Basic Information | |
---|---|
Family ID | F088051 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 109 |
Average Sequence Length | 57 residues |
Representative Sequence | MARTMGNGFQKLQIALAMTNIDLVIIMPAPEEPENPVRAQNEADDAWAIREKAHDIA |
Number of Associated Samples | 87 |
Number of Associated Scaffolds | 109 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Eukaryota |
% of genes with valid RBS motifs | 0.93 % |
% of genes near scaffold ends (potentially truncated) | 13.76 % |
% of genes from short scaffolds (< 2000 bps) | 91.74 % |
Associated GOLD sequencing projects | 87 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.35 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Eukaryota (63.303 % of family members) |
NCBI Taxonomy ID | 2759 |
Taxonomy | All Organisms → cellular organisms → Eukaryota |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (80.734 % of family members) |
Environment Ontology (ENVO) | Unclassified (93.578 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (58.716 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.12% β-sheet: 0.00% Coil/Unstructured: 45.88% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 109 Family Scaffolds |
---|---|---|
PF14223 | Retrotran_gag_2 | 28.44 |
PF07727 | RVT_2 | 2.75 |
PF00665 | rve | 2.75 |
COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
---|---|---|---|
COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 2.75 |
COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 2.75 |
COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 2.75 |
COG4584 | Transposase | Mobilome: prophages, transposons [X] | 2.75 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 63.30 % |
Unclassified | root | N/A | 36.70 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300005365|Ga0070688_101710905 | Not Available | 515 | Open in IMG/M |
3300009975|Ga0105129_112628 | Not Available | 596 | Open in IMG/M |
3300009992|Ga0105120_1010552 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 898 | Open in IMG/M |
3300009992|Ga0105120_1023500 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 694 | Open in IMG/M |
3300009994|Ga0105126_1026003 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 665 | Open in IMG/M |
3300009995|Ga0105139_1066166 | Not Available | 664 | Open in IMG/M |
3300010371|Ga0134125_12852561 | Not Available | 525 | Open in IMG/M |
3300010400|Ga0134122_11500936 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 693 | Open in IMG/M |
3300014968|Ga0157379_12275508 | Not Available | 539 | Open in IMG/M |
3300015290|Ga0182105_1014583 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 958 | Open in IMG/M |
3300015293|Ga0182103_1004813 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 1233 | Open in IMG/M |
3300015301|Ga0182184_1059901 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 603 | Open in IMG/M |
3300015306|Ga0182180_1049815 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 633 | Open in IMG/M |
3300015309|Ga0182098_1006216 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa | 1270 | Open in IMG/M |
3300015309|Ga0182098_1036811 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 768 | Open in IMG/M |
3300015309|Ga0182098_1080871 | Not Available | 593 | Open in IMG/M |
3300015310|Ga0182162_1102807 | Not Available | 549 | Open in IMG/M |
3300015311|Ga0182182_1004114 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta | 1477 | Open in IMG/M |
3300015312|Ga0182168_1022059 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 955 | Open in IMG/M |
3300015312|Ga0182168_1059244 | Not Available | 691 | Open in IMG/M |
3300015313|Ga0182164_1010462 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 1198 | Open in IMG/M |
3300015315|Ga0182120_1030988 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 867 | Open in IMG/M |
3300015316|Ga0182121_1013410 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1171 | Open in IMG/M |
3300015316|Ga0182121_1038895 | Not Available | 835 | Open in IMG/M |
3300015316|Ga0182121_1039809 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 828 | Open in IMG/M |
3300015324|Ga0182134_1036393 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 840 | Open in IMG/M |
3300015325|Ga0182148_1020160 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 989 | Open in IMG/M |
3300015326|Ga0182166_1023550 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 939 | Open in IMG/M |
3300015327|Ga0182114_1059912 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 746 | Open in IMG/M |
3300015327|Ga0182114_1070357 | Not Available | 704 | Open in IMG/M |
3300015329|Ga0182135_1070131 | Not Available | 684 | Open in IMG/M |
3300015329|Ga0182135_1089139 | Not Available | 626 | Open in IMG/M |
3300015330|Ga0182152_1003510 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 1702 | Open in IMG/M |
3300015331|Ga0182131_1025085 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 970 | Open in IMG/M |
3300015335|Ga0182116_1100522 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 646 | Open in IMG/M |
3300015335|Ga0182116_1156183 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 536 | Open in IMG/M |
3300015336|Ga0182150_1082513 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 664 | Open in IMG/M |
3300015337|Ga0182151_1044280 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 829 | Open in IMG/M |
3300015337|Ga0182151_1116992 | Not Available | 581 | Open in IMG/M |
3300015337|Ga0182151_1166552 | Not Available | 502 | Open in IMG/M |
3300015339|Ga0182149_1142654 | Not Available | 547 | Open in IMG/M |
3300015340|Ga0182133_1160288 | Not Available | 545 | Open in IMG/M |
3300015348|Ga0182115_1306813 | Not Available | 500 | Open in IMG/M |
3300015352|Ga0182169_1143358 | Not Available | 777 | Open in IMG/M |
3300015352|Ga0182169_1168959 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 715 | Open in IMG/M |
3300015352|Ga0182169_1302983 | Not Available | 515 | Open in IMG/M |
3300015353|Ga0182179_1035786 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1283 | Open in IMG/M |
3300015353|Ga0182179_1223610 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 603 | Open in IMG/M |
3300015354|Ga0182167_1274866 | Not Available | 603 | Open in IMG/M |
3300017412|Ga0182199_1125345 | Not Available | 611 | Open in IMG/M |
3300017414|Ga0182195_1201072 | Not Available | 523 | Open in IMG/M |
3300017432|Ga0182196_1134989 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 530 | Open in IMG/M |
3300017439|Ga0182200_1151446 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 517 | Open in IMG/M |
3300017445|Ga0182198_1137797 | Not Available | 586 | Open in IMG/M |
3300017445|Ga0182198_1178105 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 530 | Open in IMG/M |
3300017693|Ga0182216_1060016 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 839 | Open in IMG/M |
3300020031|Ga0182119_105925 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 538 | Open in IMG/M |
3300020223|Ga0182118_107590 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 621 | Open in IMG/M |
3300025972|Ga0207668_11928167 | Not Available | 533 | Open in IMG/M |
3300026088|Ga0207641_11262852 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 739 | Open in IMG/M |
3300028055|Ga0268338_1009569 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 802 | Open in IMG/M |
3300028056|Ga0268330_1027768 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 672 | Open in IMG/M |
3300028061|Ga0268314_1028471 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 634 | Open in IMG/M |
3300028142|Ga0268347_1027577 | Not Available | 543 | Open in IMG/M |
3300028251|Ga0268324_1023827 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 520 | Open in IMG/M |
3300028253|Ga0268316_1024418 | Not Available | 507 | Open in IMG/M |
3300028468|Ga0268317_1005407 | Not Available | 652 | Open in IMG/M |
3300028476|Ga0268329_1009662 | Not Available | 701 | Open in IMG/M |
3300028477|Ga0268309_1009084 | Not Available | 647 | Open in IMG/M |
3300032464|Ga0214492_1069126 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 679 | Open in IMG/M |
3300032465|Ga0214493_1000389 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera | 4425 | Open in IMG/M |
3300032465|Ga0214493_1048270 | Not Available | 1000 | Open in IMG/M |
3300032466|Ga0214503_1100102 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 901 | Open in IMG/M |
3300032467|Ga0214488_1064528 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 811 | Open in IMG/M |
3300032469|Ga0214491_1027984 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 1300 | Open in IMG/M |
3300032469|Ga0214491_1041633 | Not Available | 1093 | Open in IMG/M |
3300032490|Ga0214495_1007706 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 2017 | Open in IMG/M |
3300032490|Ga0214495_1084273 | Not Available | 738 | Open in IMG/M |
3300032502|Ga0214490_1039888 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1047 | Open in IMG/M |
3300032514|Ga0214502_1092154 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1145 | Open in IMG/M |
3300032550|Ga0321340_1022335 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 893 | Open in IMG/M |
3300032551|Ga0321339_1034638 | Not Available | 1121 | Open in IMG/M |
3300032589|Ga0214500_1201984 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 562 | Open in IMG/M |
3300032590|Ga0214489_1004219 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1736 | Open in IMG/M |
3300032591|Ga0214484_1000305 | Not Available | 4151 | Open in IMG/M |
3300032591|Ga0214484_1007536 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 1833 | Open in IMG/M |
3300032689|Ga0214497_1084710 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 696 | Open in IMG/M |
3300032698|Ga0214485_1039331 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 904 | Open in IMG/M |
3300032760|Ga0314754_1012478 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 1283 | Open in IMG/M |
3300032760|Ga0314754_1016185 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 1152 | Open in IMG/M |
3300032761|Ga0314733_1006933 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 1735 | Open in IMG/M |
3300032822|Ga0314740_1061610 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 560 | Open in IMG/M |
3300032843|Ga0314736_1016231 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 950 | Open in IMG/M |
3300032844|Ga0314743_1006311 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 2212 | Open in IMG/M |
3300032845|Ga0314727_1000225 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera | 3688 | Open in IMG/M |
3300032889|Ga0314751_1076687 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 678 | Open in IMG/M |
3300032913|Ga0314739_1001188 | Not Available | 3108 | Open in IMG/M |
3300032914|Ga0314750_1098195 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 682 | Open in IMG/M |
3300032916|Ga0314734_1005030 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 2002 | Open in IMG/M |
3300032934|Ga0314741_1091873 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 703 | Open in IMG/M |
3300032959|Ga0314738_1085585 | Not Available | 555 | Open in IMG/M |
3300033526|Ga0314761_1008317 | Not Available | 1870 | Open in IMG/M |
3300033526|Ga0314761_1025168 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta | 1251 | Open in IMG/M |
3300033530|Ga0314760_1059390 | Not Available | 947 | Open in IMG/M |
3300033531|Ga0314756_1027667 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1007 | Open in IMG/M |
3300033533|Ga0314770_1176605 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 671 | Open in IMG/M |
3300033534|Ga0314757_1086562 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 755 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 80.73% |
Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 8.26% |
Switchgrass Associated | Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated | 4.59% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.75% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.92% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.92% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.92% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.92% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
3300009975 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_187 metaG | Host-Associated | Open in IMG/M |
3300009992 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaG | Host-Associated | Open in IMG/M |
3300009994 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaG | Host-Associated | Open in IMG/M |
3300009995 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG | Host-Associated | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015290 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015293 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015301 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015306 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015309 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015310 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015311 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015312 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015313 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015315 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015316 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015324 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015325 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015326 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015327 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015329 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015330 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015331 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015335 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015336 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015337 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015339 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015340 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015348 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015352 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015353 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015354 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017412 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017414 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017432 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017439 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017445 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017693 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300020031 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_31MAY2016_LD2 MG | Host-Associated | Open in IMG/M |
3300020223 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_31MAY2016_LD2 MG | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028055 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028056 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
3300028061 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028142 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028251 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
3300028253 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028468 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028476 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
3300028477 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300032464 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032465 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032466 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12SEP2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032467 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_31MAY2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032469 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032490 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032502 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032514 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12SEP2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032550 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032551 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_31MAY2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032589 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032590 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_31MAY2016_LR3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032591 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032689 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12JUL2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032698 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032760 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032761 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032822 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032843 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032844 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032845 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_05JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032889 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032913 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032914 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032916 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032934 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032959 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033526 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033530 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033531 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033533 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_18SEP2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033534 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0070688_1017109051 | 3300005365 | Switchgrass Rhizosphere | MARTMGNGFQKLQNTLAMANIDLAIIMPAPEAPENPLRAQNEADDAWAIREKAHDIAWTK |
Ga0105129_1126281 | 3300009975 | Switchgrass Associated | MARTMGNGFQKLLIALAMTNIDFAIIMPDPEEPENPVRAQNKADDAWAIRPKAHDIGWTKIENSAGTLEYF* |
Ga0105120_10105521 | 3300009992 | Switchgrass Associated | MARTMGNDFHKLPIALAMTNIDLAIIMPALEEPENPVRAQNKAHDAWAI* |
Ga0105120_10235001 | 3300009992 | Switchgrass Associated | MARTMGNDFQKLRIALTMANIDSAIIMPAPEEPENPVKAQNEADDAWANREKDHDIA* |
Ga0105126_10260033 | 3300009994 | Switchgrass Associated | MGRTMGNGFQKLQNTLAMANIDLAIIMPAPEEPENSVRAQNEADDAWAIRGKAHDIAWTKWDI* |
Ga0105139_10661661 | 3300009995 | Switchgrass Associated | MPFQNEMTRTMGNVFQKLQIALAMANIDLAITMPAQEELENTVRTQNKANDACAIRGIAHDVA* |
Ga0134125_128525611 | 3300010371 | Terrestrial Soil | MGNIFQKLQIALAMTNIDFAIIMPDPEEPENPVRAQNKADDAWAIRQKAHDIGWTKIENSAGTL |
Ga0134126_124869781 | 3300010396 | Terrestrial Soil | MRNGFQKLQIALAMNNIDLTIIMPAPEEPKNPVRAQNKADDAWAI* |
Ga0134122_115009363 | 3300010400 | Terrestrial Soil | MARTIENNFQKLRIALAMANIDSAIIMPAPEEPENPVRAQNEADDAWAIREKDHDIA* |
Ga0157379_122755081 | 3300014968 | Switchgrass Rhizosphere | MAKTMGNGFQKLQIALARTNIDLSIIMPAPEEPKNPVRAQNEANDAWAIR* |
Ga0182105_10145833 | 3300015290 | Switchgrass Phyllosphere | MARTMGNDFQKLQIALAMANIDLAIIMPAPEEPENSVRAQNEADDAWAIRGKAHDIAWTKWDI* |
Ga0182103_10048132 | 3300015293 | Switchgrass Phyllosphere | MARTMGNDFQKLRIALTMANIDSAIIMPVPEKPENPVRAQNEADDAWAIREKDHDIA* |
Ga0182184_10599013 | 3300015301 | Switchgrass Phyllosphere | MARTMGNGFQKLQIALAMTNIDLVIIMPAPEEPENPVRAQNEADDAWAIREKAHDIA* |
Ga0182180_10498151 | 3300015306 | Switchgrass Phyllosphere | NDFQKLRIALTMANIDSAIIMPVPEKPENPVRAQNEADDAWAIREKDHDIA* |
Ga0182098_10062161 | 3300015309 | Switchgrass Phyllosphere | MGNIFQKLQIALAMTNIDFAIIMPDPEEPENPVRAQNKVDDAWAIRQKAHAIAWTK* |
Ga0182098_10368112 | 3300015309 | Switchgrass Phyllosphere | MARTIGNNFQKLRIALAMANIDSTIIMPAPVEPENPVKAQNEADDACAIREKAHDIA* |
Ga0182098_10808711 | 3300015309 | Switchgrass Phyllosphere | MARTLGKSFQKLQIGLAMTNIDLAIIMPALEDPENPVRDANEADDAWAIQQKAHDIAWTK |
Ga0182162_11028071 | 3300015310 | Switchgrass Phyllosphere | MARTMGNGFQKLQIALAMTNIDLVIIMPAPEEPENPVRAQNKADDAWAIRKKAHDIAWTK |
Ga0182182_10041141 | 3300015311 | Switchgrass Phyllosphere | MARTMGNDFQKLRIALTMANIDSAIIMPAPEEPENPVKAQNEADDACAIREKAHDIA* |
Ga0182168_10220592 | 3300015312 | Switchgrass Phyllosphere | MAKTMRNDFQKLRIALTMANIDSAIIMPAPEEPENPVRAQNEADDAWAIREKAHDIA* |
Ga0182168_10592441 | 3300015312 | Switchgrass Phyllosphere | MARTIGNGFQKLQIALAMNNIDLTIIMPAPEEPKNPVRAQNKADDAWPIRKKAHDIAWTK |
Ga0182164_10104621 | 3300015313 | Switchgrass Phyllosphere | MARTMVNDFQKLRIALTMANIDSAIIMPAPEEPENPVRAQNEADDAWSIREKDHDIA* |
Ga0182120_10309881 | 3300015315 | Switchgrass Phyllosphere | MARTIGNGFQKLQIALTMANIDLAIIMPAPEAPKNHVRTQNEADDAWAIREKAHDIAWTK |
Ga0182121_10134103 | 3300015316 | Switchgrass Phyllosphere | MARTIGNNFQKLRIALAMANIDSAIIMPAPEEPENPVKAQNEADDACAIREKAHDIA* |
Ga0182121_10388951 | 3300015316 | Switchgrass Phyllosphere | MGNSFQKLQIALAMTNIDFAIIKPDPEEPENPVRAQNKADDAWAIR |
Ga0182121_10398091 | 3300015316 | Switchgrass Phyllosphere | MARTMGNDFQKLQIALAIANIDLAIIMPAPEEPENSVRAQNEADDAWAIREKAHDIAWTK |
Ga0182134_10363933 | 3300015324 | Switchgrass Phyllosphere | MARTMRNDFQKLRIALTMANIDSAIIMPAPEEPENPVRAQNEADDAWAIREKAHDIA* |
Ga0182148_10201602 | 3300015325 | Switchgrass Phyllosphere | MARTMGNDFQKLRIALTMANIDSAIIMPAPEEPENPVRAQNEADDAWAIREKAHDIA* |
Ga0182166_10235501 | 3300015326 | Switchgrass Phyllosphere | MARTMGNDFQKLRIALTMANIDSAIIMLALEEPENPVRAQNEADDAWAIREKAHDIA* |
Ga0182114_10599123 | 3300015327 | Switchgrass Phyllosphere | MARTMGNDFQKLRIALTMANIDSAIIMPVPEKPENPVRAQNEADDAWAIREKAHDIA* |
Ga0182114_10703571 | 3300015327 | Switchgrass Phyllosphere | MARTMGNVFQKSQTALGMAIIDLTIIMPTPEEPENPIRTQNKADDAWAIQQKAHDITWTK |
Ga0182135_10701311 | 3300015329 | Switchgrass Phyllosphere | MPFQNEMARTMGNVFQKLQIALAMANIDLAIIMPAPEEPENPVRNQNKANDACAIRGIAHDVA |
Ga0182135_10891391 | 3300015329 | Switchgrass Phyllosphere | MGNGFQKLQIALARTNIDLSIIMPAPEEPKNPVRAQNEANDAGAIR* |
Ga0182152_10035102 | 3300015330 | Switchgrass Phyllosphere | MARTMGNNFQKLRIALAMANIDSAIIMPAPEEPENPVRAQNEADDAWAIREKDHDIA* |
Ga0182131_10250851 | 3300015331 | Switchgrass Phyllosphere | MARTIGNNFQKLRIALAIANIDSAIIMPAPEEPENPVKAQNEADDACAIREKAHDIA* |
Ga0182116_11005221 | 3300015335 | Switchgrass Phyllosphere | MARTMGNEFQKLQIALAMTNIDLAIIMPAPKEPENPVRAQNKADDAWAI* |
Ga0182116_11561831 | 3300015335 | Switchgrass Phyllosphere | MARTMGNNFEKSQIDLAMVNIDLAIIMPAPEEPENLVMAQNEADDAWTIRGKAYDIA* |
Ga0182150_10825131 | 3300015336 | Switchgrass Phyllosphere | MARTMENGFQKLQIALAMTNIDLTIIMPAPEEPENPVRAQKQADDAWAI* |
Ga0182151_10442802 | 3300015337 | Switchgrass Phyllosphere | MARTMENGFQKLQIALAMTNIDLTIIMPALEEPENPMRAQNEADDAWAIREKDHDIA* |
Ga0182151_11169921 | 3300015337 | Switchgrass Phyllosphere | MTRTMGNGFQKLLIALAMTNIDLAIIMPAPEEPENPMKAQNEADDTWVIREKAHDIGWTKWDIQHA* |
Ga0182151_11665521 | 3300015337 | Switchgrass Phyllosphere | MARTMGNGFQKLQIALAMTNIDLAIIMPAPEEPKNPVRAQNKADDASAI* |
Ga0182149_10114481 | 3300015339 | Switchgrass Phyllosphere | MARTMGNVFQKSQTALGMAIIDLTIIMPTPEEPENPMRAQNEADDAWAI* |
Ga0182149_11426541 | 3300015339 | Switchgrass Phyllosphere | MGNGFQKLQIALAMTNIDLAIVMPAPEDPENPVRVQNKADDAWTIRQKAHDIVWTKIENSAGTLEYF* |
Ga0182133_11602881 | 3300015340 | Switchgrass Phyllosphere | MARTMGNDFQKLRIALTMANIDSAIIMPAPEEPENPVRAQNEVDDAWAIREKDHDIA* |
Ga0182115_13068131 | 3300015348 | Switchgrass Phyllosphere | MARTMGNEFQKLQIALAMTNIDLAIIMLAPEEPENPVRAQNKADGAWAIR* |
Ga0182169_11433581 | 3300015352 | Switchgrass Phyllosphere | MARTMGNIFQKLQIALAMANIDLAITMPAPEELENTVRIQNKANDAWAIRGIAHDVA* |
Ga0182169_11689592 | 3300015352 | Switchgrass Phyllosphere | MARTMENNFQKSQIDLAMVNIDLAIIMPAPEEPENLVMAQNEADDAWTIRGKAYDIA* |
Ga0182169_13029831 | 3300015352 | Switchgrass Phyllosphere | MGNGFQKLLIALAMTNIDLAIIMSPPEELENPVRAQNKAGDAWAIRQKAHDIAWTKWEI* |
Ga0182179_10357861 | 3300015353 | Switchgrass Phyllosphere | MARTMGNDFQKLRIALTMANIDSAIIMPAPEKPENPVRAQNEADDAWAIREKDHDIA* |
Ga0182179_12236101 | 3300015353 | Switchgrass Phyllosphere | MARTMRNGFQKLQIALAMANIDLAIIMPAPEAPENPLRAQNEADDSWAIREKAHDIAWTK |
Ga0182167_12748661 | 3300015354 | Switchgrass Phyllosphere | MARTMGNGFQKLQIALVMTNIDLAIIKPAPEEPENPVRAQNKEDDAWAIRQKAHDIAW |
Ga0182199_11253451 | 3300017412 | Switchgrass Phyllosphere | MGNGFQKLQLALAMANIDLAIIMLAPEEPENPVRAQNKADGAWAIRQKTHDIAWTK |
Ga0182195_12010721 | 3300017414 | Switchgrass Phyllosphere | MARTIGNGFQKLQIALAMANIDLAIIMPVLEEPENPVRAQNEADDAXAIREKAHDIAWTKWD |
Ga0182196_11349891 | 3300017432 | Switchgrass Phyllosphere | QKLQIALAIANIDLAIIMPAPEEPENSVRAQNEADDAWAIRGKAHDIAWTKWDI |
Ga0182200_11514461 | 3300017439 | Switchgrass Phyllosphere | MRNDFQKLRIALTMANIDSAIIMLALEEPKNPVRAQNEADDAWAIREKAHDIA |
Ga0182198_11377972 | 3300017445 | Switchgrass Phyllosphere | MGNGFQKLQNTLAMANIDLAIIMPALEEPENPVRAQNKADGAWAIRQKAHDIAWTK |
Ga0182198_11781053 | 3300017445 | Switchgrass Phyllosphere | DFQKLQIALAMANIDLAIIMPAPEEPENSVRAQTEADDAWAIRGKAHDIAWTKWDI |
Ga0182216_10600162 | 3300017693 | Switchgrass Phyllosphere | MGNDFQKLRIALTMANIDSAIIMPAPEKPENPVRAQNEADDAWAIREKDHDIA |
Ga0182119_1059251 | 3300020031 | Switchgrass Phyllosphere | MRNDFQKLRIALTMANIDSAIIMPAPEEPENPVRAQNEADDAWAIREKDHDIA |
Ga0182118_1075902 | 3300020223 | Switchgrass Phyllosphere | MGNDFQKLRIALTMANIDSAIIMPAPEEPENPVKAQNEADDACAIREKAHDIA |
Ga0207668_119281672 | 3300025972 | Switchgrass Rhizosphere | MGNGFHKLQIALAMTNIDLTIIMPAPEEPENPVRAQNKADGAWAIRQKDHDIAWTK |
Ga0207641_112628521 | 3300026088 | Switchgrass Rhizosphere | MAKTMRNDFQKLRIALTMANIDSAIIMPAPEEPENPVRAQNEADDAWAIREKAHDIA |
Ga0268338_10095691 | 3300028055 | Phyllosphere | MGNDFQKLRIALTMANIDSAIIMLALEEPENPVRAQNEADDAWAIREKDHDIA |
Ga0268330_10277681 | 3300028056 | Phyllosphere | MGNDFQKLRIALTMANIDSAIIMPAPEEPENPVRAQNEADDAWAIREKDHDIA |
Ga0268314_10284712 | 3300028061 | Phyllosphere | MGNGFQKLQNTLAMANIDLAIIMPTPEAPKNPVRAQNEANDAWAIREKAHDIAWTK |
Ga0268347_10275771 | 3300028142 | Phyllosphere | MGNVFQKLQIALAMANIDLAITMPAPEELENTVRIQNKANDAWAIRGIAHDVA |
Ga0268324_10238272 | 3300028251 | Phyllosphere | MGNDFQKLRIALTMANIDSAIIMPAPEEPENPVRAQNEADDAWAIREKAHDIA |
Ga0268316_10244181 | 3300028253 | Phyllosphere | NGFQKLQIALTMANIDLAIIMPAPEAPKNHVRTQNEADDAWAIREKAHDIAWTK |
Ga0268317_10054072 | 3300028468 | Phyllosphere | MGNDFQKLRIALTMATIDSAIIMLALEEPENPVRAQNEADDAWAIREKDHDIA |
Ga0268329_10096621 | 3300028476 | Phyllosphere | MGNDFQKLRIALTMANIDSAIIMPAPEEPENPLRVQNEADDAWAIREKAHDIA |
Ga0268309_10090841 | 3300028477 | Phyllosphere | MGNNFQKSQIALGLAIIDLAIIMPAPQEPENPVRAQNEADDAWAIRESP |
Ga0214492_10691262 | 3300032464 | Switchgrass Phyllosphere | MENNFQKSQIDMAMAHIDLAIIMPAPEEPENLVRAENEADDAWTIRGKAYDITXTKWDYQ |
Ga0214493_10003892 | 3300032465 | Switchgrass Phyllosphere | MARTMENNFQKSQIDMAMAHIDLAIIMPAPEEPENLVRAENEADDAWTIRGKAYDIT |
Ga0214493_10482701 | 3300032465 | Switchgrass Phyllosphere | MGNYFQKSQIDLAMANIDLTIIMPAPEEPENPVRAQNEADDAWTIRGKAYDIA |
Ga0214503_11001022 | 3300032466 | Switchgrass Phyllosphere | MARTMGNNFQKSQIDLAMVSIDLAIIMPAPEEPENLVMAQNEADDAWTIRGKAYDIA |
Ga0214488_10645283 | 3300032467 | Switchgrass Phyllosphere | MENNFQKSQIDLAMAHIDLAIIIPAPEEPENPVRAQNEADDAWTIRGKAYDIAXTKLDYQQAR |
Ga0214491_10279841 | 3300032469 | Switchgrass Phyllosphere | MGNDFQKLRIALTMANIDSAIILPAPEEPENPVRAQNEADDAWAIREKDHDIA |
Ga0214491_10416331 | 3300032469 | Switchgrass Phyllosphere | MGNYFQKSQIDLAMANIDLTIIMPAPEEPENPVRAQNEADDAWTIRGKAYDIAXTKLDYQQAR |
Ga0214495_10077064 | 3300032490 | Switchgrass Phyllosphere | MARTMGNNFQKSQIDLAMVNIDLAIIMPAPEEPENLVMAQNEADNAWTIRGKAYDIA |
Ga0214495_10842731 | 3300032490 | Switchgrass Phyllosphere | MGNGFQKLQNTLAMANIDLAIIMPAPEESENLVMAQNEADDAWTIRGKAYDIA |
Ga0214490_10398883 | 3300032502 | Switchgrass Phyllosphere | MGNYFQKSQIDLAMANIDLTIIMPAPEEPENPVRAQNEADDAWTIRGKAYDIAXTKWDYQQAR |
Ga0214502_10921542 | 3300032514 | Switchgrass Phyllosphere | MGNNFQKSQIDLAMVNIDLAIIMPAPEEPENLVMAQNKADDAWTIRGKAYDIA |
Ga0321340_10223352 | 3300032550 | Switchgrass Phyllosphere | MENNFQKSQIDLAMAHIDLAIIMPAPEEPENPVRAQNEADDAWTIRGKAYDIAXTKWDYQQAR |
Ga0321339_10346382 | 3300032551 | Switchgrass Phyllosphere | MGNNFQKSQIDLAMVNIDLAIIMPAPEEPENLVMAQNEADDAWTIRGKAYDIAXTNWDYQQAR |
Ga0214500_12019841 | 3300032589 | Switchgrass Phyllosphere | MGNNFQKSQIDLAMVNIDLAIIMPAPEEPENLVMAQNEADNAWTIRGKAYDIAXTNWDYQQAR |
Ga0214489_10042193 | 3300032590 | Switchgrass Phyllosphere | MARTMGNNFQKSQIDLAMVNIDLAIIMPAPEEPENLVMAQNEADDAWTIRGKAYDIT |
Ga0214484_100030510 | 3300032591 | Switchgrass Phyllosphere | MTRIMGNGFQKLQIALAMTNIDLAIIMPAPEEPDNSARAQNEADDAWAIRQKAHDIA |
Ga0214484_10075361 | 3300032591 | Switchgrass Phyllosphere | MGNVFQKLQIALAMANIDLAIIMPAPEEPENPVRNQNKANDACAIRGIAHDVA |
Ga0214497_10847102 | 3300032689 | Switchgrass Phyllosphere | MENNFQKSQIDLAMAHIDLAIIIPAPEEPENPVRAQNEADDAWTIRGKAYDIA |
Ga0214485_10393312 | 3300032698 | Switchgrass Phyllosphere | MENNFQKSQIDLAMAHIDLAIIIPAPEEPENPVRAQNEADDAWTIRGKAYDIAXTNWDYQQAR |
Ga0314754_10124783 | 3300032760 | Switchgrass Phyllosphere | MENNFQKSQIDMAMAHIDLAIIMPAPEEPENLVRAENEADDAWTIRGKAYDITXTKWDYQQAR |
Ga0314754_10161853 | 3300032760 | Switchgrass Phyllosphere | MARTMGNGFQKLQIALAMTNIDLVIIMPAPEEPENLVRAQNEADDAWAIREKDHDIA |
Ga0314733_10069334 | 3300032761 | Switchgrass Phyllosphere | MENNFQKSQIDMAMAHIDLAIIMPAPEEPENLVRAQNEADDAWTIRGKAYDITXTKWDYQQAR |
Ga0314740_10616102 | 3300032822 | Switchgrass Phyllosphere | ARTMENNFQKSQIDLAMAHIDLAIIIPAPEEPENPVRAQNEADDAWTIRGKAYDITXTKWDYQQAC |
Ga0314736_10162312 | 3300032843 | Switchgrass Phyllosphere | MGNNFQKSQIDLAMVNIDLAIIMPAPEEPENLVMAQNEADNAWTIRGKAYDIA |
Ga0314743_10063112 | 3300032844 | Switchgrass Phyllosphere | MARTMENNFQKSQIDLAMAHIDLAIIIPAPEEPENPVRAQNEADDAWTIRGKAYDIA |
Ga0314727_10002257 | 3300032845 | Switchgrass Phyllosphere | ARTMGNNFQKSQIDLAMVNIDLAIIMPAPEEPENLVMAQNEADDAWTIRGKAYDIA |
Ga0314751_10766873 | 3300032889 | Switchgrass Phyllosphere | ARTMGNDFQKLRIALTMANIDSAIIMPAPEEPENPVRAQNEADDAWAIREKDHDIA |
Ga0314739_10011885 | 3300032913 | Switchgrass Phyllosphere | MARTMENNFQKSQIDMAMAHIDLAIIMPAPEEPENLVRARNEADDAWTIRGKAYDIT |
Ga0314750_10981952 | 3300032914 | Switchgrass Phyllosphere | MGNGFQKLQNTLAMANIDLAIIMPALEEPENPVRAQNEADDAWTIRGKAYDIAXTKWDYQQAR |
Ga0314734_10050304 | 3300032916 | Switchgrass Phyllosphere | MARTMGNYFQKSQIDLAMANIDLTIIMPAPEEPENPVRAQNEADDAWTIRGKAYDIA |
Ga0314741_10918731 | 3300032934 | Switchgrass Phyllosphere | MENNFQKSQIDMAMAHIDLAIIMPAPEEPKNPMRAQNEADDAWTIRGKAYDIA |
Ga0314738_10855851 | 3300032959 | Switchgrass Phyllosphere | MENNFQKSQIDMAMAHIDLAIIMPAPEEPENLVRAENEADDAWTIRGKAYDIA |
Ga0314761_10083174 | 3300033526 | Switchgrass Phyllosphere | MENNFQKSQIDMAMAHIDLAIIMPAPEEPENLVRARNEADDAWTIRGKAYDITXTKWDYQQAR |
Ga0314761_10251681 | 3300033526 | Switchgrass Phyllosphere | GTMGNGFQKLQIALAMTNIDLVIIMPAPEEPENLVRAQNEADDAWAIREKDHDIA |
Ga0314760_10593902 | 3300033530 | Switchgrass Phyllosphere | MGNNFQKSQIDLAMVNIDLAIIMPAPEEPENLVMAQNEADDAWTIRGKAYDIA |
Ga0314756_10276672 | 3300033531 | Switchgrass Phyllosphere | MENNFQKSQIDLAMAHIDLAIIMPAPEEPENLVMAQNEADDAWTIRGKAYDIAXTNWDYQQAR |
Ga0314770_11766051 | 3300033533 | Switchgrass Phyllosphere | MENNFQKSQIDMAMAHIDLAIIMPAPEEPENLVRARNEADDAWTIRGKAYDITXTKWDYQQAC |
Ga0314757_10865622 | 3300033534 | Switchgrass Phyllosphere | MGNNFQKSQIDLAMVNIALAIIMPAPEEPENLVMAQNEADDAWTIRGKAYDIAXTNWDYQQAR |
⦗Top⦘ |