSLVAWPRAASQEVKCGAGQDLVVQALERVTPQSDNDAFVDALELLKHAVSVCPELGDAWYYRSLVEKRLGHDSLAKYALDKAHFNNSEALDQGLNPLVLATPSSRGITADEAPAPEANAPPVRPGPVEQKWALVVGV
Ga0187883_1076125613300018037PeatlandTRSGLAILSLLAATLIASPCARAQGIRCGAGQDLVVQALERITPQSGNDAFEDALQLLKSAVAECPELGDAWYYRSLVEKRLGHDALAKYAMDKAHFNGSEALDQDLNPLVLSTPASRGIEAEGTETPVPVAPPVKPGPVQQKWALVIGIGHFTDAQIPQLNYTGADA
Ga0187855_1074676313300018038PeatlandESQSDKEARGNRKARSRKMNSRTRSGLAILSLLAATLIASPCARAQGVRCGAGQDLVVQALERITPQSGNDAFEDALQLLKSAVAECPELGDAWYYRSLVEKRLGHDALAKYAMDKAHFNGSEALDQDLNPLVLSTPASRGIEAEGTETPVPVAPPVKPGPVQQKWALVIGIGHFTDAQIPQLNYTGAD
Ga0187887_1093542113300018043PeatlandATLIASPCARAQGIRCGAGQDLIVQALERITPQSGNDAFEDALQLLKSAVAECPELGDAWYYRSLVEKHLGHDSLANYAMDKARFNGSEALDQGLNPLILSTPASRGFEDAGTVTPVPVAPPVKPGPVQQKWALVIGIGHFTDAQIPQLNYTGADAAAFAAALKDPSIGG
Ga0187851_1025646923300018046PeatlandMNQFHRSGILSVVLLSGALSACLHAYGESVRCGAGQDLVVQALEQFTPQSPNDDFENALQLLKHAVSVCPELGDAWYYRSLVEQRLGHAPLAKYAMDKAHFYGSDALDEGVNPLVLSTPASRGLSMEASTPAAPAAPVKPGPVQQKWALVVGVGNFTDTQIPKLNYTTADANAFADALKDPNIGQFPADNVHVLTDDQA
Ga0187851_1030278723300018046PeatlandMILLRKSVIFFAALLATSLVAWPRAASQEVKCGAGQDLVVQALERVTPQSDNDAFVDALELLKHAVSVCPELGDAWYYRSLVEKRLGHDSLAKYALDKAHFNNSEALDQGLNPLVLATPSSRGITADEAPAPEANAPPVRPGPVEQKWALVVGVGHFTDSEIPRLNYTTADATAFAAA
Ga0187851_1083861113300018046PeatlandPCARAQGIRCGAGQDLIVQALERITPQSGNDAFEDALQLLKSAVAECPELGDAWYYRSLVEKHLGHDSLANYAMDKARFNGSEALDQGLNPLILSTPASRGFEDAGTVTPVPVAPPVKPGPVQQKWALVIGIGHFTDAQIPQLNYTGADAAAFAAALKDPSIGGFPADNVHV
Ga0187859_1043590213300018047PeatlandRPAAAYQRRSQRADSGHNEGSGSEKACHNREASGRKMILLRKSVIFFAALLATSLVAWPRAASQEVKCGAGQDLVVQALERVTPQSDNDAFVDALELLKHAVSVCPELGDAWYYRSLVEKRLGHDSLAKYALDKAHFNNSEALDQGLNPLVLATPSSRGITADEAPAPEANAPPVRPGPVEQKWALVVGVGHFTDSEIPRLNYTTADATAFAAALEDPSIGQFPAANVHVLTDEQATTKN
Ga0187859_1068561413300018047PeatlandSEKACHNRKTCGRKMIRRLPSRILLVALVALALGLALGVGPRASAQTVRCGAGQDLVVQALERVTPQSGNDAFLDALELLKHAVSVCPELGDAWYYRSLVEKRLGHDALAKYALDKARFNGSEALDQGLNPLELATPASRGITAEEGPAPESSAPAVRPGPVQQKWALVVGIGHFTDSEIPRLNYTTADATAF
Ga0187858_1034373723300018057PeatlandMNSRTRSGLAILSLLAATLIASPCARAQGIRCGAGQDLIVQALERITPQSGNDAFEDALQLLKSAVAECPELGDAWYYRSLVEKRLGHDALAKYAMDKAHFNGSEALDQDLNPLVLSTPASRGIEAEGTETPVPVAPPVKPGPVQQKWALVIGIGHFTDAQIPQLNYTG
Ga0187858_1066992613300018057PeatlandRLPSRILLVALFALALGLAFGSWPRASAQEVRCGAGQDLVVQALERVTPQSGNDAFLDALELLKHAVSVCPELGDAWYYRSLVEKRLGHVSLAKYALDKARFNGSEALDQGLNPLELATPSSRGIPYKAPASEANAPPVSPGPVEQKWALIIGIGHFTDSEIPSLNYTTADATAFAAALEDPSIGQFPAANVHVLTDEQATTKNIKE
Ga0187784_1149989613300018062Tropical PeatlandRRREMSFRTPSCLALAAWLAAALAASPRACAEGVRCGAGQDLVIQALERITPQSSNDVFVDALELLKHAVAECPELGDAWYYRSLVEKRLGHDSLANYAMDKARFNGSDAMNQGLNPLVLSTPASRGFETDQSTTPAPAAPAARPGPVQQKWALVVGIGQFTDAQIPRLDYTTADANS
Ga0187852_110420623300019082PeatlandMNCRTRSGLAILSLLTATLLASPCARTQGIRCSAGQDLIVQALEHITPQSGNDSFEDALQLLKHAVSVCPELGDAWYYRSLVEKRLGHDSLANYAMDKARFNGSEALDQDLNPLVLSTPASRGIEAEGTETPVRVAPPVKPGPVQQKWALVIGIGHFTDTQIPQLNYTGADATAFATALKDPSIGAFPADNVHV
Ga0182031_127734613300019787BogSGGVSARVRRSECARFGRDENSRRETVETGGLKMIAHLPSRVLVVALLALAVRPCAFAQQVKCGAGRDLVVQALERVTPQSGNDAFVDALELLKHAVSVCPELGDAWYYRSLVEKRLGHDSLANYALGKAQFNGSEALDQGLNPLELSTPSSRGITATEGPAPEASAAPVRPGPVQEKWALVVGIGDFTDSEIPHL
Ga0210385_1124515513300021402SoilMIRTGRIGRLQIALPILLLGACTSATAQDDRCGAGKDLVVQALERITPQSSNDSFEDALQLLKHAVSECPELGDAWYYRSLVEKRLGHESLAKYAIEKARLNNSEALQQGLNPLVLSTPASRGLSAVPGSESPDARSNVRVGPVKQKWALVIGISRFADHSVPALRYTTADASGIADALKDP
Ga0210387_1065744823300021405SoilMIRAPKIRKIQIAFLFLLLTTGISMAQENRCGAGKDLVVQALERVTPQSSNDAFEDALQLLKHAVSECSELGDAWYYRSLVEKRLGHEALAKYAMDKARFNNSEALRQDLNPLVLSTPASRGLTAIPGSESAAPSAPVRAGPVKQKWALVVGIGQFADHSVPALR
Ga0210394_1042713223300021420SoilMIWIERIGRLQFALPILLIGTCVSATAQDNGCGAGKDLVVQALERITPRSSNDAFEDALQLLKHAVSECPELGDAWYYRGLVEKRLGHESLAKYAIDKARFNNSEALQQGLNPLVLSTPASRGLSTVAGSESPETPSNVRIGPVKQKWALVIGISRFADHSVPALRFTSADANGVADALK
Ga0208688_111663813300025480PeatlandESQSDKEARGNRKARSRKMNSRTRSGLAILSLLAATLIASPCARAQGIRCGAGQDLIVQALERITPQSGNDAFEDALQLLKSAVAECPELGDAWYYRSLVEKRLGHDALAKYAMDKAHFNGSEALDQDLNPLVLSTPASRGIEAEGTETPVPVAPPVKPGPVQQKW
Ga0209006_1042854713300027908Forest SoilMNSSKRSILVFLPLLFATLIAGPSAHAQGVRCGAGQDLIVQALEQITPQSDSKAFGDALELLKSALGECPELGDAWYYRSLVEKRLGHQALADYAMGKARFNSSEALDQGLNPLVLSTPASRGIEAEGVETPVPIAPPVKPGPVQQKWALVVGIGHFTDTKIPQLNYTGADATAFATALKDPTIGGFPADNVH
Ga0302153_1001343633300028574BogMIAHLPSRVLVVALLALAVRPCAFAQQVKCGAGRDLVVQALERVTPQSGNDAFVDALELLKHAVSVCPELGDAWYYRSLVEKRLGHDSLANYALGKAQFNGSEALDQGLNPLELSTPSSRGITATEGPAPEASAAPVRPGPVQEKWALVVGIGDFTDSEIPHLNYTTADATAFADALEDPAIGQFPTDNVH
Ga0302269_100698413300028766BogLLKHAVSVCPELGDAWYYRSLVEKRLGHDSLANYALGKAQFNGSEALDQGLNPLELSTPSSRGITATEGPAPEASAAPVRPGPVQEKWALVVGIGDFTDSEIPHLNYTTADATAFADALEDPAIGQFP
Ga0302197_1000126713300028873BogMIAHLPSRVLVVALLALAVRPCAFAQQVKCGAGRDLVVQALERVTPQSGNDAFVDALELLKHAVSVCPELGDAWYYRSLVEKRLGHDSLANYALGKAQFNGSEALDQGLNPLELSTPSSRGITATEGPAPEASAAPVRPGPVQEKWALVVGIGDFTDSEIPHLNYTTADATAFADALEDPAIGQFPTDNV
Ga0311361_1103764323300029911BogMIAQLPSRVLVVALLALAVRPCAFAQQVKCGAGRDLVVQALERVTPQSGNDAFVDALELLKHAVSVCPELGDAWYYRSLVEKRLGHDSLANYALGKAQFNGSEALDQGLNPLELSTPSSRGITATEGPAPEASAAPVRPGPVQEKWALVVGIGDFTDSEIPHLNYTTADATAFADALE
Ga0302148_122985513300029916BogRNRWPSRVVCLALLAAAASVCSSAWGQGDRCGAGKDLVVQALERISPQSDQSAFEDALQLLKHAVSECGELGDGWYYRSLVEQRLGHDALAKYAMDKARFTGSEALRQGLNPLVLATPAGRGLVAEGDETKTPDTPAAAPGPVQQKWALVIGIGRFSDRSIPRLNYTTADANAI
Ga0311343_1036306813300029953BogMIVLRKTGILLVAMFTTMLGAHPRAACQEVKCGAGQDLVVQALERITPQSGNDGFIDALELLKHAVSVCPELGDAWYYRSLVEKRLGHDSLAKYALDKAHFNGSEALDQGLNPLVLATPSSRGISAGEAPAPEANAPQVRPGPVEQKWALVVGIGQFTDSEIPRLNY
Ga0311344_1054611113300030020BogMIVLRKTGILLVAMFTTMLGAHPRAACQEVKCGAGQDLVVQALERITPQSGNDGFIDALELLKHAVSVCPELGDAWYYRSLVEKRLGHDSLAKYALDKAHFNGSEALDQGLNPLVLATPSSRGISAGEAPAPEANAPQVRPGPVEQKWALVVGIGQFTDSEIPRLNYTTADATAFAAAL
Ga0302274_1010537123300030041BogMRNSWPSRLVCLVILTTAAVVCSPASAQGTRCGAGKDLVVQALERITPQGDNNAFEDALQLLKHAVSECSELGDAWYYRSLVEQRLGHDALAKYAMDKARFNGSEALQQALNPLVLATPASRGLTAEGDQTTPDTPPVKPGPVQQKWALVIGIGRFSDRTIPRLNYTTADA
Ga0265332_1030362023300031238RhizosphereMNSRTRSGLAILSLLAATLVASPCARAEGIRCGAGQDLIIQALERITPQSGNDAFVDALELLKSALAECPELGDAWYYRSLVEKRLGHDSLANYAMGKARFNGSEALDQDLNPLTLSTPASRGIEAEGSQTPVPVAPPVKPGP
Ga0265325_1005486513300031241RhizosphereMNSYTRSGLAILSLLAATLVASPCARAQGIRCGAGQDLIIQALERITPQSDNKAFGDALELLKSALSECPELGDAWYYRSLVEKRLGHDSLATYAMGKARFNGSEALDQDLNPLILSTPASRGIEAEGTQTPVPVAPPVKPGPVQQKWALVI
Ga0265313_1014009913300031595RhizosphereMISPTRSRLAVFSLLAATLIACPCARAQGVRCGAGHDLIVQALERITPQSGNGAFVDALELLKSALSECPELGDAWYYRSLVEKRLGHDSLADYAMGKARFNGSDALDQGLNPLILSTPASRGFEAEGPQTPVPAAPPVKPGPVQQKWALVVGIGHFTDKQIPQLNYTGADAT
Ga0310686_10478159113300031708SoilMNRVTRSGIFVLALCIAGLGSSSRAIGQGIRCGAGQDLVVQALERITPQSPNDAFNDALQLLKHANAECPELGDAWYYRSLVEQHLGQASLAKYAMDKARFNGSEALDQGLNPLILSTPSSRGFSAEEATTPVPAAPPVKPGPVQQKWALVMGIGHFTDGEIPALHYTTADATAFAAALKDPNIGAF
Ga0310686_10807426823300031708SoilMISPSRLRIPVLPLLAATLLALPSAHAQGVRCGAGQDLIVQALEQITPQSDSKAIGDALELLKSALGECPELGDAWYYRSLVEKRLGHQALADYAMGKARFNGSDALDQGLDPLVLATPASRGIEAEGVETPVPVAPPVKPGPVQQKWALVV
Ga0311301_1112512023300032160Peatlands SoilMIRRSPFSIPVATLVALVLCVCLPARGESLRCGAGQDLVVQALERVTPQSPNSDFDDALQLLKHAVSSCPELGDAWYYRSLVEQKLGHAPLAKYALDKAHFYGSDALDDGLNPLILATPAARGFSMEQASTPAAPAAPVKPGPVQQKWALVIGIGDFTDAQIPKLNYTTADADAFADALKDPNIGQFPADNVHVLTD
Ga0335079_1154863523300032783SoilMRAHFPSGTMIFALLSAALVVSPRLTAEGIRCGAGQDLVVQALERITPQSGNDAFQDALELLKHAVSECPELGDAWYYRSLVERRLGHTALANYAMDKARFNGSDALNDSLNPLELSTPASRGFETDQGTTPVPTAPPVRPGPVQQKWALIVGIGQFTDVQIPRLNFT
Ga0335078_1167377013300032805SoilMTRGGRIHMDRNRIFAVTLLAAALGVGSRASAQGIRCGAGQDLVVQALERVTPQSGNDAFEDALQLLKSAIAECPELGDAWYYRGLVEKRLGHAALATYAMDKARFNGSDALAQGLNPLVLSTPASRGISAEAGTEAPVPAAPVKPGPVRQKWALVIGISQFTDSKIPHLNYTTADANAFAAALEDPSIGQ
Ga0335078_1208809013300032805SoilHQRDETSRREKDHARDIHKNCFTCRQTRGVTLNMNRSFAILAVALAATALSASPRAFSQDVKCGAGQDLVVQALERVTPQSPDSDFVDALELLKHAVSTCPELGDAWYYRSLVEQRLGHAPLARYALEKAHFYGSEALDQNLNPLILSTPASRGFSEEASTPAAPAAPPVKPGPVQQKWALVVGVGNFTDAQVPRLNFTT
Ga0335072_1079692813300032898SoilMIRSWRIHMIRIQILVVALLAAACGASPRASAQGIRCGAGQDLVVQALERITPQSGNDAFEDALQLLKSAVAECPELGDAWYYRSLVEKRLGHAALANYAMDKARFNGSEALDQGLDPLVLSTPASRGIAAEEGTETPVPAPVVKPGPVRQKWALVIGISQFTDHEIPHL
Ga0335073_1034130023300033134SoilMKGFSRSGLSVLPVLTAVLIFCPRSQAQDVRCGAGQDLVVQALERITPQSGDDAFEDALELLKSAVAECPELGDAWYYRSLVEKRLGHTALANYSLDKARFNGSEALNQGLDPLILSTPASRGFEATESTTPVPAAPPVRPGPVQQKWALVVGISHFTDSEIPKLNFTTADAKSFAAALEDPNIGGFP
Ga0326728_1020517313300033402Peat SoilMTLRIRPVAVILALLAATLFAHPRAAAQGIRCGAGQDLVVQALERITPQSGNDAFQDALELLKHAVSECPELGDAWYYRSLVEKRLGHDALASYAMDKARFNGSEALDDGLNPLVLSTPASRGFETDQGTTLAPAAPPVHPGPVQQKWALVVGIGQFTDTQIPHL
Ga0334804_075748_466_9093300033818SoilMNSRTRSGLAILSLLAATLIASPCARAQGIRCGAGQDLIVQALERITPQSGNDAFEDALQLLKSAVAECPELGDAWYYRSLVEKRLGHDALAKYAMDKAHFNGSEALDQDLNPLVLSTPASRGIEAEGTETPVPVAPPAKPGPVQQKW
Ga0334828_137520_3_4823300033822SoilVVQALERVTPQSGNDAFVDALELLKHAVSVCPELGDAWYYRSLVEKRLGHDSLANYALGKAQFNGSEALDQGLNPLELSTPSSRGITATEGPAPEASAAPVHPGPVQQKWALVVGIGDFTDSEIPHLNYTTADATAFADALEDPAIGQFPTDNVHLLTDK
Ga0334850_024499_684_11273300033828SoilMIRRVSIPILALLATLLCFGPHARGESVRCGAGQDLVVQALERVTPQSPNDTFQDALELLKHAVSVCPELGDAWYYRSLVEQRLGHAPLAKYALDKAHFYGSDALDQSLNPLILSTPASRGFSQEAATPAAPAAPVKPGPVQQKWALV
Ga0314861_0230190_1_4863300033977PeatlandMKSSRPSGILLLASLAAALGASTSVYAQGIRCGAGQDLVVQALERITPQSDNGAFEDALQLLKHAVAVCPELGDAWYYRSLVEQRLGHDSLAKYAMDKARFNGSEALDQGWNPLVLATPASRGIAPVAGTGTPAPGAPPVRPGPVAQKWALVVGIGHFTDGE
Ga0370515_0521731_1_5013300034163Untreated Peat SoilRAQGIRCGAGQDLIVQALEQITPQSGNDAFENALQLLKSAVAECPELGDAWYYRSLVEKRLGHDALANYAMDKARFNSSEALDQGLNPLVLATPASRGIEAEGVETPVPVAPPVKPGPVQQKWALVVGIGHFTDAKIPQLNYTGADATAFATALKDPTIGGFPADNV


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.