NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F087950

Metagenome / Metatranscriptome Family F087950

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F087950
Family Type Metagenome / Metatranscriptome
Number of Sequences 110
Average Sequence Length 45 residues
Representative Sequence MQCWINGPATGGIDDKIKMVNILLKTNIPSFHPSIIPFPG
Number of Associated Samples 56
Number of Associated Scaffolds 110

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 56.48 %
% of genes near scaffold ends (potentially truncated) 80.91 %
% of genes from short scaffolds (< 2000 bps) 83.64 %
Associated GOLD sequencing projects 48
AlphaFold2 3D model prediction Yes
3D model pTM-score0.35

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (83.636 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment
(16.364 % of family members)
Environment Ontology (ENVO) Unclassified
(39.091 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(39.091 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 23.53%    β-sheet: 0.00%    Coil/Unstructured: 76.47%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.35
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 110 Family Scaffolds
PF00730HhH-GPD 3.64
PF00724Oxidored_FMN 2.73
PF00441Acyl-CoA_dh_1 1.82
PF13491FtsK_4TM 1.82
PF07690MFS_1 1.82
PF08359TetR_C_4 1.82
PF01594AI-2E_transport 1.82
PF00654Voltage_CLC 1.82
PF09853DUF2080 1.82
PF01546Peptidase_M20 1.82
PF01261AP_endonuc_2 0.91
PF01558POR 0.91
PF05221AdoHcyase 0.91
PF02665Nitrate_red_gam 0.91
PF02776TPP_enzyme_N 0.91
PF16925TetR_C_13 0.91
PF03190Thioredox_DsbH 0.91
PF00248Aldo_ket_red 0.91
PF07969Amidohydro_3 0.91
PF01850PIN 0.91
PF08173YbgT_YccB 0.91
PF12728HTH_17 0.91
PF11870LutB_C 0.91
PF01012ETF 0.91
PF08352oligo_HPY 0.91
PF06253MTTB 0.91
PF05544Pro_racemase 0.91
PF13447Multi-haem_cyto 0.91
PF00815Histidinol_dh 0.91
PF08734GYD 0.91
PF13188PAS_8 0.91
PF13193AMP-binding_C 0.91
PF13378MR_MLE_C 0.91
PF02873MurB_C 0.91
PF13185GAF_2 0.91
PF01039Carboxyl_trans 0.91
PF01661Macro 0.91
PF01297ZnuA 0.91
PF01925TauE 0.91
PF02844GARS_N 0.91
PF04365BrnT_toxin 0.91
PF00206Lyase_1 0.91
PF00582Usp 0.91
PF00496SBP_bac_5 0.91
PF01037AsnC_trans_reg 0.91
PF00149Metallophos 0.91
PF00497SBP_bac_3 0.91
PF00293NUDIX 0.91
PF01975SurE 0.91
PF02457DAC 0.91
PF12787EcsC 0.91
PF02410RsfS 0.91
PF07796DUF1638 0.91
PF07992Pyr_redox_2 0.91
PF13090PP_kinase_C 0.91
PF13174TPR_6 0.91
PF02073Peptidase_M29 0.91
PF04290DctQ 0.91
PF00266Aminotran_5 0.91
PF08668HDOD 0.91
PF028262-Hacid_dh_C 0.91
PF16347DUF4976 0.91

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 110 Family Scaffolds
COG22313-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamilyReplication, recombination and repair [L] 3.64
COG01223-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylaseReplication, recombination and repair [L] 3.64
COG1194Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairsReplication, recombination and repair [L] 3.64
COG0177Endonuclease IIIReplication, recombination and repair [L] 3.64
COG1059Thermostable 8-oxoguanine DNA glycosylaseReplication, recombination and repair [L] 3.64
COG0042tRNA-dihydrouridine synthaseTranslation, ribosomal structure and biogenesis [J] 2.73
COG19022,4-dienoyl-CoA reductase or related NADH-dependent reductase, Old Yellow Enzyme (OYE) familyEnergy production and conversion [C] 2.73
COG0628Predicted PurR-regulated permease PerMGeneral function prediction only [R] 1.82
COG0038H+/Cl- antiporter ClcAInorganic ion transport and metabolism [P] 1.82
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 1.82
COG1309DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmATranscription [K] 1.82
COG2086Electron transfer flavoprotein, alpha and beta subunitsEnergy production and conversion [C] 0.91
COG5598Trimethylamine:corrinoid methyltransferaseCoenzyme transport and metabolism [H] 0.91
COG4890Predicted outer membrane lipoproteinFunction unknown [S] 0.91
COG4799Acetyl-CoA carboxylase, carboxyltransferase componentLipid transport and metabolism [I] 0.91
COG4274Uncharacterized conserved protein, contains GYD domainFunction unknown [S] 0.91
COG3938Proline racemase/hydroxyproline epimeraseAmino acid transport and metabolism [E] 0.91
COG2929Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin systemDefense mechanisms [V] 0.91
COG2309Leucyl aminopeptidase (aminopeptidase T)Amino acid transport and metabolism [E] 0.91
COG0499S-adenosylhomocysteine hydrolaseCoenzyme transport and metabolism [H] 0.91
COG2181Nitrate reductase gamma subunitEnergy production and conversion [C] 0.91
COG2110O-acetyl-ADP-ribose deacetylase (regulator of RNase III), contains Macro domainTranslation, ribosomal structure and biogenesis [J] 0.91
COG0799Ribosomal silencing factor RsfS, regulates association of 30S and 50S subunitsTranslation, ribosomal structure and biogenesis [J] 0.91
COG2025Electron transfer flavoprotein, alpha subunit FixBEnergy production and conversion [C] 0.91
COG0730Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 familyInorganic ion transport and metabolism [P] 0.91
COG0141Histidinol dehydrogenaseAmino acid transport and metabolism [E] 0.91
COG1331Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domainsGeneral function prediction only [R] 0.91
COG0777Acetyl-CoA carboxylase beta subunitLipid transport and metabolism [I] 0.91
COG0151Phosphoribosylamine-glycine ligaseNucleotide transport and metabolism [F] 0.91
COG0496Broad specificity polyphosphatase and 5'/3'-nucleotidase SurEReplication, recombination and repair [L] 0.91
COG1014Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, gamma subunitEnergy production and conversion [C] 0.91
COG0825Acetyl-CoA carboxylase alpha subunitLipid transport and metabolism [I] 0.91
COG0812UDP-N-acetylenolpyruvoylglucosamine reductaseCell wall/membrane/envelope biogenesis [M] 0.91


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms84.55 %
UnclassifiedrootN/A15.45 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001371|BBDRAFT_10439711All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales592Open in IMG/M
3300004023|Ga0055441_10044408All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria994Open in IMG/M
3300004026|Ga0055443_10134189All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium PC51MH44734Open in IMG/M
3300004029|Ga0055442_10315011Not Available540Open in IMG/M
3300005589|Ga0070729_10727820All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria531Open in IMG/M
3300005590|Ga0070727_10331500All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium847Open in IMG/M
3300005612|Ga0070723_10299469All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300005612|Ga0070723_10714308All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria509Open in IMG/M
3300005830|Ga0074473_10285092All Organisms → cellular organisms → Archaea3246Open in IMG/M
3300005920|Ga0070725_10397499All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont613Open in IMG/M
3300006467|Ga0099972_10604079Not Available564Open in IMG/M
3300006467|Ga0099972_11395754Not Available560Open in IMG/M
3300006467|Ga0099972_12530492All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1236Open in IMG/M
3300006467|Ga0099972_12595936All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont968Open in IMG/M
3300007102|Ga0102541_1049292All Organisms → cellular organisms → Bacteria2417Open in IMG/M
3300007102|Ga0102541_1249285All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria690Open in IMG/M
3300007102|Ga0102541_1443201All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1356Open in IMG/M
3300007784|Ga0102955_1207095All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium PC51MH44560Open in IMG/M
3300008409|Ga0114885_10160All Organisms → cellular organisms → Bacteria6822Open in IMG/M
3300009033|Ga0102956_1013638All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont2467Open in IMG/M
3300009033|Ga0102956_1034445All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1557Open in IMG/M
3300009060|Ga0102962_1045619All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina → Desulfosarcina variabilis1258Open in IMG/M
3300009138|Ga0102959_1030823All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina → unclassified Desulfosarcina → Desulfosarcina sp.1400Open in IMG/M
3300009138|Ga0102959_1064193All Organisms → cellular organisms → Bacteria1035Open in IMG/M
3300009138|Ga0102959_1090193All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium899Open in IMG/M
3300009145|Ga0102961_1043519All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1042Open in IMG/M
3300009145|Ga0102961_1044504All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1032Open in IMG/M
3300010392|Ga0118731_102221299All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria535Open in IMG/M
3300010392|Ga0118731_102926321All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Spirochaeta → unclassified Spirochaeta → Spirochaeta sp.1604Open in IMG/M
3300010392|Ga0118731_103282086Not Available1030Open in IMG/M
3300010392|Ga0118731_103578162All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300010392|Ga0118731_105000208Not Available631Open in IMG/M
3300010392|Ga0118731_105376354All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont648Open in IMG/M
3300010430|Ga0118733_109001484All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria515Open in IMG/M
3300014903|Ga0164321_10405164All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria672Open in IMG/M
3300019712|Ga0193969_1064997All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria500Open in IMG/M
3300019721|Ga0194011_1012083Not Available834Open in IMG/M
3300019739|Ga0194012_1010975All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria927Open in IMG/M
3300021351|Ga0210365_10597325All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2630Open in IMG/M
3300021351|Ga0210365_10683047All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria564Open in IMG/M
3300022202|Ga0224498_10034276All Organisms → cellular organisms → Bacteria1413Open in IMG/M
3300022202|Ga0224498_10040787Not Available1300Open in IMG/M
3300022202|Ga0224498_10066683All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1023Open in IMG/M
3300022217|Ga0224514_10012709All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae2661Open in IMG/M
3300022217|Ga0224514_10186475All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria737Open in IMG/M
3300022217|Ga0224514_10217716All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria684Open in IMG/M
3300022217|Ga0224514_10270153Not Available617Open in IMG/M
3300022217|Ga0224514_10394186All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria514Open in IMG/M
3300022217|Ga0224514_10395144All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300022218|Ga0224502_10013803All Organisms → cellular organisms → Bacteria → Proteobacteria2956Open in IMG/M
3300022218|Ga0224502_10018953All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae2540Open in IMG/M
3300022218|Ga0224502_10023292All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae2295Open in IMG/M
3300022218|Ga0224502_10066311All Organisms → cellular organisms → Bacteria1359Open in IMG/M
3300022218|Ga0224502_10127457All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria971Open in IMG/M
3300022220|Ga0224513_10098775All Organisms → cellular organisms → Bacteria1113Open in IMG/M
3300022220|Ga0224513_10424162All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1538Open in IMG/M
3300022306|Ga0224509_10366309All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria528Open in IMG/M
3300022308|Ga0224504_10353691All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria610Open in IMG/M
3300022391|Ga0210374_1003966All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1937Open in IMG/M
(restricted) 3300024062|Ga0255039_10050962All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1568Open in IMG/M
(restricted) 3300024062|Ga0255039_10345558Not Available639Open in IMG/M
(restricted) 3300024528|Ga0255045_10467238All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont522Open in IMG/M
3300025566|Ga0210140_1039893All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium PC51MH44871Open in IMG/M
3300025974|Ga0210118_1034095Not Available771Open in IMG/M
3300025974|Ga0210118_1045348All Organisms → cellular organisms → Bacteria → Proteobacteria677Open in IMG/M
3300025983|Ga0210106_1012239All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1314Open in IMG/M
3300025991|Ga0210128_1043613All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1720Open in IMG/M
3300026099|Ga0209920_1047674All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria545Open in IMG/M
3300026126|Ga0209957_1018356All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1481Open in IMG/M
3300026131|Ga0209928_1019347All Organisms → cellular organisms → Bacteria1010Open in IMG/M
3300027820|Ga0209578_10564737All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria506Open in IMG/M
3300027828|Ga0209692_10115629Not Available1299Open in IMG/M
3300027845|Ga0209271_10063915Not Available1528Open in IMG/M
3300027845|Ga0209271_10146050All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria971Open in IMG/M
3300027845|Ga0209271_10241874All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont729Open in IMG/M
3300027845|Ga0209271_10250845All Organisms → cellular organisms → Bacteria713Open in IMG/M
(restricted) 3300027881|Ga0255055_10006904All Organisms → cellular organisms → Bacteria7189Open in IMG/M
3300027917|Ga0209536_100061711All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria4863Open in IMG/M
3300028600|Ga0265303_10927271All Organisms → cellular organisms → Bacteria719Open in IMG/M
3300032136|Ga0316201_10278050All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1450Open in IMG/M
3300032136|Ga0316201_10583068All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria956Open in IMG/M
3300032231|Ga0316187_10015474All Organisms → cellular organisms → Bacteria6377Open in IMG/M
3300032231|Ga0316187_10211325All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1496Open in IMG/M
3300032231|Ga0316187_11104729All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium580Open in IMG/M
3300032251|Ga0316198_10751115All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont520Open in IMG/M
3300032252|Ga0316196_10258661All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium763Open in IMG/M
3300032252|Ga0316196_10350713All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae636Open in IMG/M
3300032258|Ga0316191_10109615Not Available2022Open in IMG/M
3300032258|Ga0316191_10112898All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1989Open in IMG/M
3300032258|Ga0316191_10130086All Organisms → cellular organisms → Bacteria → Proteobacteria1841Open in IMG/M
3300032258|Ga0316191_10731910All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium717Open in IMG/M
3300032259|Ga0316190_10059221All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2716Open in IMG/M
3300032259|Ga0316190_10303317All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1093Open in IMG/M
3300032259|Ga0316190_10615056Not Available725Open in IMG/M
3300032260|Ga0316192_10230570All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1282Open in IMG/M
3300032260|Ga0316192_10278949All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1152Open in IMG/M
3300032260|Ga0316192_10966082All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria570Open in IMG/M
3300032262|Ga0316194_10087002All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2022Open in IMG/M
3300032262|Ga0316194_10241554All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetes bacterium DG_611151Open in IMG/M
3300032262|Ga0316194_10264284All Organisms → cellular organisms → Bacteria → Proteobacteria1095Open in IMG/M
3300032262|Ga0316194_10760320All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria610Open in IMG/M
3300032262|Ga0316194_10874442All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria566Open in IMG/M
3300032272|Ga0316189_10094579All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatirhabdium → Desulfatirhabdium butyrativorans2448Open in IMG/M
3300032272|Ga0316189_10391101All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1076Open in IMG/M
3300033429|Ga0316193_10156394All Organisms → cellular organisms → Bacteria → Proteobacteria1799Open in IMG/M
3300033429|Ga0316193_10389125All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1108Open in IMG/M
3300033429|Ga0316193_10654341Not Available837Open in IMG/M
3300033429|Ga0316193_10821139All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria740Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment16.36%
Worm BurrowEnvironmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow15.45%
SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Sediment12.73%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment10.91%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil10.91%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine9.09%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands7.27%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment2.73%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine2.73%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater2.73%
Marine SedimentEngineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Marine Sediment2.73%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)1.82%
Marine SedimentEnvironmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment0.91%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.91%
Marine EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine0.91%
Marine SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment0.91%
SedimentEnvironmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment0.91%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001371Baker-B-sedEnvironmentalOpen in IMG/M
3300004023Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordA_D2EnvironmentalOpen in IMG/M
3300004026Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordC_D2EnvironmentalOpen in IMG/M
3300004029Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordB_D2EnvironmentalOpen in IMG/M
3300005589Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2EnvironmentalOpen in IMG/M
3300005590Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2EnvironmentalOpen in IMG/M
3300005612Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2EnvironmentalOpen in IMG/M
3300005830Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBMEnvironmentalOpen in IMG/M
3300005920Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.2EnvironmentalOpen in IMG/M
3300006467Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935EnvironmentalOpen in IMG/M
3300007102Combined Assembly of Marine Sediment Inoculum and EnrichmentsEngineeredOpen in IMG/M
3300007784Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_D1_MGEnvironmentalOpen in IMG/M
3300008409Coastal sediment microbial communities from intertidal sand flat, Janssand, Germany_1868_binCEnvironmentalOpen in IMG/M
3300009033Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_D2_MGEnvironmentalOpen in IMG/M
3300009060Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_D2_MGEnvironmentalOpen in IMG/M
3300009138Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_D2_MGEnvironmentalOpen in IMG/M
3300009145Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_D1_MGEnvironmentalOpen in IMG/M
3300010392Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385EnvironmentalOpen in IMG/M
3300010430Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samplesEnvironmentalOpen in IMG/M
3300014903Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay12, Core 4567-28, 21-24 cmEnvironmentalOpen in IMG/M
3300019712Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_5-6_MGEnvironmentalOpen in IMG/M
3300019721Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLC_7-8_MGEnvironmentalOpen in IMG/M
3300019739Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLC_8-9_MGEnvironmentalOpen in IMG/M
3300021351Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.637 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022202Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_21EnvironmentalOpen in IMG/M
3300022217Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_24EnvironmentalOpen in IMG/M
3300022218Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_13EnvironmentalOpen in IMG/M
3300022220Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_21EnvironmentalOpen in IMG/M
3300022306Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_24EnvironmentalOpen in IMG/M
3300022308Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_24EnvironmentalOpen in IMG/M
3300022391Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.765 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024062 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1EnvironmentalOpen in IMG/M
3300024528 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_23EnvironmentalOpen in IMG/M
3300025566Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025974Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Tolay_CordA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025983Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Tolay_CordC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025991Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Tolay_CordB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026099Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_D1_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026126Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_D2_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026131Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_D2_MG (SPAdes)EnvironmentalOpen in IMG/M
3300027820Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 (SPAdes)EnvironmentalOpen in IMG/M
3300027828Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2 (SPAdes)EnvironmentalOpen in IMG/M
3300027845Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 (SPAdes)EnvironmentalOpen in IMG/M
3300027881 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_27EnvironmentalOpen in IMG/M
3300027917Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes)EnvironmentalOpen in IMG/M
3300028600Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160317 (Illumina Assembly)EnvironmentalOpen in IMG/M
3300032136Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrowEnvironmentalOpen in IMG/M
3300032231Coastal sediment microbial communities from Maine, United States - Cross River worm burrow 1EnvironmentalOpen in IMG/M
3300032251Coastal sediment microbial communities from Oude Bieten Haven, Netherlands - site A anoxicEnvironmentalOpen in IMG/M
3300032252Coastal sediment microbial communities from Maine, United States - Eddy sediment 2 cmEnvironmentalOpen in IMG/M
3300032258Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 cmEnvironmentalOpen in IMG/M
3300032259Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2EnvironmentalOpen in IMG/M
3300032260Coastal sediment microbial communities from Maine, United States - Merrow Island worm burrowEnvironmentalOpen in IMG/M
3300032262Coastal sediment microbial communities from Maine, United States - Cross River sediment 1EnvironmentalOpen in IMG/M
3300032272Coastal sediment microbial communities from Maine, United States - Lowes Cove worm burrowEnvironmentalOpen in IMG/M
3300033429Coastal sediment microbial communities from Maine, United States - Merrow Island sediment 2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
BBDRAFT_1043971113300001371Marine EstuarineMQCWINGPTTGGIDDKIKMAIILLTTNIPAFHYSIIPFSG
Ga0055441_1004440813300004023Natural And Restored WetlandsMQCWINGPAGGIDDKIQMANILLKTNIPTFHHSIIPFRGKFGSTKKPL
Ga0055443_1013418913300004026Natural And Restored WetlandsMGFGMMQCWINGSATGGSDDNIKMVNILLKTNIPSFHPSII
Ga0055442_1031501123300004029Natural And Restored WetlandsMQCWINDLATGGIDDKIKMAIILLKTNIPVFHHSIIPFPGQIRKP*
Ga0070729_1072782013300005589Marine SedimentMQCWINGPATGGIDDKIKMAIILLKTNIPAFHHSIIPFSGQI
Ga0070727_1033150013300005590Marine SedimentMQCWINGSATGGIDDKIKMVNILLKTNIPSFHPSIIPFPG
Ga0070723_1029946913300005612Marine SedimentMQCWINGPATGGIDDKIKMVNILLKTNIPSFHPSIIPFPG
Ga0070723_1071430813300005612Marine SedimentMVSGVMQCWINVPATDGIEDKIKMAFFLLKTNIPAFHHSIIPFSGQIRNPK*
Ga0074473_1028509233300005830Sediment (Intertidal)MMMQCWVNGPANDAIGDKIKMAYILLKTNIPSFQHSIIPFSGQI*
Ga0074473_1060018353300005830Sediment (Intertidal)MQCWINGPATDGIDEKIKMASILLKTNIPTFLHFIIPFSGQIRKPQKNLYILSRL*
Ga0070725_1039749923300005920Marine SedimentMQYWINGPATGGIDDKIKMANILLKTNIPSFQYSIIPFSGQI
Ga0099972_1060407923300006467MarineMGSGMMQCWINGPATGGIDDKLKMVNILLKTNIPSFHPSIIPF
Ga0099972_1139575413300006467MarineTDGIEDKIKMAFFLLKTNIPAFHHSIIPFSGQIRNPK*
Ga0099972_1253049223300006467MarineMGSGIMQCWINGPATGGIDDKIKMAIILLKTNIPGFH
Ga0099972_1259593613300006467MarineMGSGIMQYWINGPATGGIDDKIKMANILLKTNIPS
Ga0102541_104929213300007102Marine SedimentPCWMNGPATDGIDDKLKTVNILLKTNIPLFHCSIIPIVSEAN*
Ga0102541_124928523300007102Marine SedimentMQCWINVPATGGNDDKIKMANILLKTNIPAFHHSIIPFSEQIRKPQN
Ga0102541_144320123300007102Marine SedimentMGFGMMQCLINGPATGGIDDKIKMVNILLKTNIPSFHPSIIPFPG
Ga0102955_120709513300007784SoilMGFGMMQCWINGSATGGSDDNIKMVNILLKTNIPS
Ga0114885_1016033300008409SedimentMQYWINGPASGGIDDKIKMVNILLKTNIPSFHHSIIPFPG*
Ga0102956_101363813300009033SoilMQCWINDLATGGIDDKIKMAIILLKTNIPVFHHSIIPFSGQIRK
Ga0102956_103444513300009033SoilGMMQCWINGPATGGIDDKIKRVNILLKTNIPSFHPSIIPFPGQIRMPQKNLFILSRL*
Ga0102962_104561913300009060SoilQCWINGPATGGIDDKIKMVNILLKTNIPSFHPSIIPFPEKIRRPKKSPYSQ*
Ga0102959_103082313300009138SoilGIMGFGIMQCRINGKIHIDDKIKMVKILLKTNIPSFHHSIIPFPRQIRKP*
Ga0102959_106419323300009138SoilMGFGMMQCWINGPATGGIDDKIKMVNIILKTNIPSFHPSIIPFPGQIQNPKKPPYSQ*
Ga0102959_109019323300009138SoilMMQCWINGPATGGIDDKIKMVNILLKTNIPSFHPSIIPFPGKIRKPQK
Ga0102961_104351923300009145SoilATSGIDDKIKMVNILLKTNIPSFHPSIIPFPEKIRRPKKSPYSQ*
Ga0102961_104450423300009145SoilMGSGIMQCWIDGSASGGIDGNIKMAIILLKTNIPA
Ga0118731_10222129923300010392MarineMGSGMMKCWNNGPATGGIDDKIKMVNILLKTNIPSFHHSIIPFPGQI*
Ga0118731_10292632133300010392MarineMQCWINGPATGGIDDKIKMANILLKTNIPSFQYSIIPFSGQIR
Ga0118731_10328208623300010392MarineMQCWINGPATGGIDDKIKMVNILLKTNIPVFHHSIIPFSGQIRK*
Ga0118731_10357816223300010392MarineMGSGIMQCWSNGPATGGIDDKIKMAIILLKTNIPVIHHSII
Ga0118731_10500020813300010392MarineMQFWVNGSAKGGIDDKIKRTNILLKTNIPSFHHSIIPFPG
Ga0118731_10537635423300010392MarineMQCWINGPATGGIDDKIKMTNILLKTNIPAFHHSIIPFSGKIRKSQK
Ga0118733_10900148413300010430Marine SedimentMQCWINGPATGGIDDKIKMAIILLKTNIPACHYSIIPFPGQIRKPQKT
Ga0164321_1040516423300014903Marine SedimentMQFWINGPATGGIDDKIKMANILLNTNIPSFHHSIIPFLGQIRKPKK
Ga0193969_106499723300019712SedimentMQCWINGPATGGIDDKIKMAIILLKTNIPAFHHSIIPFS
Ga0194011_101208323300019721SedimentMQCWINGPATGGIEGKIIMAIILLKTNIPAFHYSSFGA
Ga0194012_101097513300019739SedimentMGFGKMQCWANGPATEGIGDKIKIAYILLRTNFPEFHHSIIPFSGQI
Ga0210365_1059732543300021351EstuarineMQCWIDNPATGGIDEKIKMASILLKTNIPTFHHFINPFSGQIRKLQKKPLYSQ
Ga0210365_1068304713300021351EstuarineMQCWINGPATSGIDDKIKMAIILLKTNIPAFHHSIIPFSGQIRTPQKISISS
Ga0224498_1003427613300022202SedimentMGFGMMQCWINGPATGGIDDKIKMVNIILKTNIPSFHPSIIPFPGQIQNPKKPPYSQ
Ga0224498_1004078723300022202SedimentMGSGIMQCWINGPATGGIDDKIKMAIILLKINIPAFHHSIIPF
Ga0224498_1006668323300022202SedimentMGFGMMQCLINAPATGGIDDKIKMVNILLKTNIPSFHPSIIPFPEKIRRPK
Ga0224514_1001270913300022217SedimentMMQCWINGPATGGIDDKIKRVNILLKTNIPSFHPSIIPFPGQIRMPQKNLFILSRL
Ga0224514_1018647513300022217SedimentMQCWIDEPITGKIDDKITMAIILLETNIPAFHHSIIPFSGQIRKPQNTYIFSVGC
Ga0224514_1021771613300022217SedimentMQCWINGPATGGIDDKIKMAIILLTTNIPAFQHSTI
Ga0224514_1027015323300022217SedimentTGGIDDKIKMVNILLKTNIPSFHPSIIPFPEKIRRPKKSPYSQ
Ga0224514_1039418613300022217SedimentMQCWINGPATGGIDDKIKMVNILLKTNIPSFHPSIIPFPGKIRKPQK
Ga0224514_1039514413300022217SedimentMQCWINGPAAGGIDDKIKIAIILFKTNIPVFHHSIIPFSGQIRKFRKNH
Ga0224502_1001380343300022218SedimentNGPATGGIDDKLKMVNILLKTNIPAFHPSIIPFPG
Ga0224502_1001895323300022218SedimentMQCLINGPATGGIDDKIKMVKILLKTNIPSFHPSIIPFPEKIRRPKKSPYSQ
Ga0224502_1002329213300022218SedimentMQCWINDPATGGIDDKIKMAIILWENNIPAFHHSIIPFS
Ga0224502_1006631123300022218SedimentMQCWINGPATSGIGDKIKMVNILLKTNIPSFHPSIIPFPGQIRKSQ
Ga0224502_1012745733300022218SedimentMQCWINGPATGAIDDKIKMVDILLKTNIPSFHPSI
Ga0224513_1009877523300022220SedimentMGFGMMQCWINGPATSGIGDKIKMVNILLKTNIPSFHPSIIPFPGQ
Ga0224513_1042416213300022220SedimentMGSGMMQCWINGPATGGIDDKIKMVNILLKTNIPSFHPS
Ga0224509_1036630923300022306SedimentTGGIDYKIKMAIILWKNNIPAFHHSIIPFSGQIRKP
Ga0224504_1035369113300022308SedimentGMVQCWINGPATSGIDDKIKMVNILLKTNIPSFHPSIIPFPEKIRRPKKSPYSQ
Ga0210374_100396623300022391EstuarineMQCWINGPATGGIDDKIKMVNILLKTNIPAFHPSIIPFPGKIRKSQKSPILSIDC
(restricted) Ga0255039_1005096233300024062SeawaterMQCWINCPATSGIDDKVIMANILLKTNIPSFHHSITPF
(restricted) Ga0255039_1034555823300024062SeawaterMQCWINGPATGVIDDKIKMANILLKTNIPAFHHSIIPFPEQIRKPQNNF
(restricted) Ga0255045_1046723813300024528SeawaterMQCWINGPATDGNADKNKMAYILLKTNIPAFHHSITPFSG
Ga0210140_103989313300025566Natural And Restored WetlandsMGFGMMQCWINGSATGGSDDNIKMVNILLKTNIPSFHPSIIPFPGEI
Ga0210118_103409533300025974Natural And Restored WetlandsMGSGIMQCWINGPATGRIDDKIKMAIILLKTNIPAFHHSVIPFLG
Ga0210118_104534823300025974Natural And Restored WetlandsLINGPATGGIDDKIKMVNILLKTNIPSFHPSIIPFPEKIRRPKKSPYSQ
Ga0210106_101223923300025983Natural And Restored WetlandsMQCWINGPATGGIDDKIKMVNILLKTNIPSFHPSIIPFPGKIRKPQKTSIL
Ga0210128_104361313300025991Natural And Restored WetlandsMQCWINGPATGGIDDKIKMAIILLKTNIPAFHHSIIPFSGPIRKPQ
Ga0209920_104767423300026099SoilMGSGMVQCWINGPATSGIDDKIKMVNILLKTNIPSFHPSIIPFPGQI
Ga0209957_101835633300026126SoilMQCWINGPATDGIDDKIKMANILLKTNIPPFHYSISGANS
Ga0209928_101934723300026131SoilMQCWINGPATGGIDDKIKMAIILLKTNIPAFHHSIIPF
Ga0209578_1056473713300027820Marine SedimentMGSGMMQCWINGPATGGIDDKIKMANILLKTNIPSFHHSIIPFPGQIRR
Ga0209692_1011562923300027828Marine SedimentERMMQSWINGPATGGIDDKIKMVNILFKTNIPSLHYSIIPFPRQIRKP
Ga0209271_1006391523300027845Marine SedimentMQCWINGSATGGIDDKIKMVNILLKTNIPSFHPSIIPFPGQIRRP
Ga0209271_1014605013300027845Marine SedimentMQCWINGLATGGFDDKIKMANILLKTNIPSFQYSIIPFSGQIREPQKISIFS
Ga0209271_1024187413300027845Marine SedimentMQCWINGPATGGIDVKIKMANILLKTNIPSFQYSIIPFSGQIRKP
Ga0209271_1025084513300027845Marine SedimentMQCWINDPATGGIDDKLKMVNILLKTNIPSFHPSIIPFPGQIRRPQKTSIFSV
(restricted) Ga0255055_1000690443300027881SeawaterMQCWINVPATNGIDDKIKMAYILLKTNIPEFHHSIIPFSWQFRNPK
Ga0209536_10006171123300027917Marine SedimentMMECWIDNPARGEIEDKIKMATIRLKTNIPSFQHSNIPFSIQIW
Ga0265303_1092727123300028600SedimentMQCWINGPAIDGIDDKIKMAYILLKTNIPTFHHSNIPFSG
Ga0316201_1027805033300032136Worm BurrowMGSGMMQCWINGPATGGIDDKIKMVNILLKTNIPSFHLSIIPFPGQIRRPQKTSIFS
Ga0316201_1058306833300032136Worm BurrowMQCWINGPATGGIDDKLKMVNILLKTNIPAFHPSIIPFPGQIRRPQ
Ga0316187_1001547433300032231Worm BurrowMQYLINGPATGGIDDKIKMVNILLKTNIPSFHPSIIPFPEKIRRPQKSPYSQ
Ga0316187_1021132513300032231Worm BurrowMGFGMMQCLINGPAAGGIDDKIKMVNILLKTNIPSFHPSIIPFPGKIRKPQK
Ga0316187_1110472923300032231Worm BurrowMVQCWINGPATSGIDDKIKMVNILLKTNIPSFHPSI
Ga0316198_1075111523300032251SedimentMQCCNNGPATGGIDDKTKMANILLKTNIPVFHHSIIPF
Ga0316196_1004654933300032252SedimentMQCWINGPATDGINGKILMAIILLKTNIPAFHHSIIPFSRQIRKPPKTSI
Ga0316196_1025866113300032252SedimentMGFGMMQCLINGPAAGGIDDKIKMVNILLKTNIPSFHPSIIPF
Ga0316196_1035071313300032252SedimentMQYWINGPVLGGIDDKIKMAIILLKTNIPAFHHSIIPFSG
Ga0316191_1010961513300032258Worm BurrowMQCWINGPSTGEIDDKIKMAIILLKTNIPAFHYSII
Ga0316191_1011289833300032258Worm BurrowMQCWINGPATGGIDDKLKMVNILLKTNIPAFHPSIIPFPG
Ga0316191_1013008613300032258Worm BurrowMQCLINGPATGGIDDKIKMVNILLKTNIPSFHPSIIPFPEKIRRPKKSPYSQ
Ga0316191_1073191013300032258Worm BurrowMGFGMMQCLINGPAAGGIDDKIKMVNILLKTNIPSFHPSIIPFPGKIRKP
Ga0316190_1005922143300032259Worm BurrowVGSGMMQCWINGPATGGIEDKIKMVNILLKTNNPSFHPSIIPFPGK
Ga0316190_1030331713300032259Worm BurrowMQYLINGPASGGIDDKLKMVNILLKTNVPAFHSSIIPF
Ga0316190_1061505623300032259Worm BurrowMQCWINNPAAVGIDDKIKIAIILLKTNIPAFHHSIIPFPGQ
Ga0316192_1023057013300032260Worm BurrowMQCWINVPATGRVDDNIKMANILLKTNIPSFHRSIV
Ga0316192_1027894923300032260Worm BurrowMQCWINGPATGGSDDNIKMVNILLKTNILAFHPSMIPISGQI
Ga0316192_1096608213300032260Worm BurrowMQCWINGITTGGIDVKIKMAIFLLKTNIPAFHHSIIPFSGQIRKLKNT
Ga0316194_1008700213300032262SedimentMMQCWINGPATGGIDDKIKMVNILLKTNIPSFHPSIIPFPGKIRKPQKTSILSVGC
Ga0316194_1024155423300032262SedimentMQCWINGPAAVGIDDKIKIAISLLKTNIPAFHHSIIPFPGQIRKPQ
Ga0316194_1026428413300032262SedimentMQCWINGSAAVGIDDKIKIAIILLKTNIPAFHHSIIPFPGQIRKPQKTS
Ga0316194_1076032023300032262SedimentMQCWINVPATSGIDDKIKMVIILLKTNIPAFHPSIIPF
Ga0316194_1087444223300032262SedimentMGSEIMQYXINGPATGGIDGKIIIAIIVLKTNIPAFHHSI
Ga0316189_1009457923300032272Worm BurrowMQCWINGPATGGINDKIQMVTIILKTNIPSFHPCIIPFPGQIRKPQKNLHILSRL
Ga0316189_1039110133300032272Worm BurrowMMGFGMMQCLINGPAAGGIDDKIKMVNILLKTNIPSFHPSIIPFPGKIRKPQKIS
Ga0316193_1015639413300033429SedimentWINGPATGGIDDKLKMVNILLKTNIPAFHPSIIPFPR
Ga0316193_1038912513300033429SedimentMQYLINGPASGGIDDKLKMVNILLKTNVPAFHSSIIPFLGHIQRPQ
Ga0316193_1065434123300033429SedimentMKCWVNGPATGGIDDKIKIAIILLKTNIPVFHYSIF
Ga0316193_1082113923300033429SedimentMQCWINGPAADEIDDNINRAYILLKTNIPAFHHPIIPF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.